Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZK39_4
(690 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 374 e-102
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 220 2e-56
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 207 2e-52
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 205 8e-52
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 205 8e-52
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 205 8e-52
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 204 2e-51
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 197 2e-49
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 175 7e-43
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 174 1e-42
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 171 2e-41
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 164 2e-39
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 164 2e-39
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 157 2e-37
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 155 7e-37
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 154 2e-36
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 149 5e-35
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 142 5e-33
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 141 1e-32
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 135 6e-31
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 134 2e-30
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 133 3e-30
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 133 4e-30
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 131 1e-29
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 129 6e-29
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 129 6e-29
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 127 3e-28
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 123 3e-27
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 119 6e-26
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 117 2e-25
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno... 115 6e-25
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 113 3e-24
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 111 1e-23
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 110 2e-23
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 110 3e-23
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 108 1e-22
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur... 105 1e-21
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 104 1e-21
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 104 2e-21
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 104 2e-21
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 103 2e-21
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 103 3e-21
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 102 6e-21
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno... 102 6e-21
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 101 2e-20
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 100 4e-20
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 99 6e-20
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 99 8e-20
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 98 1e-19
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 98 1e-19
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 97 4e-19
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 96 9e-19
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 95 2e-18
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 94 3e-18
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 94 3e-18
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 93 4e-18
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno... 93 6e-18
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 92 7e-18
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 92 1e-17
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 91 2e-17
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 91 2e-17
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 91 2e-17
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 91 3e-17
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 91 3e-17
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)... 90 4e-17
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 90 4e-17
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno... 90 5e-17
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno... 89 8e-17
gi|17531917|ref|NP_494490.1| putative protein family member (2D5... 89 1e-16
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 86 5e-16
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 86 5e-16
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb... 85 1e-15
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno... 85 2e-15
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 84 3e-15
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 84 3e-15
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 81 2e-14
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno... 79 9e-14
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 79 1e-13
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 79 1e-13
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot... 77 3e-13
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 76 6e-13
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 75 9e-13
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 75 2e-12
