Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm2/seq/F02E9.4
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  F02E9.4  CE09187  locus:pqn-28  status:Partially_confirmed TR:O01319 protein_id:CAB04052.1

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N
--------  -----------                                   -----    ------- ---
PAH       Paired amphipathic helix repeat                80.5    3.5e-20   1
Nebulin   Nebulin repeat                                  7.8          3   1
CDRN      Cysteine-rich D. radiodurans N-terminus fam     6.8        2.3   1
Replicase Replicase family                                5.4        2.5   1
CHMI      5-carboxymethyl-2-hydroxymuconate isomerase     4.8        1.8   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
PAH         1/1     304   350 ..     1    47 []    80.5  3.5e-20
Nebulin     1/1     514   528 ..    15    29 .]     7.8        3
Replicase   1/1     759   783 ..   232   261 .]     5.4      2.5
CDRN        1/1     997  1018 ..     1    22 [.     6.8      2.3
CHMI        1/1    1020  1027 ..     1     8 [.     4.8      1.8

Alignments of top-scoring domains:
PAH: domain 1 of 1, from 304 to 350: score 80.5, E = 3.5e-20
                   *->pekYneFLeiLndykaeridkpeviarVseLlkghpdLllgFnvFLp
                        +Y+ FLei++d++a+ri++p+vi++V+eLl+++p+L+lgFn+FLp
     F02E9.4   304    VPVYHRFLEIMKDFRAQRIETPDVIEQVAELLYDSPELVLGFNTFLP 350

                   <-*

     F02E9.4     -     -

Nebulin: domain 1 of 1, from 514 to 528: score 7.8, E = 3
                   *->qSdvkYKedyEkeKg<-*
                      +Sd +YK+d Ek ++
     F02E9.4   514    MSDQQYKKDMEKLRK    528

Replicase: domain 1 of 1, from 759 to 783: score 5.4, E = 2.5
                   *->tiwgrchRgdgqlvyeatlpeiQaarGRkg<-*
                      +++      d+++v + +lp+iQ++rG +
     F02E9.4   759    RPEN-----DMDAVMRKDLPAIQPKRGLRD    783

CDRN: domain 1 of 1, from 997 to 1018: score 6.8, E = 2.3
                   *->rllsasLEqFsELrvRRnstAt<-*
                      ++l+ ++Eq +E r++ nst t
     F02E9.4   997    KPLVNQIEQICEERRKNNSTDT    1018

CHMI: domain 1 of 1, from 1020 to 1027: score 4.8, E = 1.8
                   *->PHlilEct<-*
                      PHlilE+t
     F02E9.4  1020    PHLILEYT    1027



[DB home][top]