Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= ZK39_3
         (642 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb...   408   e-113
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb...   229   3e-59
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno...   205   7e-52
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb...   192   5e-48
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)...   185   7e-46
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k...   172   5e-42
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor...   171   8e-42
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ...   171   8e-42
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab...   171   8e-42
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno...   166   4e-40
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ...   162   7e-39
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb...   159   6e-38
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi...   155   8e-37
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)...   152   7e-36
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)...   150   2e-35
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family...   149   4e-35
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family...   144   2e-33
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)...   139   5e-32
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb...   135   7e-31
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur...   134   2e-30
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb...   129   4e-29
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family...   129   4e-29
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb...   125   5e-28
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)...   121   1e-26
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno...   120   3e-26
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur...   117   1e-25
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ...   115   5e-25
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k...   114   1e-24
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno...   113   3e-24
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ...   113   4e-24
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur...   109   4e-23
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or...   108   9e-23
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family...   108   9e-23
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno...   106   3e-22
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno...   106   3e-22
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno...   106   3e-22
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno...   106   4e-22
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno...   105   1e-21
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur...   105   1e-21
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae...   103   2e-21
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb...   103   3e-21
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family...   102   6e-21
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family...   101   1e-20
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family...   101   1e-20
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno...   101   1e-20
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6...   100   2e-20
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb...    98   1e-19
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno...    96   6e-19
gi|17506689|ref|NP_493310.1| putative protein family member (1N7...    95   1e-18
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd...    94   2e-18
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb...    94   2e-18
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)...    94   2e-18
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae...    94   2e-18
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno...    92   1e-17
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno...    91   2e-17
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno...    89   7e-17
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)...    89   9e-17
gi|17531917|ref|NP_494490.1| putative protein family member (2D5...    88   1e-16
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam...    87   2e-16
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)...    87   2e-16
