Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK596_1
(726 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17544598|ref|NP_502026.1| keratin-like protein precursor fami... 271 1e-71
gi|39593662|emb|CAE61954.1| Hypothetical protein CBG05953 [Caeno... 202 4e-51
gi|17538834|ref|NP_501448.1| keratin-like protein family member ... 131 2e-29
gi|39581341|emb|CAE71550.1| Hypothetical protein CBG18497 [Caeno... 124 2e-27
gi|17539818|ref|NP_502023.1| predicted CDS, keratin-like protein... 115 9e-25
gi|39593657|emb|CAE61949.1| Hypothetical protein CBG05948 [Caeno... 113 3e-24
gi|39593658|emb|CAE61950.1| Hypothetical protein CBG05949 [Caeno... 111 1e-23
gi|17538832|ref|NP_501449.1| keratin-like protein family member ... 101 1e-20
gi|39593708|emb|CAE62000.1| Hypothetical protein CBG06008 [Caeno... 101 1e-20
gi|17566876|ref|NP_503259.1| predicted CDS, prion-like Q/N-rich ... 94 4e-18
gi|17566882|ref|NP_503262.1| prion-like Q/N-rich domain protein ... 94 4e-18
gi|17541554|ref|NP_502073.1| keratin-like protein precursor fami... 93 6e-18
gi|39581340|emb|CAE71549.1| Hypothetical protein CBG18492 [Caeno... 91 3e-17
gi|39593659|emb|CAE61951.1| Hypothetical protein CBG05950 [Caeno... 89 7e-17
gi|15636811|dbj|BAB68205.1| keratin-like protein [Nippostrongylu... 88 2e-16
gi|17542216|ref|NP_502075.1| keratin-like protein family member ... 88 2e-16
gi|39593709|emb|CAE62001.1| Hypothetical protein CBG06009 [Caeno... 87 3e-16
gi|17555122|ref|NP_497250.1| keratin-like protein precursor fami... 86 6e-16
gi|17563130|ref|NP_503226.1| keratin-like protein family member ... 86 6e-16
gi|39586121|emb|CAE69197.1| Hypothetical protein CBG15236 [Caeno... 86 1e-15
gi|39581427|emb|CAE74709.1| Hypothetical protein CBG22524 [Caeno... 86 1e-15
gi|39583756|emb|CAE63860.1| Hypothetical protein CBG08422 [Caeno... 81 2e-14
gi|17542540|ref|NP_502644.1| immunodominant hypodermal antigen-r... 77 4e-13
gi|17563132|ref|NP_503225.1| prion-like Q/N-rich domain protein ... 76 6e-13
gi|17539810|ref|NP_502024.1| keratin-like protein precursor fami... 76 6e-13
gi|17537745|ref|NP_494033.1| keratin-like protein family member ... 74 4e-12
gi|17544658|ref|NP_502257.1| keratin-like protein family member ... 72 9e-12
gi|39582650|emb|CAE73754.1| Hypothetical protein CBG21288 [Caeno... 71 2e-11
gi|17538922|ref|NP_502467.1| keratin-like protein family member ... 70 6e-11
gi|39593707|emb|CAE61999.1| Hypothetical protein CBG06007 [Caeno... 67 5e-10
gi|39593853|emb|CAE62146.1| Hypothetical protein CBG06192 [Caeno... 66 8e-10
gi|18496163|emb|CAD22110.1| keratin [Ostertagia ostertagi] 62 9e-09
gi|17541552|ref|NP_502072.1| keratin-like protein family member ... 60 3e-08
gi|39593854|emb|CAE62147.1| Hypothetical protein CBG06193 [Caeno... 60 6e-08
gi|17538928|ref|NP_502470.1| immunodominant hypodermal antigen-r... 59 1e-07
gi|17538924|ref|NP_502468.1| keratin-like protein precursor fami... 58 2e-07
gi|39580304|emb|CAE56039.1| Hypothetical protein CBG23605 [Caeno... 51 2e-05
gi|39580305|emb|CAE56040.1| Hypothetical protein CBG23606 [Caeno... 51 2e-05
gi|39584364|emb|CAE65528.1| Hypothetical protein CBG10504 [Caeno... 51 2e-05
gi|39584365|emb|CAE65529.1| Hypothetical protein CBG10505 [Caeno... 51 2e-05
gi|39584362|emb|CAE65526.1| Hypothetical protein CBG10502 [Caeno... 51 2e-05
gi|39580301|emb|CAE56036.1| Hypothetical protein CBG23602 [Caeno... 51 2e-05
gi|39584363|emb|CAE65527.1| Hypothetical protein CBG10503 [Caeno... 50 4e-05
gi|39589965|emb|CAE60963.1| Hypothetical protein CBG04695 [Caeno... 49 8e-05
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa... 44 9e-05
gi|33300517|emb|CAE18022.1| Hypothetical protein Y57G11C.39 [Cae... 49 1e-04
gi|21280508|gb|AAM45145.1| L3B25 [Teladorsagia circumcincta] >gn... 45 0.001
gi|23481000|gb|EAA17411.1| ELM2 domain, putative [Plasmodium yoe... 45 0.001
gi|50552886|ref|XP_503853.1| hypothetical protein [Yarrowia lipo... 45 0.001
gi|39583474|emb|CAE73932.1| Hypothetical protein CBG21549 [Caeno... 45 0.002
gi|17539822|ref|NP_502022.1| putative secreted or extracellular ... 45 0.002
gi|39983642|gb|AAR35032.1| SXP/RAL-2 protein [Meloidogyne incogn... 45 0.002
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli... 44 0.003
gi|39578843|emb|CAE57088.1| Hypothetical protein CBG24988 [Caeno... 44 0.003
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 42 0.010
gi|23612286|ref|NP_703866.1| cleavage stimulation factor subunit... 42 0.010
gi|22788775|ref|NP_690487.1| hypothetical protein HZV_68 [Heliot... 42 0.013
gi|50310441|ref|XP_455240.1| unnamed protein product [Kluyveromy... 42 0.013
gi|23508683|ref|NP_701352.1| antigen 332, putative [Plasmodium f... 42 0.017
gi|33300612|emb|CAE18041.1| Hypothetical protein Y67A10A.10 [Cae... 42 0.017
gi|39593626|emb|CAE61918.1| Hypothetical protein CBG05914 [Caeno... 41 0.022
