hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm5c/seq/ZK863.6
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  ZK863.6  CE15445  locus:dpy-30 DPY-30 protein status:Confirmed SW:Q10661 protein_id:CAB01452.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
Dpy-30   Dpy-30 motif                                    79.7    3.3e-20   1
B1       Protein L b1 domain                              3.7        3.5   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
B1         1/1      33    56 ..     1    25 [.     3.7      3.5
Dpy-30     1/1      69   110 ..     1    42 []    79.7  3.3e-20

Alignments of top-scoring domains:
B1: domain 1 of 1, from 33 to 56: score 3.7, E = 3.5
                   *->tPEedskEevtiKanlifadGstqt<-*
                        E +s+E+ t+  n++ a+G  qt
     ZK863.6    33    -AEAESNENTTVPSNVLSANGGQQT    56

Dpy-30: domain 1 of 1, from 69 to 110: score 79.7, E = 3.3e-20
                   *->paRqYLnqtVaPiLlqGLtelAkeRPeDPiefLAeyLlknnn<-*
                      p+RqYL+ tV+PiLlqGL +lAk+RPe+PiefLA++Ll  +
     ZK863.6    69    PTRQYLDSTVVPILLQGLGALAKDRPENPIEFLANFLLREKD    110

[DB home][top]