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)...    86   8e-16
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family...    85   1e-15
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur...    85   1e-15
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno...    84   2e-15
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno...    84   2e-15
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno...    84   2e-15
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb...    84   3e-15
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno...    83   5e-15
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno...    82   7e-15
gi|17539326|ref|NP_503090.1| versican family member, possibly N-...    80   3e-14
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno...    79   6e-14
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno...    79   6e-14
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno...    79   1e-13
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno...    78   1e-13
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno...    77   2e-13
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno...    77   2e-13
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno...    77   2e-13
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno...    77   3e-13
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb...    77   3e-13
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot...    75   1e-12
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno...    75   1e-12
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam...    75   1e-12
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family...    74   3e-12
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb...    73   4e-12
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family...    73   4e-12
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno...    72   1e-11
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa...    72   1e-11
gi|17506693|ref|NP_493312.1| putative protein family member (1N7...    71   2e-11
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam...    71   2e-11
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd...    71   2e-11
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno...    70   3e-11
gi|17565952|ref|NP_507583.1| c-type lectin precursor family memb...    70   3e-11
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)...    70   3e-11
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno...    70   4e-11
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb...    69   6e-11
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno...    67   3e-10
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno...    66   5e-10
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno...    65   8e-10
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)...    65   1e-09
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno...    65   1e-09
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family...    63   4e-09
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno...    62   7e-09
gi|17539324|ref|NP_503089.1| putative protein family member, wit...    61   2e-08
gi|17554888|ref|NP_497956.1| predicted CDS, c-type lectin family...    58   2e-07
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)...    58   2e-07
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb...    57   4e-07
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ...    54   2e-06
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family...    54   2e-06
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd...    54   3e-06
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno...    54   3e-06
gi|39583048|emb|CAE71827.1| Hypothetical protein CBG18868 [Caeno...    53   4e-06
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno...    52   7e-06
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)...    51   2e-05
gi|17553032|ref|NP_497944.1| predicted CDS, c-type lectin family...    51   2e-05
gi|17562684|ref|NP_507837.1| putative protein family member (5U2...    51   2e-05
gi|33300499|emb|CAE18002.1| Hypothetical protein Y51A2A.11 [Caen...    50   4e-05
gi|17507421|ref|NP_493450.1| putative protein family member (1O6...    50   5e-05
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb...    49   6e-05
gi|17559100|ref|NP_505753.1| putative protein family member (5L2...    49   8e-05
gi|47227138|emb|CAG00500.1| unnamed protein product [Tetraodon n...    47   2e-04