gi|13508497|gb|AAF15293.3| erythrocyte membrane-associated giant... 41 0.028
gi|39593540|emb|CAE61832.1| Hypothetical protein CBG05802 [Caeno... 41 0.028
gi|47211556|emb|CAF92350.1| unnamed protein product [Tetraodon n... 41 0.028
gi|5669894|gb|AAD46501.1| latent nuclear antigen [Human herpesvi... 41 0.028
gi|23482369|gb|EAA18370.1| malaria antigen [Plasmodium yoelii yo... 40 0.037
gi|46444424|gb|EAL03699.1| hypothetical protein CaO19.9118 [Cand... 40 0.037
gi|1518119|gb|AAB07017.1| AsSLR8.97 [Ascaris suum] 40 0.037
gi|50758276|ref|XP_415843.1| PREDICTED: similar to KIAA1047 prot... 40 0.048
gi|1685360|gb|AAB52722.1| chitinase [Entamoeba dispar] 40 0.048
gi|50555796|ref|XP_505306.1| hypothetical protein [Yarrowia lipo... 40 0.048
gi|26000370|gb|AAN75483.1| dentin matrix protein 1 [Thyroptera t... 40 0.048
gi|23613492|ref|NP_703336.1| P. falciparum RESA-like protein wit... 40 0.048
gi|4154097|gb|AAD04750.1| unknown [Human herpesvirus 8] 40 0.048
gi|30681829|ref|NP_850032.1| expressed protein [Arabidopsis thal... 40 0.063
gi|32417560|ref|XP_329258.1| predicted protein [Neurospora crass... 40 0.063
gi|34854705|ref|XP_229225.2| similar to KIAA1476 protein [Rattus... 40 0.063
gi|48102221|ref|XP_395309.1| similar to DNop5 protein [Apis mell... 40 0.063
gi|7022719|dbj|BAA91700.1| unnamed protein product [Homo sapiens] 39 0.083
gi|46852388|ref|NP_060707.2| cell-cycle and apoptosis regulatory... 39 0.083
gi|32441867|gb|AAP82002.1| cell-cycle and apoptosis regulatory p... 39 0.083
gi|27497118|gb|AAO17319.1| death inducer with SAP domain DIS [Ho... 39 0.083
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot... 39 0.083
gi|7489869|pir||T30330 gelsolin-related protein GRP125 - slime m... 39 0.083
gi|48831776|ref|ZP_00288829.1| hypothetical protein Mmc102002739... 39 0.083
gi|9886896|gb|AAG01636.1| Orf73 [Human herpesvirus 8] 39 0.11
gi|13936996|gb|AAK50002.1| ORF73 [Human herpesvirus 8] 39 0.11
gi|2246532|gb|AAB62657.1| ORF 73, contains large complex repeat ... 39 0.11
gi|120943|sp|P13816|GARP_PLAFF Glutamic acid-rich protein precur... 39 0.11
gi|26000382|gb|AAN75473.1| dentin matrix protein 1 [Mormoops meg... 39 0.11
gi|17544558|ref|NP_500774.1| MSP-domain protein 2 like family me... 39 0.11
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil... 39 0.11
gi|50546553|ref|XP_500746.1| hypothetical protein [Yarrowia lipo... 39 0.14
gi|136657|sp|P25980|UBF2_XENLA Nucleolar transcription factor 2 ... 39 0.14
gi|2133786|pir||I51116 NF-180 - sea lamprey >gnl|BL_ORD_ID|32563... 39 0.14
gi|38074781|ref|XP_355331.1| similar to Bromodomain adjacent to ... 39 0.14
gi|30722350|emb|CAD91151.1| hypothetical protein [Homo sapiens] 39 0.14
gi|13470092|ref|NP_078789.1| FYVE and coiled-coil domain contain... 39 0.14
gi|2598958|gb|AAB84027.1| homeobox transcription factor iriquois... 39 0.14
gi|26326841|dbj|BAC27164.1| unnamed protein product [Mus musculus] 39 0.14
gi|25742663|ref|NP_446340.1| myelin transcription factor 1-like;... 39 0.14
gi|50510945|dbj|BAD32458.1| mKIAA1476 protein [Mus musculus] 39 0.14
gi|39595951|emb|CAE67454.1| Hypothetical protein CBG12955 [Caeno... 39 0.14
gi|38074779|ref|XP_130366.3| similar to KIAA1476 protein [Mus mu... 39 0.14
gi|34869750|ref|XP_223980.2| similar to RPGR-interacting protein... 39 0.14
gi|17539140|ref|NP_501136.1| immunodominant hypodermal antigen-r... 39 0.14
gi|23485922|gb|EAA20646.1| hypothetical protein [Plasmodium yoel... 39 0.14
gi|11037008|gb|AAG27458.1| latent nuclear antigen [Human herpesv... 38 0.18
gi|15240555|ref|NP_200377.1| expressed protein [Arabidopsis thal... 38 0.18
gi|18846043|ref|NP_572129.1| ORF 73; extensive acidic domains, p... 38 0.18
gi|23508151|ref|NP_700821.1| hypothetical protein [Plasmodium fa... 38 0.18
gi|9837385|gb|AAG00554.1| retinitis pigmentosa GTPase regulator-... 38 0.18
gi|23957710|ref|NP_473163.2| hypothetical protein, conserved [Pl... 38 0.24
gi|23487174|gb|EAA20984.1| MIF4G domain, putative [Plasmodium yo... 38 0.24
gi|45478244|gb|AAS66293.1| LRRGT00202 [Rattus norvegicus] 38 0.24
gi|50546607|ref|XP_500773.1| hypothetical protein [Yarrowia lipo... 38 0.24
gi|7494190|pir||T18423 hypothetical protein C0150w - malaria par... 38 0.24
gi|27924183|gb|AAH44970.1| Canx-prov protein [Xenopus laevis] 38 0.24
gi|23510031|ref|NP_702697.1| hypothetical protein [Plasmodium fa... 38 0.24
gi|34851186|ref|XP_346518.1| hypothetical protein XP_346517 [Rat... 38 0.24
gi|17531551|ref|NP_495640.1| immunodominant hypodermal antigen-r... 38 0.24
gi|28829096|gb|AAO51658.1| hypothetical protein [Dictyostelium d... 38 0.24
gi|23613480|ref|NP_703324.1| glutamic acid-rich protein (garp) [... 38 0.24
gi|23479048|gb|EAA15981.1| ring-infected erythrocyte surface ant... 38 0.24
gi|9631239|ref|NP_048021.1| orf 48 [Ateline herpesvirus 3] >gnl|... 38 0.24
