Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/F58E6.1a
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F58E6.1a  CE25921   SH2 domain status:Partially_confirmed TR:Q20977 protein_id:CAA94771.2

Scores for sequence family classification (score includes all domains):
Model          Description                              Score    E-value  N
--------       -----------                              -----    ------- ---
zf-C3HC4       Zinc finger, C3HC4 type (RING finger)     58.0    8.3e-20   1
TSC22          TSC-22/dip/bun family                      6.3       0.79   1
Flavi_propep   Flavivirus polyprotein propeptide          5.7        3.2   1
GSH_synthase   Eukaryotic glutathione synthase            4.2        6.9   1
Bac_thur_toxin Bacillus thuringiensis toxin               3.9        3.2   1

Parsed for domains:
Model          Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------       ------- ----- -----    ----- -----      -----  -------
zf-C3HC4         1/1      52    95 ..     1    50 []    58.0  8.3e-20
TSC22            1/1     196   209 ..    47    60 .]     6.3     0.79
Flavi_propep     1/1     316   327 ..    77    88 .]     5.7      3.2
GSH_synthase     1/1     406   431 ..    89   110 .]     4.2      6.9
Bac_thur_toxin   1/1     785   816 ..   204   235 .]     3.9      3.2

Alignments of top-scoring domains:
zf-C3HC4: domain 1 of 1, from 52 to 95: score 58.0, E = 8.3e-20
                   *->CrICleelkepsndfplilpCgHsGslkyfCrsClerWls..gnttv
                      CrIC++ + + +      +pC ++G+++ ++++Cl++W++ ++++t
    F58E6.1a    52    CRICQMHEGDMV------RPCDCAGTMGDVHEECLTKWVNmsNKKT- 91

                   kCplC<-*
                    C++C
    F58E6.1a    92 -CEIC    95

TSC22: domain 1 of 1, from 196 to 209: score 6.3, E = 0.79
                   *->EqLaqlqaqlqlae<-*
                      EqL ++q  lq +e
    F58E6.1a   196    EQLPFIQRTLQICE    209

Flavi_propep: domain 1 of 1, from 316 to 327: score 5.7, E = 3.2
                   *->rCtktgesRRsR<-*
                      +C+ ++ +RRsR
    F58E6.1a   316    KCGEAENHRRSR    327

GSH_synthase: domain 1 of 1, from 406 to 431: score 4.2, E = 6.9
                   *->eARLllErSrA..iKCP..dIstqLa<-*
                      eA L+lErS+A+ +  P +dI+t+++
    F58E6.1a   406    EAKLFLERSFAdlVRHPlsDIPTHVS    431

Bac_thur_toxin: domain 1 of 1, from 785 to 816: score 3.9, E = 3.2
                   *->eVkikaLtfvQpLvssnaapIvDlfnvlnysl<-*
                      eV + a ++v + v+++ a++ Dl  +++ +
    F58E6.1a   785    EVTVPAVRVVRLQVDYRNASVSDLQKIHKWNA    816



[DB home][top]