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam...    47   2e-04
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno...    47   3e-04
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb...    47   4e-04
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru...    46   5e-04
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU...    46   5e-04
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha...    46   5e-04
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno...    46   7e-04
gi|17557544|ref|NP_505863.1| putative protein family member (5L7...    45   0.001
gi|126130|sp|P21963|LECG_CROAT Galactose-specific lectin >gnl|BL...    45   0.001
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno...    45   0.001
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno...    45   0.001
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno...    44   0.002
gi|39588191|emb|CAE68116.1| Hypothetical protein CBG13759 [Caeno...    44   0.003
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|...    44   0.003
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus]     44   0.003
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k...    44   0.003
gi|34098771|sp|Q9YI92|MMHB_AGKHA Mamushigin beta chain precursor...    44   0.003
gi|17552510|ref|NP_498023.1| predicted CDS, c-type lectin and CU...    44   0.003
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam...    43   0.005
gi|17552508|ref|NP_498022.1| c-type lectin and CUB domain contai...    43   0.006
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co...    43   0.006
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ...    43   0.006
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno...    43   0.006
gi|39581670|emb|CAE57178.1| Hypothetical protein CBG00017 [Caeno...    43   0.006
gi|211655|gb|AAA48720.1| proteoglycan core protein                     43   0.006
gi|37537732|gb|AAQ92957.1| BJcuL precursor [Bothrops jararacussu]      43   0.006
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh...    43   0.006
gi|17541614|ref|NP_502826.1| putative secreted or extracellular ...    42   0.008
gi|17385630|dbj|BAB78598.1| GalNAc-specific lectin [Asterina pec...    42   0.010
gi|27530675|dbj|BAC54021.1| C-type lectin 2 [Anguilla japonica]        42   0.010
gi|34922459|sp|P83519|LECG_BOTJR Galactose-specific lectin (BJcuL)     42   0.010
gi|7674107|sp|Q9YGP1|LECG_TRIST Galactose-binding lectin precurs...    42   0.013
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab...    42   0.013
gi|34922645|sp|Q9PSN0|LECG_BITAR Galactose-specific lectin (PAL)...    42   0.013
gi|17507129|ref|NP_493188.1| predicted CDS, c-type lectin precur...    41   0.017
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S...    41   0.022
gi|33332307|gb|AAQ11365.1| crotocetin [Crotalus durissus terrifi...    41   0.022
gi|1709255|sp|P55066|PGCN_MOUSE Neurocan core protein precursor ...    41   0.022
gi|40789268|ref|NP_031815.2| chondroitin sulfate proteoglycan 3 ...    41   0.022
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro...    40   0.029
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ...    40   0.029
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus]                       40   0.029
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo...    40   0.029
gi|32396016|gb|AAP42417.1| c-type lectin [Bothrops jararacussu]        40   0.029
gi|113926|sp|P05140|ANP_HEMAM Type II antifreeze protein precurs...    40   0.038
gi|213876|gb|AAA49618.1| antifreeze protein                            40   0.038
gi|40889261|pdb|1OZ7|B Chain B, Crystal Structure Of Echicetin F...    40   0.038
gi|3023232|sp|P81114|ABA4_TRIAB Alboaggregin A subunit 4               40   0.038
gi|32450776|gb|AAP41219.2| echicetin B-chain [Echis carinatus]         40   0.038
gi|6729952|pdb|2AFP|A Chain A, The Solution Structure Of Type Ii...    40   0.038
gi|213874|gb|AAA49617.1| antifreeze polypeptide (AFP) precursor        40   0.038
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n...    40   0.038
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam...    40   0.038
gi|41353970|gb|AAS01426.1| C-type lectin [Bothrops insularis]          40   0.050
gi|6678744|ref|NP_032552.1| killer cell lectin-like receptor sub...    40   0.050
gi|10441756|gb|AAG17178.1| halyxin A-chain precursor [Gloydius h...    40   0.050
gi|34877453|ref|XP_346488.1| hypothetical protein XP_346487 [Rat...    40   0.050
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor...    40   0.050