gi|17505881|ref|NP_492824.1| vamp-associated protein like family... 37 0.31
gi|50419503|ref|XP_458278.1| unnamed protein product [Debaryomyc... 37 0.31
gi|37811886|gb|AAR03951.1| Cag7 [Helicobacter pylori] 37 0.31
gi|50302699|ref|XP_451286.1| unnamed protein product [Kluyveromy... 37 0.31
gi|23619599|ref|NP_705561.1| hypothetical protein [Plasmodium fa... 37 0.31
gi|38488737|ref|NP_942112.1| starmaker [Danio rerio] >gnl|BL_ORD... 37 0.31
gi|26325886|dbj|BAC26697.1| unnamed protein product [Mus musculus] 37 0.31
gi|23509629|ref|NP_702296.1| hypothetical protein [Plasmodium fa... 37 0.31
gi|50551701|ref|XP_503325.1| hypothetical protein [Yarrowia lipo... 37 0.31
gi|23480647|gb|EAA17150.1| hypothetical protein [Plasmodium yoel... 37 0.31
gi|50806272|ref|XP_424402.1| PREDICTED: similar to MYST histone ... 37 0.31
gi|23482007|gb|EAA18120.1| probable ATP-dependent RNA helicase d... 37 0.31
gi|23508165|ref|NP_700835.1| DNA polymerase zeta catalytic subun... 37 0.31
gi|13569852|ref|NP_076368.1| retinitis pigmentosa GTPase regulat... 37 0.31
gi|47564383|ref|ZP_00235428.1| surface protein [Bacillus cereus ... 37 0.31
gi|23619284|ref|NP_705246.1| hypothetical protein [Plasmodium fa... 37 0.41
gi|26006249|dbj|BAC41467.1| mKIAA1106 protein [Mus musculus] 37 0.41
gi|32470287|ref|NP_863522.1| YopN [Yersinia enterocolitica] >gnl... 37 0.41
gi|28373001|ref|NP_783674.1| YopN [Yersinia enterocolitica] >gnl... 37 0.41
gi|10955559|ref|NP_052400.1| YopN [Yersinia enterocolitica] >gnl... 37 0.41
gi|16082727|ref|NP_395173.1| secretion control protein [Yersinia... 37 0.41
gi|27503844|gb|AAH42232.1| MGC52607 protein [Xenopus laevis] 37 0.41
gi|104205|pir||S17196 transcription factor UBF2 - African clawed... 37 0.41
gi|65265|emb|CAA42523.1| a xenopus upstream binding factor [Xeno... 37 0.41
gi|15792502|ref|NP_282325.1| highly acidic protein [Campylobacte... 37 0.41
gi|6679000|ref|NP_032692.1| myelin transcription factor 1-like; ... 37 0.41
gi|50419029|ref|XP_458036.1| unnamed protein product [Debaryomyc... 37 0.41
gi|46122435|ref|XP_385771.1| hypothetical protein FG05595.1 [Gib... 37 0.41
gi|26000360|gb|AAN75476.1| dentin matrix protein 1 [Natalus micr... 37 0.41
gi|50307371|ref|XP_453664.1| unnamed protein product [Kluyveromy... 37 0.41
gi|39580106|emb|CAE56125.1| Hypothetical protein CBG23734 [Caeno... 37 0.41
gi|17559190|ref|NP_506146.1| putative protein, with 2 coiled coi... 37 0.54
gi|15644384|ref|NP_229436.1| conserved hypothetical protein [The... 37 0.54
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her... 37 0.54
gi|23480977|gb|EAA17393.1| hypothetical protein [Plasmodium yoel... 37 0.54
gi|8745181|emb|CAB95697.1| putative mc7 protein [Mus musculus] 37 0.54
gi|50427631|ref|XP_462428.1| unnamed protein product [Debaryomyc... 37 0.54
gi|39583539|emb|CAE73997.1| Hypothetical protein CBG21632 [Caeno... 37 0.54
gi|29421196|dbj|BAA96000.2| KIAA1476 protein [Homo sapiens] 37 0.54
gi|7304923|ref|NP_038478.1| bromodomain adjacent to zinc finger ... 37 0.54
gi|38089141|ref|XP_146248.3| MYST histone acetyltransferase (mon... 37 0.54
gi|22653668|sp|Q9UIF8|BA2B_HUMAN Bromodomain adjacent to zinc fi... 37 0.54
gi|10180804|gb|AAG14291.1| glutamic acid-rich protein [Plasmodiu... 37 0.54
gi|23509958|ref|NP_702625.1| hypothetical protein [Plasmodium fa... 37 0.54
gi|21740055|emb|CAD39044.1| hypothetical protein [Homo sapiens] 37 0.54
gi|16804923|ref|NP_472952.1| hypothetical protein [Plasmodium fa... 36 0.70
gi|32422107|ref|XP_331497.1| predicted protein [Neurospora crass... 36 0.70
gi|17531597|ref|NP_496231.1| tyrosine specific protein phosphata... 36 0.70
gi|47575744|ref|NP_001001216.1| hypothetical protein MGC69450 [X... 36 0.70
gi|49903364|gb|AAH76719.1| LOC398539 protein [Xenopus laevis] 36 0.70
gi|23482220|gb|EAA18266.1| hypothetical protein [Plasmodium yoel... 36 0.70
gi|26345990|dbj|BAC36646.1| unnamed protein product [Mus musculus] 36 0.70
gi|26347237|dbj|BAC37267.1| unnamed protein product [Mus musculus] 36 0.70
gi|21283468|ref|NP_646556.1| hypothetical protein [Staphylococcu... 36 0.70
gi|26000356|gb|AAN75470.1| dentin matrix protein 1 [Pteropus hyp... 36 0.70
gi|33563288|ref|NP_080477.1| cell division cycle and apoptosis r... 36 0.70
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb... 36 0.70
gi|23481470|gb|EAA17738.1| hypothetical protein [Plasmodium yoel... 36 0.70
gi|2735340|gb|AAB93881.1| RNA polymerase beta-subunit [Anisopogo... 36 0.70
gi|46437578|gb|EAK96922.1| hypothetical protein CaO19.8078 [Cand... 36 0.70
gi|1144145|gb|AAC47031.1| larval 20/22 kDa protein 36 0.91
gi|11022651|dbj|BAB17025.1| unnamed protein product [Arabidopsis... 36 0.91
gi|50418807|ref|XP_457924.1| unnamed protein product [Debaryomyc... 36 0.91
gi|9758600|dbj|BAB09233.1| unnamed protein product [Arabidopsis ... 36 0.91