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 75 2e-12
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family... 74 3e-12
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 72 8e-12
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 72 8e-12
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 72 1e-11
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 72 1e-11
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 72 1e-11
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family... 72 1e-11
gi|17506693|ref|NP_493312.1| putative protein family member (1N7... 70 3e-11
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 70 5e-11
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 69 7e-11
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 69 9e-11
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 66 8e-10
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ... 65 1e-09
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 65 2e-09
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 64 3e-09
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam... 64 3e-09
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 64 3e-09
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd... 64 3e-09
gi|17507421|ref|NP_493450.1| putative protein family member (1O6... 64 4e-09
gi|17565952|ref|NP_507583.1| c-type lectin precursor family memb... 61 2e-08
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 60 4e-08
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 59 7e-08
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 59 1e-07
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family... 58 2e-07
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 58 2e-07
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family... 55 1e-06
gi|39583048|emb|CAE71827.1| Hypothetical protein CBG18868 [Caeno... 55 1e-06
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno... 55 1e-06
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb... 55 1e-06
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd... 54 2e-06
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno... 54 3e-06
gi|17559100|ref|NP_505753.1| putative protein family member (5L2... 54 3e-06
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)... 52 9e-06
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh... 52 1e-05
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam... 52 1e-05
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 51 2e-05
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k... 51 3e-05
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k... 50 6e-05
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family... 49 7e-05
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 49 1e-04
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno... 49 1e-04
gi|39588191|emb|CAE68116.1| Hypothetical protein CBG13759 [Caeno... 47 3e-04
gi|17558764|ref|NP_504965.1| predicted CDS, putative protein fam... 47 4e-04
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 46 6e-04
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno... 46 8e-04
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family... 45 0.001
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam... 45 0.001
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU... 44 0.002
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai... 44 0.002
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno... 44 0.003
gi|39583394|emb|CAE66369.1| Hypothetical protein CBG11628 [Caeno... 44 0.003
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic... 43 0.007
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec... 42 0.009
gi|33300499|emb|CAE18002.1| Hypothetical protein Y51A2A.11 [Caen... 42 0.009
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai... 42 0.009
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab... 42 0.012
gi|17559556|ref|NP_507665.1| predicted CDS, c-type lectin family... 41 0.020
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ... 41 0.020
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami... 41 0.020
gi|39581670|emb|CAE57178.1| Hypothetical protein CBG00017 [Caeno... 41 0.026
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno... 40 0.034
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 40 0.044
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 40 0.058
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ... 40 0.058
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam... 39 0.075
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno... 39 0.098
gi|17539972|ref|NP_502157.1| predicted CDS, putative protein fam... 39 0.13
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor... 39 0.13
gi|17506207|ref|NP_493162.1| c-type lectin and CUB domain contai... 38 0.17
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor... 38 0.22
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n... 38 0.22
gi|34555967|emb|CAB16536.2| Hypothetical protein Y70C5C.2 [Caeno... 38 0.22
gi|39583395|emb|CAE66370.1| Hypothetical protein CBG11629 [Caeno... 38 0.22
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 38 0.22
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family... 38 0.22
gi|17559516|ref|NP_504865.1| c-type lectin and CUB domain contai... 37 0.29
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 37 0.29