gi|39585605|emb|CAE65365.1| Hypothetical protein CBG10310 [Caeno...    40   0.050
gi|13928904|ref|NP_113841.1| chondroitin sulfate proteoglycan 3 ...    40   0.050
gi|39583395|emb|CAE66370.1| Hypothetical protein CBG11629 [Caeno...    40   0.050
gi|17544698|ref|NP_502451.1| phospholipase A2 receptor precursor...    40   0.050
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe...    40   0.050
gi|33332305|gb|AAQ11364.1| crotocetin-1 [Crotalus durissus terri...    39   0.065
gi|17539582|ref|NP_500691.1| predicted CDS, putative protein fam...    39   0.065
gi|34922643|sp|Q9PSM4|LECG_LACST Galactose-specific lectin (Muti...    39   0.065
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno...    39   0.065
gi|181168|gb|AAA35726.1| proteoglycan core protein                     39   0.085
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic...    39   0.085
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (...    39   0.085
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr...    39   0.085
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr...    39   0.085
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA...    39   0.085
gi|20562939|gb|AAM22787.1| C-type lectin [Deinagkistrodon acutus...    39   0.085
gi|3790610|gb|AAC68695.1| layilin [Cricetulus griseus]                 39   0.11
gi|3212543|pdb|1IXX|A Chain A, Crystal Structure Of Coagulation ...    39   0.11
gi|12583677|dbj|BAB21452.1| factor XI/factor X binding protein A...    39   0.11
gi|39583338|emb|CAE66312.1| Hypothetical protein CBG11562 [Caeno...    39   0.11
gi|2851435|sp|P23806|IXA_TRIFL Coagulation factor IX/factor X-bi...    39   0.11
gi|39587014|emb|CAE62949.1| Hypothetical protein CBG07162 [Caeno...    39   0.11
gi|39588559|emb|CAE58082.1| Hypothetical protein CBG01163 [Caeno...    39   0.11
gi|17509297|ref|NP_493166.1| predicted CDS, tolloid like family ...    39   0.11
gi|47216660|emb|CAG04858.1| unnamed protein product [Tetraodon n...    38   0.14
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)...    38   0.14
gi|4321120|gb|AAA29218.2| tyrosine kinase receptor [Hydra vulgaris]    38   0.14
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre...    38   0.14
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga...    38   0.14
gi|33341216|gb|AAQ15169.1| stejaggregin-A beta chain-3 [Trimeres...    38   0.14
gi|39582793|emb|CAE74256.1| Hypothetical protein CBG21945 [Caeno...    38   0.14
gi|37993393|gb|AAR06852.1| C-type lectin-2 [Bitis gabonica]            38   0.19
gi|39588558|emb|CAE58081.1| Hypothetical protein CBG01162 [Caeno...    38   0.19
gi|39581152|emb|CAE71009.1| Hypothetical protein CBG17848 [Caeno...    38   0.19
gi|33341194|gb|AAQ15158.1| stejaggregin-B beta chain-1 [Trimeres...    38   0.19
gi|23321263|gb|AAN23126.1| agglucetin-beta 1 subunit precursor [...    38   0.19
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb...    38   0.19
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro...    37   0.25
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb...    37   0.25
gi|13876735|gb|AAK43584.1| C-type lectin-like protein 1 [Bungaru...    37   0.25
gi|206105|gb|AAA41836.1| proteoglycan                                  37   0.25
gi|7495300|pir||T32032 hypothetical protein C03H5.1 - Caenorhabd...    37   0.25
gi|6715115|gb|AAF26287.1| agkisacutacin B chain [Deinagkistrodon...    37   0.25
gi|11277029|pir||JC7135 agkisacutacin beta chain precursor - sha...    37   0.25
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n...    37   0.25
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor...    37   0.25
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n...    37   0.25
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca...    37   0.25
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr...    37   0.25
gi|38090330|ref|XP_146887.2| similar to layilin [Mus musculus]         37   0.25
gi|938265|emb|CAA45972.1| natural killer cell receptor-P1 [Mus m...    37   0.25
gi|32564282|ref|NP_493725.2| c-type lectin and CUB domain contai...    37   0.25
gi|26352257|dbj|BAC39765.1| unnamed protein product [Mus musculus]     37   0.25
gi|17557546|ref|NP_505862.1| putative protein (5L753) [Caenorhab...    37   0.25
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno...    37   0.25
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8...    37   0.25
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio]                     37   0.25
