Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm5a/seq/ZK616.9
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  ZK616.9  CE26344    status:Partially_confirmed TR:Q9N4M7 protein_id:AAF60943.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
SapB_2   Saposin-like type B, region 2                   31.2    1.4e-07   2
SapB_1   Saposin-like type B, region 1                    4.6        7.3   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SapB_2     1/2      85   119 ..     1    35 []    31.7    1e-07
SapB_1     1/1     243   279 ..     1    39 []     4.6      7.3
SapB_2     2/2     284   306 ..     1    23 [.     2.4       60

Alignments of top-scoring domains:
SapB_2: domain 1 of 2, from 85 to 119: score 31.7, E = 1e-07
                   *->sdqCkefVdqYgpliidlLesgldPkevCsklglC<-*
                      ++qC +fV++ +p+i+  +  +++ k+vC+++++C
     ZK616.9    85    KEQCFAFVETSLPEIYYSINYDISSKDVCVRMNFC    119

SapB_1: domain 1 of 1, from 243 to 279: score 4.6, E = 7.3
                   *->dilCelCemvVkevenlLkdnkTqeeIlkaLeklCdlLP<-*
                        +C +Ce + + ++n+      +++I  + + +C++L
     ZK616.9   243    RLTCAFCERMLENAKNYAVTS--KTDITSFANTACASLA    279

SapB_2: domain 2 of 2, from 284 to 306: score 2.4, E = 60
                   *->sdqCkefVdqYgpliidlLesgl<-*
                      sdqC+++ d+   ++ + + +++
     ZK616.9   284    SDQCYQMADKKIAELAKFVDQQV    306



[DB home][top]