gi|6688939|emb|CAB65345.1| PR7 protein [Plasmodium falciparum] 36 0.91
gi|50425659|ref|XP_461426.1| unnamed protein product [Debaryomyc... 36 0.91
gi|23619148|ref|NP_705110.1| hypothetical protein [Plasmodium fa... 36 0.91
gi|34862643|ref|XP_220055.2| similar to mitotic kinesin-related ... 36 0.91
gi|24653671|ref|NP_610972.2| CG12864-PA [Drosophila melanogaster... 36 0.91
gi|26000366|gb|AAN75481.1| dentin matrix protein 1 [Desmodus rot... 36 0.91
gi|33086672|gb|AAP92648.1| Cc2-27 [Rattus norvegicus] 36 0.91
gi|17554908|ref|NP_497967.1| cyclin-like F-box (3F797) [Caenorha... 36 0.91
gi|4009482|gb|AAC95451.1| cell division protein DivIB [Streptoco... 36 0.91
gi|15900591|ref|NP_345195.1| cell division protein DivIB [Strept... 36 0.91
gi|23479053|gb|EAA15986.1| mature-parasite-infected erythrocyte ... 36 0.91
gi|34879107|ref|XP_225008.2| similar to Runt-related transcripti... 36 0.91
gi|25395695|pir||G88436 protein T04A8.13 [imported] - Caenorhabd... 36 0.91
gi|50547961|ref|XP_501450.1| hypothetical protein [Yarrowia lipo... 36 0.91
gi|15228477|ref|NP_189519.1| expressed protein [Arabidopsis thal... 36 0.91
gi|34872595|ref|XP_345605.1| similar to Cc2-27 [Rattus norvegicus] 36 0.91
gi|9937992|ref|NP_064663.1| DIPB protein; DIPB gene; brain cDNA ... 36 0.91
gi|26000364|gb|AAN75477.1| dentin matrix protein 1 [Natalus stra... 36 0.91
gi|32405570|ref|XP_323398.1| predicted protein [Neurospora crass... 36 0.91
gi|23490473|gb|EAA22241.1| hypothetical protein [Plasmodium yoel... 36 0.91
gi|37360474|dbj|BAC98215.1| mKIAA1610 protein [Mus musculus] 36 0.91
gi|32965021|gb|AAP91698.1| hypothetical protein cihA10P13 [Ciona... 36 0.91
gi|34394290|dbj|BAC84772.1| putative heavy-metal-associated doma... 36 0.91
gi|23613042|ref|NP_703364.1| hypothetical protein [Plasmodium fa... 36 0.91
gi|49256265|gb|AAH74321.1| Unknown (protein for MGC:84144) [Xeno... 36 0.91
gi|34869927|ref|XP_342875.1| similar to mesoderm induction early... 36 0.91
gi|23488910|gb|EAA21432.1| hypothetical protein [Plasmodium yoel... 36 0.91
gi|42567760|ref|NP_196563.2| expressed protein [Arabidopsis thal... 36 0.91
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand... 36 0.91
gi|6320562|ref|NP_010643.1| may be involved in connecting nuclea... 36 0.91
gi|17233201|ref|NP_490291.1| hypothetical protein [Nostoc sp. PC... 29 1.2
gi|42519391|ref|NP_965321.1| signal recognition particle recepto... 35 1.2
gi|42519392|ref|NP_965322.1| chromosome partitioning protein Smc... 35 1.2
gi|2735417|gb|AAB93898.1| RNA polymerase beta-subunit [Joycea pa... 35 1.2
gi|126022|sp|P16945|YOPN_YEREN Outer membrane protein yopN (Yop4... 35 1.2
gi|45478545|ref|NP_995372.1| putative membrane-bound Yop targeti... 35 1.2
gi|50557074|ref|XP_505945.1| hypothetical protein [Yarrowia lipo... 35 1.2
gi|50258198|gb|EAL20892.1| hypothetical protein CNBE2530 [Crypto... 35 1.2
gi|27503180|gb|AAH42300.1| LOC398539 protein [Xenopus laevis] 35 1.2
gi|28828674|gb|AAO51277.1| hypothetical protein [Dictyostelium d... 35 1.2
gi|19075736|ref|NP_588236.1| putative nuclear pore complex-assoc... 35 1.2
gi|50744910|ref|XP_419932.1| PREDICTED: similar to myelin transc... 35 1.2
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno... 35 1.2
gi|17553556|ref|NP_497136.1| zn-finger, C2H2 type and HMG-I and ... 35 1.2
gi|18395643|ref|NP_564229.1| basic helix-loop-helix (bHLH) famil... 35 1.2
gi|25145616|ref|NP_500551.2| protein conserved (4F151) [Caenorha... 35 1.2
gi|50556864|ref|XP_505840.1| hypothetical protein [Yarrowia lipo... 35 1.2
gi|23612820|ref|NP_704359.1| hypothetical protein [Plasmodium fa... 35 1.2
gi|45356830|gb|AAS58454.1| DIPB protein [Rattus norvegicus] 35 1.2
gi|10140993|ref|NP_065570.1| putative immediate early protein [A... 35 1.2
gi|23490877|gb|EAA22546.1| maebl [Plasmodium yoelii yoelii] 35 1.2
gi|42409269|dbj|BAD10532.1| unknown protein [Oryza sativa (japon... 35 1.2
gi|42409268|dbj|BAD10531.1| RNA recognition motif (RRM)-containi... 35 1.2
gi|11360390|pir||T46608 zinc finger protein Png-1 - mouse >gnl|B... 35 1.2
gi|37811787|gb|AAR03862.1| Cag7 [Helicobacter pylori] 35 1.6
gi|18858381|ref|NP_571122.1| calreticulin [Danio rerio] >gnl|BL_... 35 1.6
gi|23003652|ref|ZP_00047307.1| COG1196: Chromosome segregation A... 35 1.6
gi|39595447|emb|CAE60485.1| Hypothetical protein CBG04099 [Caeno... 35 1.6
gi|23619337|ref|NP_705299.1| hypothetical protein [Plasmodium fa... 35 1.6
gi|46437526|gb|EAK96871.1| hypothetical protein CaO19.448 [Candi... 35 1.6
gi|458871|gb|AAC37372.1| RNA polymerase beta-subunit 35 1.6
gi|23488560|gb|EAA21348.1| hypothetical protein [Plasmodium yoel... 35 1.6
gi|26000358|gb|AAN75475.1| dentin matrix protein 1 [Myzopoda aur... 35 1.6
gi|50294960|ref|XP_449891.1| unnamed protein product [Candida gl... 35 1.6