gi|7488591|pir||T14536 S-locus-specific glycoprotein - wild cabb...    37   0.32
gi|1839442|gb|AAB47093.1| platelet glycoprotein Ib-binding prote...    37   0.32
gi|17558764|ref|NP_504965.1| predicted CDS, putative protein fam...    37   0.32
gi|17506483|ref|NP_493152.1| c-type lectin and CUB domain contai...    37   0.32
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ...    37   0.32
gi|11277028|pir||JC7134 agkisacutacin alpha chain precursor - sh...    37   0.32
gi|17531799|ref|NP_494750.1| putative protein family member (2E5...    37   0.32
gi|33341214|gb|AAQ15168.1| stejaggregin-A beta chain-2 [Trimeres...    37   0.32
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (...    37   0.32
gi|39583088|emb|CAE60628.1| Hypothetical protein CBG04271 [Caeno...    37   0.32
gi|17564166|ref|NP_506744.1| low affinity IgE Fc receptor B fami...    37   0.42
gi|33341196|gb|AAQ15159.1| stejaggregin-B beta chain-2 [Trimeres...    37   0.42
gi|17539578|ref|NP_500693.1| predicted CDS, putative nuclear pro...    37   0.42
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic...    37   0.42
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno...    37   0.42
gi|13876739|gb|AAK43586.1| C-type lectin-like protein 1 [Bungaru...    36   0.55
gi|39583394|emb|CAE66369.1| Hypothetical protein CBG11628 [Caeno...    36   0.55
gi|38085039|ref|XP_355810.1| similar to dendritic cell immuno-ac...    36   0.55
gi|33243094|gb|AAQ01217.1| C-type lectin CTL-9 [Echis carinatus ...    36   0.55
gi|33341184|gb|AAQ15153.1| factor IX/X binding protein alpha cha...    36   0.55
gi|39585606|emb|CAE65366.1| Hypothetical protein CBG10311 [Caeno...    36   0.55
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens]        36   0.72
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [...    36   0.72
gi|7488545|pir||T14422 S-locus-specific glycoprotein - turnip (f...    36   0.72
gi|833853|gb|AAA67565.1| versican V2 core protein precursor            36   0.72
gi|39581146|emb|CAE71003.1| Hypothetical protein CBG17839 [Caeno...    36   0.72
gi|14719570|pdb|1IOD|A Chain A, Crystal Structure Of The Complex...    36   0.72
gi|7993934|sp|P81996|ECHB_ECHCA Echicetin beta subunit >gnl|BL_O...    36   0.72
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|...    36   0.72
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens]        36   0.72
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma...    36   0.72
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p...    36   0.72
gi|10641064|dbj|BAB16306.1| C-type lectin TC14-3 [Polyandrocarpa...    36   0.72
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ...    36   0.72
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [...    36   0.72
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi...    36   0.72
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote...    36   0.72
gi|31200327|ref|XP_309111.1| ENSANGP00000005322 [Anopheles gambi...    35   0.94
gi|39585604|emb|CAE65364.1| Hypothetical protein CBG10309 [Caeno...    35   0.94
gi|20562937|gb|AAM22786.1| ACF 1/2 A-chain [Deinagkistrodon acutus]    35   0.94
gi|8980619|dbj|BAA99281.1| anticoagulant protein A [Deinagkistro...    35   0.94
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ...    35   0.94
gi|25137427|dbj|BAC24063.1| S-locus glycoprotein [Brassica olera...    35   0.94
gi|1655437|dbj|BAA13567.1| TC14-1 [Polyandrocarpa misakiensis]         35   0.94
gi|10641060|dbj|BAB16305.1| C-type lectin TC14-2 [Polyandrocarpa...    35   0.94
gi|1655439|dbj|BAA13568.1| TC14-2 [Polyandrocarpa misakiensis]         35   0.94
gi|10641056|dbj|BAB16304.1| C-type lectin TC14-1 [Polyandrocarpa...    35   0.94
gi|126126|sp|P16108|LECC_POLMI Lectin >gnl|BL_ORD_ID|951175 gi|1...    35   0.94
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ...    35   1.2
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ...    35   1.2
gi|25395663|pir||B88392 protein R06B10.3 [imported] - Caenorhabd...    35   1.2
gi|17554488|ref|NP_497312.1| pancreatitis-associated protein pre...    35   1.2
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens]            35   1.2
gi|40548420|ref|NP_954705.1| collectin sub-family member 11 isof...    35   1.2
gi|13128972|ref|NP_076932.1| collectin sub-family member 11 isof...    35   1.2
gi|39590313|emb|CAE66052.1| Hypothetical protein CBG11253 [Caeno...    35   1.2
gi|39585607|emb|CAE65367.1| Hypothetical protein CBG10312 [Caeno...    35   1.2
gi|31203403|ref|XP_310650.1| ENSANGP00000020762 [Anopheles gambi...    35   1.2
