Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK39_8
(681 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 323 3e-87
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 186 5e-46
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 172 4e-42
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 159 4e-38
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 147 2e-34
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 145 9e-34
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 144 1e-33
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 135 1e-30
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 134 2e-30
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 132 6e-30
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 131 1e-29
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 129 4e-29
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 128 9e-29
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 127 3e-28
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 127 3e-28
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 127 3e-28
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 123 3e-27
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 123 4e-27
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 121 1e-26
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 120 2e-26
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 117 3e-25
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 115 8e-25
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 115 8e-25
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 115 1e-24
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 106 4e-22
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 98 1e-19
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 96 9e-19
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 92 1e-17
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 92 1e-17
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 89 6e-17
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno... 86 7e-16
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 85 1e-15
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 85 2e-15
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 84 2e-15
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 84 3e-15
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 82 1e-14
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 81 2e-14
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 80 4e-14
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 80 4e-14
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 79 6e-14
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 79 8e-14
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 79 1e-13
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 78 2e-13
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno... 77 4e-13
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 77 4e-13
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 77 4e-13
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 76 5e-13
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 75 1e-12
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 75 2e-12
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ... 75 2e-12
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 74 3e-12
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno... 73 6e-12
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 73 6e-12
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno... 72 8e-12
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur... 72 1e-11
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 71 2e-11
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 70 3e-11
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 70 4e-11
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 69 7e-11
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 69 1e-10
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 68 2e-10
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 67 3e-10
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 67 3e-10
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 66 6e-10
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno... 66 7e-10
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 65 1e-09
gi|17531917|ref|NP_494490.1| putative protein family member (2D5... 65 1e-09
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 65 1e-09
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 65 2e-09
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 65 2e-09
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 65 2e-09
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 64 2e-09
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)... 64 2e-09
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 64 3e-09
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 64 4e-09
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno... 64 4e-09
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 64 4e-09
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 62 8e-09
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 62 1e-08
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno... 61 2e-08
gi|17559100|ref|NP_505753.1| putative protein family member (5L2... 59 1e-07
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 58 2e-07
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb... 58 2e-07
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 57 4e-07
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd... 56 6e-07
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 56 8e-07
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 55 2e-06
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 54 2e-06
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 54 3e-06
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 54 4e-06
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 54 4e-06
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam... 52 1e-05
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 51 2e-05
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family... 50 3e-05
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno... 50 5e-05
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 48 2e-04
gi|17506693|ref|NP_493312.1| putative protein family member (1N7... 48 2e-04
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 48 2e-04
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 47 3e-04
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 47 5e-04
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 46 8e-04
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam... 44 0.002
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh... 44 0.002
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno... 44 0.003
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 44 0.004
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 43 0.007
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab... 42 0.009
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 42 0.009
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 42 0.011
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 42 0.015
