Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/C33A11.1
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  C33A11.1  CE24824   Ank repeat status:Partially_confirmed TR:Q93318 protein_id:CAB01860.2

Scores for sequence family classification (score includes all domains):
Model     Description                                   Score    E-value  N
--------  -----------                                   -----    ------- ---
ank       Ankyrin repeat                                 84.1    3.7e-22   4
Chorion_2 Chorion family 2                                4.1        5.5   1

Parsed for domains:
Model     Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
--------  ------- ----- -----    ----- -----      -----  -------
Chorion_2   1/1     184   195 ..   175   191 .]     4.1      5.5
ank         1/4     375   389 ..     1    15 [.     9.8     0.53
ank         2/4     417   449 ..     1    33 []    31.6  3.3e-07
ank         3/4     452   485 ..     1    33 []    18.7   0.0016
ank         4/4     486   530 ..     1    33 []    23.9  5.3e-05

Alignments of top-scoring domains:
Chorion_2: domain 1 of 1, from 184 to 195: score 4.1, E = 5.5
                   *->DVPAgAGqLSYGyGqga<-*
                      D+ A+     +GyG+g+
    C33A11.1   184    DISAY-----TGYGSGY    195

ank: domain 1 of 4, from 375 to 389: score 9.8, E = 0.53
                   *->dGnTPLHlAakrgnl<-*
                      dG+TPLH+ a +++l
    C33A11.1   375    DGDTPLHIVAAHNDL    389

ank: domain 2 of 4, from 417 to 449: score 31.6, E = 3.3e-07
                   *->dGnTPLHlAakrgnlevvklLlqrGAdlnaqdd<-*
                       G+TPL +A++  ++evv++Ll+ GA++n +
    C33A11.1   417    FGETPLYVAVLQRSIEVVEYLLELGASPNSRSS    449

ank: domain 3 of 4, from 452 to 485: score 18.7, E = 0.0016
                   *->dGnTPLHlAakrgnlevvklLlq.rGAdlnaqdd<-*
                       G++PLH A  rg +++v+ Ll++r   +n ++d
    C33A11.1   452    VGDSPLHFATARGMNNMVEALLSkREIRVNETND    485

ank: domain 4 of 4, from 486 to 530: score 23.9, E = 5.3e-05
                   *->dGnTPLHlAakrg............nlevvklLlqrGAdlnaqdd<-
                      dG+T L +A+k+ +  ++ + ++ +n++++++L+++GAd+ +
    C33A11.1   486    DGQTSLLCAVKMHgmmdeqtqhkidNKSIIEMLIKAGADPTIAET   530

                   *

    C33A11.1     -   -



[DB home][top]