gi|24666442|ref|NP_649060.1| CG14073-PB [Drosophila melanogaster... 35 1.6
gi|4760402|gb|AAD29126.1| variant-specific surface protein [Plas... 35 1.6
gi|15218784|ref|NP_174195.1| heavy-metal-associated domain-conta... 35 1.6
gi|39593019|emb|CAE62633.1| Hypothetical protein CBG06763 [Caeno... 35 1.6
gi|6754802|ref|NP_035438.1| nuclear receptor co-repressor 1; ret... 35 1.6
gi|2739311|emb|CAA75923.1| MtN14 [Medicago truncatula] 35 1.6
gi|23508250|ref|NP_700919.1| hypothetical protein [Plasmodium fa... 35 1.6
gi|27806661|ref|NP_776463.1| dentin matrix acidic phosphoprotein... 35 1.6
gi|13929148|ref|NP_113997.1| cyclic nucleotide-gated channel bet... 35 1.6
gi|50547355|ref|XP_501147.1| hypothetical protein [Yarrowia lipo... 35 1.6
gi|15895748|ref|NP_349097.1| Methyl-accepting chemotaxis protein... 35 1.6
gi|47551251|ref|NP_999808.1| heat shock protein gp96 [Strongyloc... 35 1.6
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno... 35 1.6
gi|48838225|ref|ZP_00295172.1| hypothetical protein Meth02003882... 35 1.6
gi|23483005|gb|EAA18816.1| hypothetical protein [Plasmodium yoel... 35 2.0
gi|2735315|gb|AAB93876.1| RNA polymerase beta-subunit [Stipa dre... 35 2.0
gi|3152917|gb|AAC17171.1| DNA-directed RNA polymerase beta' subu... 35 2.0
gi|23100367|ref|NP_693834.1| N-acetylmuramoyl-L-alanine amidase ... 35 2.0
gi|26000376|gb|AAN75486.1| dentin matrix protein 1 [Kerivoula ha... 35 2.0
gi|26341210|dbj|BAC34267.1| unnamed protein product [Mus musculu... 35 2.0
gi|23481834|gb|EAA17992.1| probable RNA 3'-terminal phosphate cy... 35 2.0
gi|46439313|gb|EAK98632.1| hypothetical protein CaO19.5058 [Cand... 35 2.0
gi|3168604|gb|AAC17709.1| proline and glutamic acid rich nuclear... 35 2.0
gi|35902932|ref|NP_919371.1| zinc finger-like gene 2 [Danio reri... 35 2.0
gi|28829071|gb|AAO51637.1| similar to Dictyostelium discoideum (... 35 2.0
gi|2735461|gb|AAB93913.1| RNA polymerase beta-subunit [Merxmuell... 35 2.0
gi|17136772|ref|NP_476896.1| CG10385-PA [Drosophila melanogaster... 35 2.0
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi] 35 2.0
gi|38084006|ref|XP_128974.3| RIKEN cDNA 9030411M15 [Mus musculus] 35 2.0
gi|39587629|emb|CAE58567.1| Hypothetical protein CBG01732 [Caeno... 35 2.0
gi|23508775|ref|NP_701443.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|31542025|ref|NP_083799.2| DEP domain containing 1 [Mus muscul... 35 2.0
gi|50547043|ref|XP_500991.1| hypothetical protein [Yarrowia lipo... 35 2.0
gi|17540780|ref|NP_501331.1| tyrosine specific protein phosphata... 35 2.0
gi|23488517|gb|EAA21339.1| hypothetical protein [Plasmodium yoel... 35 2.0
gi|23509702|ref|NP_702369.1| hypothetical protein [Plasmodium fa... 35 2.0
gi|23478689|gb|EAA15708.1| Arabidopsis thaliana At5g64630/MUB3_1... 35 2.0
gi|46439237|gb|EAK98557.1| hypothetical protein CaO19.12525 [Can... 35 2.0
gi|26000390|gb|AAN75472.1| dentin matrix protein 1 [Tadarida bra... 35 2.0
gi|46226679|gb|EAK87658.1| Low complexity protein with large Glu... 35 2.0
gi|21426922|gb|AAC17708.2| PELP1 [Homo sapiens] 35 2.0
gi|136655|sp|P25979|UBF1_XENLA Nucleolar transcription factor 1 ... 35 2.0
gi|12084973|ref|NP_073266.1| TlpA [Salmonella enterica subsp. en... 28 2.5
gi|321935|pir||A44122 alpha-helical coiled coil protein TlpA - S... 28 2.5
gi|50754401|ref|XP_414366.1| PREDICTED: similar to ankyrin repea... 34 2.7
gi|42656368|ref|XP_039762.5| myelin transcription factor 1-like ... 34 2.7
gi|45185293|ref|NP_983010.1| ABR064Wp [Eremothecium gossypii] >g... 34 2.7
gi|31207045|ref|XP_312489.1| ENSANGP00000021340 [Anopheles gambi... 34 2.7
gi|34909996|ref|NP_916345.1| P0490D09.22 [Oryza sativa (japonica... 34 2.7
gi|46439069|gb|EAK98391.1| hypothetical protein CaO19.497 [Candi... 34 2.7
gi|6491868|gb|AAF14051.1| myelin transcription factor 1-like [Ho... 34 2.7
gi|2218107|gb|AAB81574.1| outer surface protein B [Borrelia gari... 34 2.7
gi|45708564|gb|AAH32844.1| Angiogenic factor VG5Q [Homo sapiens] 34 2.7
gi|39725952|ref|NP_060516.2| angiogenic factor VG5Q; vasculogene... 34 2.7
gi|15611374|ref|NP_223025.1| putative [Helicobacter pylori J99] ... 34 2.7
gi|50305353|ref|XP_452636.1| unnamed protein product [Kluyveromy... 34 2.7
gi|23490353|gb|EAA22151.1| hypothetical protein [Plasmodium yoel... 34 2.7
gi|458869|gb|AAC37370.1| RNA polymerase beta-subunit 34 2.7
gi|25986819|gb|AAM93745.1| heat shock protein 90 [Diplonema papi... 34 2.7
gi|15611223|ref|NP_222874.1| putative [Helicobacter pylori J99] ... 34 2.7
gi|15225073|ref|NP_181464.1| OTU-like cysteine protease family p... 34 2.7
gi|34784456|gb|AAH57473.1| LOC402866 protein [Danio rerio] 34 2.7
gi|23619619|ref|NP_705581.1| erythrocyte membrane protein 1 (PfE... 34 2.7
gi|5803098|ref|NP_006757.1| MYST histone acetyltransferase (mono... 34 2.7
gi|49481764|ref|YP_034811.1| possible internalin protein [Bacill... 34 2.7
