Motif confirmation by HMMer
hmmpfam - search a single seq against HMM database
HMMER 2.1.1 (Dec 1998)
Copyright (C) 1992-1998 Washington University School of Medicine
HMMER is freely distributed under the GNU General Public License (GPL).
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/niguts/usr02/tshini/ykclst/db/Pfam_fs
Sequence file: hmm1/seq/C06G3.6
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query: C06G3.6 CE07982 zinc finger protein status:Partially_confirmed TR:Q17746 protein_id:AAB03135.1
Scores for sequence family classification (score includes all domains):
Model Description Score E-value N
-------- ----------- ----- ------- ---
ZZ Zinc finger, ZZ type 37.8 2.1e-08 1
Parsed for domains:
Model Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
ZZ 1/1 190 233 .. 1 46 [] 37.8 2.1e-08
Alignments of top-scoring domains:
ZZ: domain 1 of 1, from 190 to 233: score 37.8, E = 2.1e-08
*->ihkvytCdgCkeapiigvRYhClrCsdYDLCqsCfstGhkagkHkm<
++++Cd+C iig R++C++C +YDLC C+ + +++ H
C06G3.6 190 EVHEASCDKCQD-LIIGHRFKCAICYNYDLCETCEAA-GVHAQHAL 233
-*
C06G3.6 - -