Motif confirmation by HMMer
hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file: hmm3/seq/F58H1.7
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: F58H1.7 CE20895 low-density lipoprotein receptor status:Confirmed TR:Q18790 protein_id:CAB01419.1
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
ldl_recept_a Low-density lipoprotein receptor domain 42.1 3.1e-11 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
ldl_recept_a 1/1 43 76 .. 9 43 .] 42.1 3.1e-11
Alignments of top-scoring domains:
ldl_recept_a: domain 1 of 1, from 43 to 76: score 42.1, E = 3.1e-11
*->FqCgsgrrCIprswvCDGdpDCeDGSDEslenCaa<-*
F C sg+ C+p++++CDG+pDC D DE C a
F58H1.7 43 FACPSGE-CVPIKYLCDGSPDCSDEYDENKSMCTA 76