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 34 2.7
gi|50286801|ref|XP_445830.1| unnamed protein product [Candida gl... 34 2.7
gi|16804977|ref|NP_473006.1| ribosome releasing factor, putative... 34 2.7
gi|37811818|gb|AAR03890.1| Cag7 [Helicobacter pylori] 34 2.7
gi|23483656|gb|EAA19256.1| hypothetical protein [Plasmodium yoel... 34 2.7
gi|17557798|ref|NP_504421.1| putative nuclear protein, with 2 co... 34 3.5
gi|16805048|ref|NP_473077.1| hypothetical protein [Plasmodium fa... 34 3.5
gi|32566867|ref|NP_872166.1| putative protein, with a coiled coi... 34 3.5
gi|50553250|ref|XP_504035.1| hypothetical protein [Yarrowia lipo... 34 3.5
gi|39592294|emb|CAE75515.1| Hypothetical protein CBG23530 [Caeno... 34 3.5
gi|47569221|ref|ZP_00239907.1| Mature parasite-infected erythroc... 34 3.5
gi|50555293|ref|XP_505055.1| hypothetical protein [Yarrowia lipo... 34 3.5
gi|15828993|ref|NP_326353.1| LIPOPROTEIN B [Mycoplasma pulmonis ... 34 3.5
gi|7511874|pir||T13734 groovin gene protein - fruit fly (Drosoph... 34 3.5
gi|23479216|gb|EAA16104.1| hypothetical protein [Plasmodium yoel... 34 3.5
gi|23478309|gb|EAA15432.1| hypothetical protein [Plasmodium yoel... 34 3.5
gi|23613494|ref|NP_703338.1| hypothetical protein, conserved in ... 34 3.5
gi|23488733|gb|EAA21388.1| mature-parasite-infected erythrocyte ... 34 3.5
gi|23486500|gb|EAA20810.1| unknown protein, putative [Plasmodium... 34 3.5
gi|42761494|gb|AAS45312.1| hypothetical protein [Dictyostelium d... 34 3.5
gi|6690788|gb|AAF24343.1| Short stop/Kakapo long isoform [Drosop... 34 3.5
gi|39587824|emb|CAE67842.1| Hypothetical protein CBG13429 [Caeno... 34 3.5
gi|24653491|ref|NP_725337.1| CG18076-PE [Drosophila melanogaster... 34 3.5
gi|40549138|gb|AAR87662.1| heart of glass soluble isoform 1 [Dan... 34 3.5
gi|46228057|gb|EAK88956.1| histone transcription regulator (HIR1... 34 3.5
gi|39589511|emb|CAE74540.1| Hypothetical protein CBG22297 [Caeno... 34 3.5
gi|19173762|ref|NP_596893.1| nucleosome assembly protein 1-like ... 34 3.5
gi|39582016|emb|CAE64447.1| Hypothetical protein CBG09154 [Caeno... 34 3.5
gi|33300100|emb|CAE17780.1| Hypothetical protein F33A8.10 [Caeno... 34 3.5
gi|7489882|pir||T18283 hypothetical protein G5 - slime mold (Dic... 34 3.5
gi|23508591|ref|NP_701260.1| hypothetical protein [Plasmodium fa... 34 3.5
gi|23619192|ref|NP_705154.1| microfibril-associated protein homo... 34 3.5
gi|23619251|ref|NP_705213.1| hypothetical protein [Plasmodium fa... 34 3.5
gi|23482103|gb|EAA18183.1| hypothetical protein [Plasmodium yoel... 34 3.5
gi|45382579|ref|NP_990552.1| alpha subunit of cone photoreceptor... 34 3.5
gi|23613112|ref|NP_703434.1| hypothetical protein [Plasmodium fa... 34 3.5
gi|40549140|gb|AAR87663.1| heart of glass soluble isoform 2 [Dan... 34 3.5
gi|23481512|gb|EAA17768.1| hypothetical protein [Plasmodium yoel... 34 3.5
gi|29251343|gb|EAA42825.1| GLP_574_57226_57648 [Giardia lamblia ... 34 3.5
gi|24653495|ref|NP_725338.1| CG18076-PC [Drosophila melanogaster... 34 3.5
gi|50410289|ref|XP_456948.1| unnamed protein product [Debaryomyc... 34 3.5
gi|2981225|gb|AAC38597.1| lipase precursor [Staphylococcus epide... 34 3.5
gi|23491066|gb|EAA22695.1| hypothetical protein [Plasmodium yoel... 34 3.5
gi|47222662|emb|CAG00096.1| unnamed protein product [Tetraodon n... 34 3.5
gi|19114865|ref|NP_593953.1| hypothetical protein [Schizosacchar... 34 3.5
gi|47085721|ref|NP_998133.1| heart of glass [Danio rerio] >gnl|B... 34 3.5
gi|34525762|gb|AAQ73927.1| erythrocyte membrane protein 1 [Plasm... 34 3.5
gi|39581569|emb|CAE58354.1| Hypothetical protein CBG01475 [Caeno... 34 3.5
gi|71553|pir||QFBO micro glutamic acid-rich protein - bovine 34 3.5
gi|50291547|ref|XP_448206.1| unnamed protein product [Candida gl... 27 3.9
gi|47569429|ref|ZP_00240111.1| methyl-accepting chemotaxis prote... 33 4.5
gi|15223179|ref|NP_172310.1| rac GTPase activating protein, puta... 33 4.5
gi|6579202|gb|AAF18245.1| T23G18.20 [Arabidopsis thaliana] 33 4.5
gi|21228910|ref|NP_634832.1| conserved protein [Methanosarcina m... 33 4.5
gi|32566642|ref|NP_505122.3| fibronectin, type III and protein k... 33 4.5
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 33 4.5
gi|20090783|ref|NP_616858.1| conserved hypothetical protein [Met... 33 4.5
gi|46227735|gb|EAK88655.1| WD repeat protein [Cryptosporidium pa... 33 4.5
gi|32566644|ref|NP_872126.1| putative membrane protein family me... 33 4.5
gi|34881325|ref|XP_346335.1| similar to nucleosome binding prote... 33 4.5
gi|19856246|sp|P15205|MAPB_RAT Microtubule-associated protein 1B... 33 4.5
gi|32417556|ref|XP_329256.1| hypothetical protein [Neurospora cr... 33 4.5
gi|19920846|ref|NP_609066.1| CG11188-PA [Drosophila melanogaster... 33 4.5
gi|33303450|gb|AAQ02301.1| dentin matrix protein 1 [Scotinomys t... 33 4.5