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 42 0.015
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 42 0.015
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ... 41 0.025
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ... 41 0.025
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ... 40 0.033
gi|17533737|ref|NP_494816.1| putative secreted or extracellular ... 40 0.033
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 40 0.033
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 40 0.033
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat... 40 0.033
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 40 0.033
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 40 0.033
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd... 40 0.043
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam... 40 0.043
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 40 0.056
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 40 0.056
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 40 0.056
gi|206105|gb|AAA41836.1| proteoglycan 40 0.056
gi|34531979|dbj|BAC86280.1| unnamed protein product [Homo sapiens] 40 0.056
gi|17559566|ref|NP_507660.1| predicted CDS, c-type lectin family... 40 0.056
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 39 0.073
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family... 39 0.073
gi|17559556|ref|NP_507665.1| predicted CDS, c-type lectin family... 39 0.12
gi|17559568|ref|NP_507659.1| predicted CDS, putative protein fam... 38 0.16
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 38 0.21
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ... 38 0.21
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 38 0.21
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 38 0.21
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 38 0.21
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 38 0.21
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 38 0.21
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 38 0.21
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 38 0.21
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 38 0.21
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 38 0.21
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 38 0.21
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot... 38 0.21
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 38 0.21
gi|17559564|ref|NP_507661.1| predicted CDS, c-type lectin precur... 37 0.28
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n... 37 0.28
gi|39579290|emb|CAE56946.1| Hypothetical protein CBG24793 [Caeno... 37 0.36
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 37 0.36
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 37 0.36
gi|39581194|emb|CAE73599.1| Hypothetical protein CBG21085 [Caeno... 37 0.36
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno... 37 0.47
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 37 0.47
gi|17559570|ref|NP_507658.1| predicted CDS, putative secreted or... 36 0.62
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 36 0.62
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 36 0.62
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 36 0.62
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 36 0.62
gi|21628937|ref|NP_660230.1| TraE-like protein [Haemophilus infl... 36 0.62
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 36 0.62
gi|46396751|sp|P83515|STR2_STRCA Struthiocalcin-2 (SCA-2) 36 0.62
gi|39580171|emb|CAE56379.1| Hypothetical protein CBG24059 [Caeno... 35 1.1
gi|17540278|ref|NP_502932.1| predicted CDS, c-type lectin family... 35 1.4
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai... 35 1.8
gi|31542313|ref|NP_525126.2| C-type lectin, superfamily member 8... 35 1.8
gi|17226268|gb|AAL37713.1| C-type lectin-like receptor CLEC-6 [H... 35 1.8
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno... 35 1.8
gi|2144278|pir||S43922 versican - pig-tailed macaque (fragments) 34 2.4
gi|47219432|emb|CAG10796.1| unnamed protein product [Tetraodon n... 34 2.4
gi|3108091|gb|AAC15766.1| neurocan [Rattus norvegicus] 34 2.4
gi|30580858|sp||Q28858_3 [Segment 3 of 3] Versican core protein ... 34 2.4
gi|16124576|ref|NP_419140.1| conserved hypothetical protein [Cau... 34 2.4
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 34 2.4
gi|49076888|ref|XP_402370.1| hypothetical protein UM04755.1 [Ust... 34 3.1
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 34 3.1
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai... 34 3.1
gi|17535965|ref|NP_493772.1| predicted CDS, putative secreted or... 33 4.0
gi|39580174|emb|CAE56382.1| Hypothetical protein CBG24064 [Caeno... 33 4.0
gi|48861995|ref|ZP_00315893.1| hypothetical protein Mdeg02002626... 33 4.0
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h... 33 4.0
gi|15237600|ref|NP_196022.1| calmodulin-binding protein-related ... 33 4.0
gi|17542828|ref|NP_500318.1| basic-leucine zipper transcription... 33 5.2
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 33 5.2
gi|39579486|emb|CAE56876.1| Hypothetical protein CBG24712 [Caeno... 33 5.2
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 33 5.2
gi|24373605|ref|NP_717648.1| cation efflux family protein [Shewa... 33 6.9
gi|20150424|pdb|1JH3|A Chain A, Solution Structure Of Tyrosyl-Tr... 33 6.9
gi|47206624|emb|CAF89558.1| unnamed protein product [Tetraodon n... 33 6.9
gi|39581670|emb|CAE57178.1| Hypothetical protein CBG00017 [Caeno... 33 6.9
gi|24661779|ref|NP_729519.1| CG32045-PC [Drosophila melanogaster... 32 8.9
gi|15233976|ref|NP_193602.1| leucine-rich repeat family protein ... 32 8.9
gi|48770843|ref|ZP_00275186.1| COG2371: Urease accessory protein... 32 8.9
gi|39582561|emb|CAE63880.1| Hypothetical protein CBG08446 [Caeno... 32 8.9
gi|24661783|ref|NP_729520.1| CG32045-PB [Drosophila melanogaster... 32 8.9
gi|11907986|gb|AAG41424.1| fry [Drosophila melanogaster] 32 8.9
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ... 32 8.9
gi|47215297|emb|CAF98106.1| unnamed protein product [Tetraodon n... 32 8.9
>gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 kD)
(1L750) [Caenorhabditis elegans]
gi|7511126|pir||T27843 hypothetical protein ZK39.8 - Caenorhabditis
elegans
gi|3881630|emb|CAB05021.1| Hypothetical protein ZK39.8
[Caenorhabditis elegans]
Length = 226
Score = 323 bits (827), Expect = 3e-87
Identities = 162/213 (76%), Positives = 162/213 (76%)
Frame = -1
Query: 642 IGTLVAIDFDXXXXXXXXXXXXXXXXXXXXXXXXXXXXNRGCDAGWTRFNRPSGGWCVRV 463
IGTLVAIDFD NRGCDAGWTRFNRPSGGWCVRV
Sbjct: 14 IGTLVAIDFDSSSSESCEESHEHKHGGGHEGGNNGGGNNRGCDAGWTRFNRPSGGWCVRV 73
Query: 462 FPGTYHQPLAESRCQSQGAVLTGVQNQEEAKKIASLLLPQISQQSGSIYIGLHRTPAXXX 283
FPGTYHQPLAESRCQSQGAVLTGVQNQEEAKKIASLLLPQISQQSGSIYIGLHRTPA
Sbjct: 74 FPGTYHQPLAESRCQSQGAVLTGVQNQEEAKKIASLLLPQISQQSGSIYIGLHRTPACSK 133
Query: 282 XXXXXXXXXXXSFHWXXXXXXXXXGLLWNNNQPDNAHAATQQCAVLLAAHTPTVVDKWTW 103
SFHW GLLWNNNQPDNAHAATQQCAVLLAAHTPTVVDKWTW
Sbjct: 134 SPISSSCNSMNSFHWTDGSTTGTDGLLWNNNQPDNAHAATQQCAVLLAAHTPTVVDKWTW 193
Query: 102 QANRLDDVQCQVPAGSNVARTVRGYACGKKARS 4
QANRLDDVQCQVPAGSNVARTVRGYACGKKARS
Sbjct: 194 QANRLDDVQCQVPAGSNVARTVRGYACGKKARS 226