gi|33416211|gb|AAQ18640.1| factor IX binding protein A chain [Gl...    35   1.2
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti...    35   1.2
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens]    35   1.2
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens]                     35   1.2
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]...    35   1.2
gi|38049424|ref|XP_283054.2| collectin sub-family member 11 [Mus...    35   1.6
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE...    35   1.6
gi|34858498|ref|XP_342766.1| similar to NATURAL KILLER CELL SURF...    35   1.6
gi|28378166|ref|NP_785058.1| extracellular protein [Lactobacillu...    35   1.6
gi|17559568|ref|NP_507659.1| predicted CDS, putative protein fam...    35   1.6
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno...    35   1.6
gi|38100274|gb|EAA47424.1| hypothetical protein MG02667.4 [Magna...    35   1.6
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor...    35   1.6
gi|3023229|sp|P81111|ABA1_TRIAB Alboaggregin A subunit 1               35   1.6
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B...    34   2.1
gi|27530677|dbj|BAC54022.1| C-type lectin 1 [Anguilla japonica]        34   2.1
gi|8392926|ref|NP_058885.1| asialoglycoprotein receptor 2; rat h...    34   2.1
gi|39587013|emb|CAE62948.1| Hypothetical protein CBG07161 [Caeno...    34   2.1
gi|322659|pir||S31429 S-receptor kinase (EC 2.7.1.-) precursor -...    34   2.1
gi|20273044|gb|AAF26286.2| agkisacutacin A chain [Deinagkistrodo...    34   2.1
gi|34863397|ref|XP_345653.1| similar to hypothetical protein MGC...    34   2.1
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus]      34   2.1
gi|39587019|emb|CAE62954.1| Hypothetical protein CBG07168 [Caeno...    34   2.1
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus]                     34   2.7
gi|1143285|gb|AAA87847.1| brevican core protein                        34   2.7
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_...    34   2.7
gi|50801414|ref|XP_424170.1| PREDICTED: similar to mannose recep...    34   2.7
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ...    34   2.7
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ...    34   2.7
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID...    34   2.7
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ...    34   2.7
gi|17538888|ref|NP_503095.1| predicted CDS, c-type lectin family...    34   2.7
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr...    34   2.7
gi|37575445|gb|AAQ93687.1| mucrocetin beta chain [Protobothrops ...    34   2.7
gi|39655010|pdb|1V4L|B Chain B, Crystal Structure Of A Platelet ...    34   2.7
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus]        34   2.7
gi|50750964|ref|XP_422207.1| PREDICTED: similar to cell adhesion...    33   3.6
gi|17539580|ref|NP_500692.1| predicted CDS, putative protein fam...    33   3.6
gi|48766367|ref|ZP_00270917.1| COG1217: Predicted membrane GTPas...    33   3.6
gi|39581194|emb|CAE73599.1| Hypothetical protein CBG21085 [Caeno...    33   3.6
gi|17507729|ref|NP_493109.1| predicted CDS, c-type lectin and CU...    33   3.6
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal...    33   3.6
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal...    33   3.6
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal...    33   3.6
gi|1478015|gb|AAB36402.1| ECLV IX/X-bp beta subunit=Ca(2+)-depen...    33   3.6
gi|2773304|gb|AAB96767.1| aggrecan core protein [Equus caballus]       33   3.6
gi|39579290|emb|CAE56946.1| Hypothetical protein CBG24793 [Caeno...    33   3.6
gi|46128591|ref|XP_388849.1| hypothetical protein FG08673.1 [Gib...    33   4.7
gi|24641465|ref|NP_511136.2| CG1500-PA [Drosophila melanogaster]...    33   4.7
gi|25137391|dbj|BAC24045.1| S-locus receptor kinase [Brassica ol...    33   4.7
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m...    33   4.7
gi|24965387|gb|AAK19313.2| S-receptor kinase [Arabidopsis lyrata]      33   4.7
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g...    33   4.7
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens]          33   4.7
gi|25137385|dbj|BAC24042.1| S-locus receptor kinase [Brassica ol...    33   4.7
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul...    33   4.7
gi|33243072|gb|AAQ01206.1| C-type lectin CTL-1 [Bitis arietans]        33   4.7
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno...    33   4.7