gi|50725359|dbj|BAD34431.1| bromodomain protein 103-like [Oryza ... 33 4.5
gi|46431840|gb|EAK91364.1| hypothetical protein CaO19.188 [Candi... 33 4.5
gi|123676|sp|P24724|HS90_THEPA Heat shock protein 90 (HSP90) >gn... 33 4.5
gi|17505873|ref|NP_492830.1| putative prenylated protein family ... 33 4.5
gi|46091588|dbj|BAD14026.1| cag pathogenicity island protein [He... 33 4.5
gi|34853474|ref|XP_215469.2| similar to Microtubule-associated p... 33 4.5
gi|17544554|ref|NP_500777.1| putative nuclear protein, with 4 co... 33 4.5
gi|50260827|gb|EAL23477.1| hypothetical protein CNBA1260 [Crypto... 33 4.5
gi|26000384|gb|AAN75474.1| dentin matrix protein 1 [Pteronotus p... 33 4.5
gi|26000368|gb|AAN75480.1| dentin matrix protein 1 [Centurio senex] 33 4.5
gi|46431414|gb|EAK90983.1| hypothetical protein CaO19.9303 [Cand... 33 4.5
gi|50730125|ref|XP_416780.1| PREDICTED: similar to retinitis pig... 33 4.5
gi|25365828|pir||B86217 protein T27G7.4 [imported] - Arabidopsis... 33 4.5
gi|31242837|ref|XP_321849.1| ENSANGP00000020303 [Anopheles gambi... 33 4.5
gi|32565168|ref|NP_871885.1| putative protein family member, wit... 33 4.5
gi|1083716|pir||A56577 microtubule-associated protein MAP 1B - r... 33 4.5
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 33 4.5
gi|50424261|ref|XP_460717.1| unnamed protein product [Debaryomyc... 33 4.5
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 33 4.5
gi|34856350|ref|XP_344903.1| similar to nucleosome binding prote... 33 4.5
gi|15828490|ref|NP_325850.1| LIPOPROTEIN [Mycoplasma pulmonis UA... 33 5.9
gi|32414987|ref|XP_327973.1| predicted protein [Neurospora crass... 33 5.9
gi|23613580|ref|NP_704601.1| beta subunit of coatomer complex, p... 33 5.9
gi|34783134|gb|AAH10457.2| PELP1 protein [Homo sapiens] 33 5.9
gi|17221673|gb|AAL36457.1| circumsporozoite protein [Plasmodium ... 33 5.9
gi|1335718|emb|CAA28817.1| ring-infected eryrthrocyte surface an... 33 5.9
gi|29421188|dbj|BAA82999.2| KIAA1047 protein [Homo sapiens] 33 5.9
gi|16117781|ref|NP_361014.1| F-box protein FBW7 isoform 1; archi... 33 5.9
gi|23507919|ref|NP_700589.1| QF122 antigen [Plasmodium falciparu... 33 5.9
gi|23508394|ref|NP_701063.1| hypothetical protein [Plasmodium fa... 33 5.9
gi|34857770|ref|XP_341884.1| similar to Pre-mRNA cleavage comple... 33 5.9
gi|46399217|gb|AAH69058.1| Proline-, glutamic acid-, leucine-ric... 33 5.9
gi|24653487|ref|NP_725335.1| CG18076-PG [Drosophila melanogaster... 33 5.9
gi|39645221|gb|AAH07361.2| PPM1G protein [Homo sapiens] 33 5.9
gi|15644799|ref|NP_206969.1| hypothetical protein HP0170 [Helico... 33 5.9
gi|2218101|gb|AAB81570.1| outer surface protein B [Borrelia gari... 33 5.9
gi|46228705|gb|EAK89575.1| conserved protein [Cryptosporidium pa... 33 5.9
gi|15673632|ref|NP_267806.1| hypothetical protein L98109 [Lactoc... 33 5.9
gi|50411801|ref|XP_457079.1| unnamed protein product [Debaryomyc... 33 5.9
gi|22788865|ref|NP_690550.1| DNA polymerase I [Heliothis zea vir... 33 5.9
gi|41147248|ref|XP_373106.1| similar to Tb-291 membrane associat... 33 5.9
gi|47569503|ref|ZP_00240183.1| conserved hypothetical protein pr... 33 5.9
gi|46439420|gb|EAK98738.1| hypothetical protein CaO19.12872 [Can... 33 5.9
gi|17551634|ref|NP_508124.1| kinase (40.9 kD) (XB213) [Caenorhab... 33 5.9
gi|7511951|pir||T13714 kakapo gene protein - fruit fly (Drosophi... 33 5.9
gi|15241453|ref|NP_199241.1| zinc finger (C3HC4-type RING finger... 33 5.9
gi|24653489|ref|NP_725336.1| CG18076-PB [Drosophila melanogaster... 33 5.9
gi|32407697|ref|XP_324355.1| hypothetical protein [Neurospora cr... 33 5.9
gi|23479761|gb|EAA16501.1| hypothetical protein [Plasmodium yoel... 33 5.9
gi|50759528|ref|XP_417679.1| PREDICTED: similar to neurofilament... 33 5.9
gi|23508651|ref|NP_701320.1| hypothetical protein [Plasmodium fa... 33 5.9
gi|462703|sp|Q02916|NFL_COTJA Neurofilament triplet L protein (N... 33 5.9
gi|15235082|ref|NP_195100.1| expressed protein [Arabidopsis thal... 33 5.9
gi|422665|pir||B46024 neurofilament-L subunit - quail 33 5.9
gi|22538461|ref|NP_006302.2| nuclear receptor co-repressor 1; th... 33 5.9
gi|3510603|gb|AAC33550.1| nuclear receptor co-repressor N-CoR [H... 33 5.9
gi|33150576|gb|AAP97166.1| nuclear receptor co-repressor [Homo s... 33 5.9
gi|132383|sp|P13830|RESA_PLAFF Ring-infected erythrocyte surface... 33 5.9
gi|15131992|emb|CAC49971.1| dJ276E15.1 (DIPB protein) [Homo sapi... 33 5.9
gi|46138029|ref|XP_390705.1| hypothetical protein FG10529.1 [Gib... 33 5.9
gi|34853049|ref|XP_342386.1| similar to hypothetical protein FLJ... 33 5.9
gi|28190008|gb|AAO32942.1| NCOR isoform b [Homo sapiens] 33 5.9
gi|26000380|gb|AAN75471.1| dentin matrix protein 1 [Saccopteryx ... 33 5.9
gi|6688177|emb|CAB65108.1| DIPB protein [Homo sapiens] 33 5.9
gi|21361639|ref|NP_060053.2| DIPB protein [Homo sapiens] >gnl|BL... 33 5.9
