Motif confirmation by HMMer
hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file: hmm3/seq/F47B7.1
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: F47B7.1 CE02743 status:Confirmed SW:Q20516 protein_id:AAA80373.1
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
UPF0057 Uncharacterized protein family UPF0057 107.4 2.7e-28 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
UPF0057 1/1 6 57 .. 1 52 [] 107.4 2.7e-28
Alignments of top-scoring domains:
UPF0057: domain 1 of 1, from 6 to 57: score 107.4, E = 2.7e-28
*->ddiieiILaifLPPlAVfLhkgeCgkhvlInILLtiLgyiPGiIHAl
++iie+ILaifLPPlA+f+h+++C++hv++nI+L++++++P++IHAl
F47B7.1 6 QQIIELILAIFLPPLAIFIHGNDCNMHVAVNIILCFFFFVPAVIHAL 52
yvcff<-*
++cff
F47B7.1 53 WYCFF 57