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab... 37 0.37
gi|22774588|gb|AAN07447.1| envelope glycoprotein [Human immunode... 37 0.37
gi|6540372|gb|AAF16202.1| envelope glycoprotein [Human immunodef... 37 0.37
gi|17507929|ref|NP_493197.1| c-type lectin and CUB domain contai... 37 0.49
gi|6540360|gb|AAF16190.1| envelope glycoprotein [Human immunodef... 37 0.49
gi|17558312|ref|NP_506807.1| c-type lectin family member (5P828)... 37 0.49
gi|39587833|emb|CAE67851.1| Hypothetical protein CBG13439 [Caeno... 37 0.49
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU... 37 0.49
gi|6540374|gb|AAF16204.1| envelope glycoprotein [Human immunodef... 37 0.49
gi|6540377|gb|AAF16207.1| envelope glycoprotein [Human immunodef... 36 0.64
gi|4808981|gb|AAD30041.1| receptor protein-tyrosine kinase; HTK2... 35 1.1
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 35 1.1
gi|14290034|gb|AAK59217.1| envelope glycoprotein [Human immunode... 35 1.4
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica] 35 1.4
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 35 1.4
gi|31204765|ref|XP_311331.1| ENSANGP00000001657 [Anopheles gambi... 35 1.4
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 35 1.4
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 35 1.4
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 35 1.4
gi|31205409|ref|XP_311653.1| ENSANGP00000023472 [Anopheles gambi... 35 1.4
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 35 1.4
gi|47218860|emb|CAG02845.1| unnamed protein product [Tetraodon n... 35 1.4
gi|47211657|emb|CAF94910.1| unnamed protein product [Tetraodon n... 35 1.4
gi|39593826|emb|CAE62119.1| Hypothetical protein CBG06159 [Caeno... 35 1.4
gi|17535965|ref|NP_493772.1| predicted CDS, putative secreted or... 35 1.4
gi|22774863|gb|AAN07580.1| envelope glycoprotein [Human immunode... 35 1.4
gi|34786368|emb|CAD87146.1| gp120 protein [Human immunodeficienc... 35 1.9
gi|28200475|gb|AAO31762.1| endo-b1,4-mannanase 26B [Cellvibrio j... 35 1.9
gi|6540368|gb|AAF16198.1| envelope glycoprotein [Human immunodef... 35 1.9
gi|126127|sp|P06027|LECE_ANTCR Echinoidin >gnl|BL_ORD_ID|1193382... 35 1.9
gi|39588558|emb|CAE58081.1| Hypothetical protein CBG01162 [Caeno... 35 1.9
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno... 35 1.9
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno... 35 1.9
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre... 35 1.9
gi|3211889|gb|AAC21518.1| envelope glycoprotein; gp120 [Human im... 34 2.4
gi|22775055|gb|AAN07668.1| envelope glycoprotein [Human immunode... 34 2.4
gi|31872509|gb|AAP59117.1| envelope glycoprotein [Human immunode... 34 3.2
gi|31872433|gb|AAP59089.1| envelope glycoprotein [Human immunode... 34 3.2
gi|22775212|gb|AAN07745.1| envelope glycoprotein [Human immunode... 34 3.2
gi|22775111|gb|AAN07695.1| envelope glycoprotein [Human immunode... 34 3.2
gi|34535366|dbj|BAC87294.1| unnamed protein product [Homo sapiens] 34 3.2
gi|34532063|dbj|BAC86307.1| unnamed protein product [Homo sapiens] 34 3.2
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno... 34 3.2
gi|14531783|gb|AAK66323.1| envelope glycoprotein [Human immunode... 34 3.2
gi|31872487|gb|AAP59106.1| envelope glycoprotein [Human immunode... 34 3.2
gi|31872453|gb|AAP59395.1| envelope glycoprotein [Human immunode... 34 3.2
gi|22774753|gb|AAN07526.1| envelope glycoprotein [Human immunode... 34 3.2
gi|22774618|gb|AAN07462.1| envelope glycoprotein [Human immunode... 34 3.2
gi|22774952|gb|AAN07619.1| envelope glycoprotein [Human immunode... 34 3.2
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 33 4.1
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 33 4.1
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 33 4.1
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor... 33 4.1
gi|17558310|ref|NP_506808.1| c-type lectin precursor family memb... 33 4.1
gi|16118279|gb|AAL12657.1| envelope glycoprotein [Human immunode... 33 4.1
gi|6912282|ref|NP_036204.1| complement component 1, q subcompone... 33 4.1
gi|21759074|sp|Q9NPY3|CD93_HUMAN Complement component C1q recept... 33 4.1
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 33 4.1
gi|24421055|emb|CAC82720.1| C1q receptor protein [Homo sapiens] 33 4.1
gi|34786452|emb|CAD87188.1| gp120 protein [Human immunodeficienc... 33 4.1
gi|38491933|gb|AAR22297.1| envelope glycoprotein [Human immunode... 33 5.4
gi|17543706|ref|NP_499975.1| c-type lectin family member (4B469)... 33 5.4
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno... 33 5.4
gi|31872507|gb|AAP59116.1| envelope glycoprotein [Human immunode... 33 5.4
gi|6754578|ref|NP_034870.1| complement component 1, q subcompone... 33 5.4
gi|31872503|gb|AAP59114.1| envelope glycoprotein [Human immunode... 33 5.4
gi|6958360|gb|AAF32553.1| envelope glycoprotein [Human immunodef... 33 5.4
gi|405021|gb|AAA03303.1| gp120 [Human immunodeficiency virus typ... 33 5.4
gi|24459815|gb|AAN34498.1| envelope glycoprotein [Human immunode... 33 5.4
gi|47551311|ref|NP_999836.1| echinoidin [Strongylocentrotus purp... 33 5.4
gi|31872447|gb|AAP59392.1| envelope glycoprotein [Human immunode... 33 5.4
gi|16758114|ref|NP_445835.1| lymphocyte antigen 68 [Rattus norve... 33 5.4
gi|21541989|sp|Q9ET61|CD93_RAT Complement component C1q receptor... 33 5.4
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru... 33 5.4
gi|14531817|gb|AAK66340.1| envelope glycoprotein [Human immunode... 33 5.4
