hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/K08B12.2a
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  K08B12.2a  CE29814    status:Partially_confirmed TR:O01582 protein_id:AAB52258.2

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N
--------  -----------                                   -----    ------- ---
DM-domain DM DNA binding domain                          99.0    4.7e-26   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
DM-domain   1/1      57   103 ..     1    48 []    99.0  4.7e-26

Alignments of top-scoring domains:
DM-domain: domain 1 of 1, from 57 to 103: score 99.0, E = 4.7e-26
                   *->RipyCqRCenHGekvpLKGHKryCpfrdCtCkkvCtlvekRRrlmal
                      R+++C++Ce+HG++v+LKGH+++Cpf++C+Ck+ Ct+v+++R+++++
   K08B12.2a    57    RTLFCRKCEGHGQQVVLKGHASRCPFNNCSCKT-CTNVMSMRANAII 102

                   q<-*
                   +
   K08B12.2a   103 R    103

[DB home][top]