Motif confirmation by HMMer


hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file:                 /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file:            hmm1/seq/C06G3.6
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query:  C06G3.6  CE07982   zinc finger protein status:Partially_confirmed TR:Q17746 protein_id:AAB03135.1

Scores for sequence family classification (score includes all domains):
Model    Description                                    Score    E-value  N
-------- -----------                                    -----    ------- ---
ZZ       Zinc finger, ZZ type                            37.8    2.1e-08   1

Parsed for domains:
Model    Domain  seq-f seq-t    hmm-f hmm-t      score  E-value
-------- ------- ----- -----    ----- -----      -----  -------
ZZ         1/1     190   233 ..     1    46 []    37.8  2.1e-08

Alignments of top-scoring domains:
ZZ: domain 1 of 1, from 190 to 233: score 37.8, E = 2.1e-08
                   *->ihkvytCdgCkeapiigvRYhClrCsdYDLCqsCfstGhkagkHkm<
                        ++++Cd+C    iig R++C++C +YDLC  C+ +  +++ H
     C06G3.6   190    EVHEASCDKCQD-LIIGHRFKCAICYNYDLCETCEAA-GVHAQHAL  233

                   -*

     C06G3.6     -    -



[DB home][top]