hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm3/seq/F52H3.4
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F52H3.4  CE03400    status:Partially_confirmed TR:Q20682 protein_id:CAA91324.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
SPK      Domain of unknown function (DUF545)             33.4    4.4e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
SPK        1/1      43    87 ..    69   115 .]    33.4  4.4e-08

Alignments of top-scoring domains:
SPK: domain 1 of 1, from 43 to 87: score 33.4, E = 4.4e-08
                   *->eRvRlMFaLsgkVeddFLerietiGtVeLDekkRIckYtSnDGklkL
                      e+v+++F  + ++++ FL  +++++tV LD+  RI++Y  +DG+l+L
     F52H3.4    43    EMVKVLFLNRTPISEAFLPILRKNATVNLDDDGRIVEY--DDGELEL 87

                   <-*

     F52H3.4     -     -

[DB home][top]