gi|24653493|ref|NP_523733.2| CG18076-PA [Drosophila melanogaster... 33 5.9
gi|46128087|ref|XP_388597.1| hypothetical protein FG08421.1 [Gib... 33 5.9
gi|38197221|gb|AAH02875.2| PELP1 protein [Homo sapiens] 33 5.9
gi|3758911|emb|CAA09870.1| Kakapo [Drosophila melanogaster] 33 5.9
gi|27807391|ref|NP_777226.1| protein phosphatase 1G (formerly 2C... 33 5.9
gi|458875|gb|AAC37376.1| RNA polymerase beta-subunit 33 5.9
gi|50428363|dbj|BAD30000.1| Conserved hypothetical [Xanthomonas ... 33 5.9
gi|34870011|ref|XP_341021.1| similar to DNA-dependent protein ki... 33 5.9
gi|50257196|gb|EAL19909.1| hypothetical protein CNBG0520 [Crypto... 33 5.9
gi|23489856|gb|EAA21766.1| mature parasite-infected erythrocyte ... 33 5.9
gi|39597354|emb|CAE59582.1| Hypothetical protein CBG02982 [Caeno... 33 5.9
gi|23613774|ref|NP_704795.1| Histone deacetylase [Plasmodium fal... 33 5.9
gi|4505999|ref|NP_002698.1| protein phosphatase 1G; protein phos... 33 5.9
gi|23510180|ref|NP_702846.1| ran binding protein 1 [Plasmodium f... 33 5.9
gi|15794633|ref|NP_284455.1| lactoferrin-binding protein [Neisse... 33 5.9
gi|15212037|emb|CAC51118.1| putative bifunctional autolysin [Sta... 33 7.7
gi|6272692|gb|AAF06163.1| short microtubule-associated protein 1... 33 7.7
gi|38075633|ref|XP_194040.3| microtubule-associated protein 1 A ... 33 7.7
gi|21357213|ref|NP_648884.1| CG4784-PA [Drosophila melanogaster]... 33 7.7
gi|20984013|ref|XP_135885.1| RIKEN cDNA 4933402E13 [Mus musculus... 33 7.7
gi|2218104|gb|AAB81572.1| outer surface protein B [Borrelia gari... 33 7.7
gi|33086446|gb|AAP92535.1| Ab1-042 [Rattus norvegicus] 33 7.7
gi|48098628|ref|XP_392101.1| similar to CG10840-PB [Apis mellifera] 33 7.7
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo... 33 7.7
gi|1518639|gb|AAB63387.1| cGMP-gated cation channel beta subunit 33 7.7
gi|21323625|dbj|BAB98252.1| Hypothetical membrane protein [Coryn... 33 7.7
gi|23483767|gb|EAA19328.1| Arabidopsis thaliana At5g66540/K1F13_... 33 7.7
gi|17508597|ref|NP_492170.1| AdaPTin or adaptin-related protein ... 33 7.7
gi|4502919|ref|NP_001288.1| cyclic nucleotide gated channel beta... 33 7.7
gi|47224891|emb|CAG06461.1| unnamed protein product [Tetraodon n... 33 7.7
gi|49119211|gb|AAH73206.1| Unknown (protein for MGC:80481) [Xeno... 33 7.7
gi|48095642|ref|XP_394496.1| similar to ENSANGP00000025216 [Apis... 33 7.7
gi|56619|emb|CAA47316.1| microtubule associated protein 1A [Ratt... 33 7.7
gi|6606205|gb|AAF19110.1| BdrA2 [Borrelia hermsii] 33 7.7
gi|2493750|sp|Q14028|CNG4_HUMAN Cyclic-nucleotide-gated cation c... 33 7.7
gi|2134905|pir||S32538 cGMP-gated cation channel 2, rod - human ... 33 7.7
gi|8778449|gb|AAF79457.1| F1L3.1 [Arabidopsis thaliana] 33 7.7
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 33 7.7
gi|23508376|ref|NP_701045.1| hypothetical protein [Plasmodium fa... 33 7.7
gi|382658|prf||1819485A CENP-E protein 33 7.7
gi|19552086|ref|NP_600088.1| hypothetical membrane protein [Cory... 33 7.7
gi|50731067|ref|XP_417149.1| PREDICTED: similar to M-phase phosp... 33 7.7
gi|33086440|gb|AAP92532.1| Ab1-013 [Rattus norvegicus] 33 7.7
gi|46439989|gb|EAK99300.1| hypothetical protein CaO19.2564 [Cand... 33 7.7
gi|23508883|ref|NP_701551.1| erythrocyte membrane protein 1 (PfE... 33 7.7
gi|18203400|sp|Q9QYR6|MAPA_MOUSE Microtubule-associated protein ... 33 7.7
gi|23478622|gb|EAA15658.1| histone deacetylase [Plasmodium yoeli... 33 7.7
gi|23619032|ref|NP_704994.1| hypothetical protein [Plasmodium fa... 33 7.7
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ... 33 7.7
gi|50737598|ref|XP_419199.1| PREDICTED: similar to suppression o... 33 7.7
gi|14017564|ref|NP_114251.1| RNA polymerase beta'' chain [Tritic... 33 7.7
gi|27467309|ref|NP_763946.1| conserved hypothetical protein [Sta... 33 7.7
gi|15220087|ref|NP_173179.1| COP1-interacting protein-related [A... 33 7.7
>gi|17544598|ref|NP_502026.1| keratin-like protein precursor family
member (24.8 kD) (4L665) [Caenorhabditis elegans]
gi|7511229|pir||T27929 hypothetical protein ZK596.1 -
Caenorhabditis elegans
gi|3881726|emb|CAA93430.1| Hypothetical protein ZK596.1
[Caenorhabditis elegans]
Length = 241
Score = 271 bits (692), Expect = 1e-71
Identities = 144/159 (90%), Positives = 144/159 (90%)
Frame = +1
Query: 1 MALSYSFIFTLFAFSAVVLAXXXXXXXXXXXXXXXAPQLPPFLQNVTAEGRQAFFAIVSN 180
MALSYSFIFTLFAFSAVVLA APQLPPFLQNVTAEGRQAFFAIVSN
Sbjct: 1 MALSYSFIFTLFAFSAVVLAGPGGRHGHGGGGFGGAPQLPPFLQNVTAEGRQAFFAIVSN 60
Query: 181 TSLTISETESQISSWAQTYGVSSQVTEFQTKVEEKLNEIKQNVTAVINNLSTVETQLEAI 360
TSLTISETESQISSWAQTYGVSSQVTEFQTKVEEKLNEIKQNVTAVINNLSTVETQLEAI
Sbjct: 61 TSLTISETESQISSWAQTYGVSSQVTEFQTKVEEKLNEIKQNVTAVINNLSTVETQLEAI 120
Query: 361 FANKSQTIREQFQALGQLKDQYPQEVGVLLFLAKPKGEH 477
FANKSQTIREQFQALGQLKDQYPQEVGVLLFLAKPKGEH
Sbjct: 121 FANKSQTIREQFQALGQLKDQYPQEVGVLLFLAKPKGEH 159