gi|47222448|emb|CAG12968.1| unnamed protein product [Tetraodon n...    33   4.7
gi|47195820|emb|CAF88787.1| unnamed protein product [Tetraodon n...    33   4.7
gi|17536123|ref|NP_494003.1| predicted CDS, CUB sushi multiple d...    33   4.7
gi|50750535|ref|XP_422038.1| PREDICTED: similar to Lymphocyte an...    33   4.7
gi|10641067|dbj|BAB16307.1| C-type lectin TC14-4 [Polyandrocarpa...    33   4.7
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_...    33   4.7
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula]         33   4.7
gi|49129289|ref|XP_412902.1| hypothetical protein AN8765.2 [Aspe...    33   4.7
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ...    33   6.1
gi|1685117|gb|AAB36703.1| furrowed [Drosophila melanogaster]           33   6.1
gi|50750537|ref|XP_422039.1| PREDICTED: similar to Lymphocyte an...    33   6.1
gi|48139242|ref|XP_396985.1| similar to ENSANGP00000005322 [Apis...    33   6.1
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B...    33   6.1
gi|126136|sp|P08290|LECI_RAT Asialoglycoprotein receptor R2/3 (H...    33   6.1
gi|206649|gb|AAA42038.1| asialoglycoprotein receptor (RHL2)            33   6.1
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus]     33   6.1
gi|27545354|ref|NP_775414.1| killer cell lectin-like receptor su...    33   6.1
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]...    33   6.1
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus]                      33   6.1
gi|47211657|emb|CAF94910.1| unnamed protein product [Tetraodon n...    33   6.1
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n...    33   6.1
gi|38493076|pdb|1UOS|B Chain B, The Crystal Structure Of The Sna...    33   6.1
gi|2134245|pir||JC5059 bitiscetin beta chain - puff adder >gnl|B...    33   6.1
gi|33332301|gb|AAQ11362.1| convulxin subunit b [Crotalus durissu...    33   6.1
gi|25090034|sp|O93427|CVXB_CRODU Convulxin beta precursor (CVX b...    33   6.1
gi|39654959|pdb|1UMR|C Chain C, Crystal Structure Of The Platele...    33   6.1
gi|39588321|emb|CAE72672.1| Hypothetical protein CBG19888 [Caeno...    33   6.1
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus]                 33   6.1
gi|29372837|emb|CAD83836.1| S-locus-specific glycoprotein [Cicho...    32   8.0
gi|6678746|ref|NP_032553.1| killer cell lectin-like receptor sub...    32   8.0
gi|2146870|pir||S72579 hypothetical protein C35D10.1 - Caenorhab...    32   8.0
gi|3868808|dbj|BAA34232.1| SLG23Bol [Brassica oleracea]                32   8.0
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep...    32   8.0
gi|13774951|gb|AAK39103.1| natural killer cell receptor protein ...    32   8.0
gi|13508195|ref|NP_110144.1| conserved hypothetical protein [Myc...    32   8.0
gi|3868810|dbj|BAA34233.1| SRK23Bol [Brassica oleracea]                32   8.0
gi|1839441|gb|AAB47092.1| platelet glycoprotein Ib-binding prote...    32   8.0
gi|25137353|dbj|BAC24026.1| S-locus receptor kinase [Brassica rapa]    32   8.0
gi|254095|gb|AAB22979.1| NK1.1 alloantigen; natural killer cell ...    32   8.0
gi|39579884|emb|CAE56620.1| Hypothetical protein CBG24376 [Caeno...    32   8.0
gi|886932|emb|CAA61188.1| ORF 171 [Saccharomyces cerevisiae]           32   8.0


>gi|17511035|ref|NP_492867.1| c-type lectin precursor family member
           (22.7 kD) (1L739) [Caenorhabditis elegans]
 gi|7511121|pir||T27841 hypothetical protein ZK39.3 - Caenorhabditis
           elegans
 gi|3881628|emb|CAB05019.1| Hypothetical protein ZK39.3
           [Caenorhabditis elegans]
          Length = 213

 Score =  408 bits (1049), Expect = e-113
 Identities = 201/213 (94%), Positives = 201/213 (94%)
 Frame = +1

Query: 1   MVKLILLTVLVIGATNAMFFIPSKVSCDDKNXXXXXXXXXXXXWRRLNRPSGGWCIRVFE 180
           MVKLILLTVLVIGATNAMFFIPSKVSCDDKN            WRRLNRPSGGWCIRVFE
Sbjct: 1   MVKLILLTVLVIGATNAMFFIPSKVSCDDKNGGGETNGGCGAGWRRLNRPSGGWCIRVFE 60

Query: 181 GVLTQADAEAKCKSRGATLSGLKNAEEARIIADMALPVLNRDSGSVWIGARRTDACMTKS 360
           GVLTQADAEAKCKSRGATLSGLKNAEEARIIADMALPVLNRDSGSVWIGARRTDACMTKS
Sbjct: 61  GVLTQADAEAKCKSRGATLSGLKNAEEARIIADMALPVLNRDSGSVWIGARRTDACMTKS 120

Query: 361 ITSDCTATNSFTWTDGSTSGTAGFVWDSRQPDNDYKKQPCVILLSSKTPETPVSVKNRPW 540
           ITSDCTATNSFTWTDGSTSGTAGFVWDSRQPDNDYKKQPCVILLSSKTPETPVSVKNRPW
Sbjct: 121 ITSDCTATNSFTWTDGSTSGTAGFVWDSRQPDNDYKKQPCVILLSSKTPETPVSVKNRPW 180

Query: 541 LPRMIDDVACSLDPAEGSARIVAGYVCGKKSSQ 639
           LPRMIDDVACSLDPAEGSARIVAGYVCGKKSSQ
Sbjct: 181 LPRMIDDVACSLDPAEGSARIVAGYVCGKKSSQ 213




[DB home][top]