gi|2290146|gb|AAC58911.1| envelope glycoprotein [Human immunodef... 33 5.4
gi|31872467|gb|AAP59096.1| envelope glycoprotein [Human immunode... 33 5.4
gi|38101637|gb|EAA48569.1| hypothetical protein MG00227.4 [Magna... 33 5.4
gi|47221564|emb|CAF97829.1| unnamed protein product [Tetraodon n... 33 5.4
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 33 7.0
gi|14532227|gb|AAK66545.1| envelope glycoprotein [Human immunode... 33 7.0
gi|14531797|gb|AAK66330.1| envelope glycoprotein [Human immunode... 33 7.0
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 33 7.0
gi|14326154|gb|AAK60167.1| envelope glycoprotein [Human immunode... 33 7.0
gi|799060|gb|AAB06647.1| envelope glycoprotein, V3-V5 region 33 7.0
gi|405011|gb|AAA03298.1| gp120 [Human immunodeficiency virus typ... 33 7.0
gi|17559882|ref|NP_504948.1| predicted CDS, putative protein (5I... 33 7.0
gi|14531973|gb|AAK66418.1| envelope glycoprotein [Human immunode... 33 7.0
gi|14532191|gb|AAK66527.1| envelope glycoprotein [Human immunode... 33 7.0
gi|14532217|gb|AAK66540.1| envelope glycoprotein [Human immunode... 33 7.0
gi|31872475|gb|AAP59100.1| envelope glycoprotein [Human immunode... 33 7.0
gi|14532225|gb|AAK66544.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532199|gb|AAK66531.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532163|gb|AAK66513.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532173|gb|AAK66518.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532175|gb|AAK66519.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532147|gb|AAK66505.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532161|gb|AAK66512.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532235|gb|AAK66549.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532169|gb|AAK66516.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532165|gb|AAK66514.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532177|gb|AAK66520.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532185|gb|AAK66524.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532189|gb|AAK66526.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532171|gb|AAK66517.1| envelope glycoprotein [Human immunode... 32 9.2
gi|6958364|gb|AAF32555.1| envelope glycoprotein [Human immunodef... 32 9.2
gi|6958366|gb|AAF32556.1| envelope glycoprotein [Human immunodef... 32 9.2
gi|31872511|gb|AAP59118.1| envelope glycoprotein [Human immunode... 32 9.2
gi|22774887|gb|AAN07591.1| envelope glycoprotein [Human immunode... 32 9.2
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno... 32 9.2
gi|22774889|gb|AAN07592.1| envelope glycoprotein [Human immunode... 32 9.2
gi|17536123|ref|NP_494003.1| predicted CDS, CUB sushi multiple d... 32 9.2
gi|14531761|gb|AAK66312.1| envelope glycoprotein [Human immunode... 32 9.2
gi|18252422|gb|AAL66251.1| envelope glycoprotein [Human immunode... 32 9.2
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno... 32 9.2
gi|6919968|sp|Q62230|SN_MOUSE Sialoadhesin precursor (Sialic aci... 32 9.2
gi|14532007|gb|AAK66435.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14531819|gb|AAK66341.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532001|gb|AAK66432.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14531821|gb|AAK66342.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14531825|gb|AAK66344.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532071|gb|AAK66467.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14532183|gb|AAK66523.1| envelope glycoprotein [Human immunode... 32 9.2
gi|1839441|gb|AAB47092.1| platelet glycoprotein Ib-binding prote... 32 9.2
gi|14531873|gb|AAK66368.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14531815|gb|AAK66339.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14531839|gb|AAK66351.1| envelope glycoprotein [Human immunode... 32 9.2
gi|14531871|gb|AAK66367.1| envelope glycoprotein [Human immunode... 32 9.2
gi|31872451|gb|AAP59394.1| envelope glycoprotein [Human immunode... 32 9.2
gi|6755584|ref|NP_035556.1| sialoadhesin [Mus musculus] >gnl|BL_... 32 9.2
gi|557250|emb|CAA85268.1| sialoadhesin [Mus musculus] 32 9.2
gi|21311618|gb|AAM46809.1| envelope glycoprotein [Human immunode... 32 9.2
gi|19568961|gb|AAL91986.1| envelope glycoprotein [Human immunode... 32 9.2
>gi|17511033|ref|NP_492868.1| c-type lectin precursor family member
(1L741) [Caenorhabditis elegans]
gi|7511120|pir||T27840 hypothetical protein ZK39.2 - Caenorhabditis
elegans
gi|3881627|emb|CAB05018.1| Hypothetical protein ZK39.2
[Caenorhabditis elegans]
Length = 229
Score = 374 bits (959), Expect = e-102
Identities = 184/229 (80%), Positives = 184/229 (80%)
Frame = +1
Query: 1 MTKFIXXXXXXXXXXIDFDXXXXXXCEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCET 180
MTKFI IDFD CED CET
Sbjct: 1 MTKFILLALVGLAAAIDFDSSSSESCEDGNGHGHGHGNGNGNGNGNGNGNGGRANGGCET 60
Query: 181 GWRHFRRPSGSWCVRVFGGRLNQGAAQSQCQSFGATLSGLRNLEEARTISNLALSVIGRS 360
GWRHFRRPSGSWCVRVFGGRLNQGAAQSQCQSFGATLSGLRNLEEARTISNLALSVIGRS
Sbjct: 61 GWRHFRRPSGSWCVRVFGGRLNQGAAQSQCQSFGATLSGLRNLEEARTISNLALSVIGRS 120
Query: 361 SGGIWLGARRTTACAKQHKTTSCSTTSSFRWTDSSASGTAGFVWNNVQPDNSDLNSQCAV 540
SGGIWLGARRTTACAKQHKTTSCSTTSSFRWTDSSASGTAGFVWNNVQPDNSDLNSQCAV
Sbjct: 121 SGGIWLGARRTTACAKQHKTTSCSTTSSFRWTDSSASGTAGFVWNNVQPDNSDLNSQCAV 180
Query: 541 LHAGSSAATVSNAVWQPAMMDDVTCSFDPAGRDPRSIYGYVCGKKPSRR 687
LHAGSSAATVSNAVWQPAMMDDVTCSFDPAGRDPRSIYGYVCGKKPSRR
Sbjct: 181 LHAGSSAATVSNAVWQPAMMDDVTCSFDPAGRDPRSIYGYVCGKKPSRR 229