Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZC581_4
(1188 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17511023|ref|NP_491913.1| tyrosine protein kinase similar to ... 808 0.0
gi|7510847|pir||T29770 hypothetical protein ZC581.7 - Caenorhabd... 795 0.0
gi|39597066|emb|CAE59293.1| Hypothetical protein CBG02628 [Caeno... 561 e-158
gi|17538708|ref|NP_499953.1| tyrosine kinase family member (4B34... 559 e-158
gi|17535461|ref|NP_496201.1| tyrosine kinase family member (2K48... 555 e-156
gi|39589124|emb|CAE57857.1| Hypothetical protein CBG00895 [Caeno... 548 e-154
gi|39583632|emb|CAE65736.1| Hypothetical protein CBG10819 [Caeno... 538 e-151
gi|400127|sp|P07332|FES_HUMAN Proto-oncogene tyrosine-protein ki... 213 9e-54
gi|4503687|ref|NP_001996.1| V-FES feline sarcoma viral/V-FPS fuj... 212 1e-53
gi|23452674|gb|AAN33122.1| tyrosine kinase Fps/Fes [Mus musculus] 209 8e-53
gi|66835|pir||TVCTFF protein-tyrosine kinase (EC 2.7.1.112) fes/... 209 1e-52
gi|1345986|sp|P14238|FES_FELCA Proto-oncogene tyrosine-protein k... 209 1e-52
gi|323873|gb|AAA43041.1| gag polyprotein 207 4e-52
gi|125353|sp|P00542|FES_FSVGA Tyrosine-protein kinase transformi... 207 4e-52
gi|33859552|ref|NP_034324.1| feline sarcoma oncogene [Mus muscul... 206 9e-52
gi|125354|sp|P00543|FES_FSVST Tyrosine-protein kinase transformi... 205 1e-51
gi|17538768|ref|NP_501081.1| SH2 motif and protein kinase family... 205 2e-51
gi|209722|gb|AAA42415.1| gag-fps polyprotein 203 7e-51
gi|125366|sp|P00541|FPS_AVISP Tyrosine-protein kinase transformi... 203 7e-51
gi|2117867|pir||I50618 c-fps proto oncogene - chicken >gnl|BL_OR... 201 2e-50
gi|39595891|emb|CAE67394.1| Hypothetical protein CBG12879 [Caeno... 201 2e-50
gi|17506773|ref|NP_490975.1| SH2 motif and protein kinase family... 200 5e-50
gi|17537903|ref|NP_494994.1| tyrosine kinase (2F585) [Caenorhabd... 199 8e-50
gi|49116711|gb|AAH73445.1| Unknown (protein for MGC:80946) [Xeno... 198 2e-49
gi|40796153|ref|NP_955606.1| FBS [Fujinami sarcoma virus] >gnl|B... 197 3e-49
gi|9626155|ref|NP_056889.1| p140 polyprotein [Fujinami sarcoma v... 197 3e-49
gi|17553726|ref|NP_498511.1| SH2 motif and protein kinase family... 197 3e-49
gi|66840|pir||TVFVFS protein-tyrosine kinase (EC 2.7.1.112) fps ... 197 4e-49
gi|209689|gb|AAA42403.1| p140 transforming protein 197 4e-49
gi|4885231|ref|NP_005237.1| fer (fps/fes related) tyrosine kinas... 196 9e-49
gi|17505883|ref|NP_492826.1| SH2 motif and protein kinase family... 196 9e-49
gi|17539452|ref|NP_500846.1| fer (fps/fes related) tyrosine prot... 194 3e-48
gi|66841|pir||OKFFPS protein-tyrosine kinase (EC 2.7.1.112), fps... 194 3e-48
gi|25287726|pir||C88493 protein F57B9.8 [imported] - Caenorhabdi... 194 3e-48
gi|24645330|ref|NP_731341.1| CG8874-PB [Drosophila melanogaster]... 194 3e-48
gi|24645334|ref|NP_731342.1| CG8874-PC [Drosophila melanogaster]... 194 3e-48
gi|39595241|emb|CAE60278.1| Hypothetical protein CBG03859 [Caeno... 193 6e-48
gi|1245415|gb|AAA93470.1| tyrosine kinase [Drosophila melanogaster] 193 6e-48
gi|24645336|ref|NP_731343.1| CG8874-PD [Drosophila melanogaster]... 193 8e-48
gi|45549219|ref|NP_524288.3| CG8874-PA [Drosophila melanogaster]... 193 8e-48
gi|6003683|gb|AAF00543.1| protein tyrosine kinase fer [Canis fam... 191 2e-47
gi|18150842|dbj|BAA81721.3| protein tyrosine kinase [Ephydatia f... 191 4e-47
gi|17541450|ref|NP_501793.1| SH2 motif and protein kinase family... 188 2e-46
gi|47230350|emb|CAF99543.1| unnamed protein product [Tetraodon n... 188 2e-46
gi|17541456|ref|NP_501309.1| SH2 motif and protein kinase family... 187 3e-46
gi|39582584|emb|CAE63903.1| Hypothetical protein CBG08474 [Caeno... 187 4e-46
gi|39584908|emb|CAE64332.1| Hypothetical protein CBG09015 [Caeno... 187 5e-46
gi|39582590|emb|CAE63909.1| Hypothetical protein CBG08480 [Caeno... 186 7e-46
gi|7548235|gb|AAA43046.2| gag polyprotein [Feline sarcoma virus] 186 1e-45
gi|30109312|gb|AAH51249.1| Fert2 protein [Mus musculus] 184 3e-45
gi|31208911|ref|XP_313422.1| ENSANGP00000020160 [Anopheles gambi... 184 3e-45
gi|34785613|gb|AAH58100.1| Fert2 protein [Mus musculus] 184 3e-45
gi|26349973|dbj|BAC38626.1| unnamed protein product [Mus musculus] 184 3e-45
gi|1673620|gb|AAB18988.1| Fer [Mus musculus] 184 3e-45
gi|39595643|emb|CAE67145.1| Hypothetical protein CBG12568 [Caeno... 184 5e-45
gi|3550651|emb|CAA76605.1| tyrosine kinase [Sycon raphanus] 184 5e-45
gi|6679773|ref|NP_032026.1| fer (fms/fps related) protein kinase... 181 2e-44
gi|47216989|emb|CAG04931.1| unnamed protein product [Tetraodon n... 181 2e-44
gi|17540892|ref|NP_501818.1| fer oncogene Related Kinase (44.6 k... 180 5e-44
gi|34857370|ref|XP_214974.2| similar to tyrosine kinase Fps/Fes ... 178 3e-43
gi|17508233|ref|NP_492004.1| tyrosine kinase (kin-14) [Caenorhab... 174 3e-42
gi|125360|sp|P09760|FLK_RAT Tyrosine-protein kinase FLK >gnl|BL_... 172 1e-41
gi|32564575|ref|NP_498912.3| SH2 motif and protein kinase family... 171 3e-41
gi|39593938|emb|CAE70048.1| Hypothetical protein CBG16480 [Caeno... 170 5e-41
gi|45550738|ref|NP_650097.2| CG17309-PA [Drosophila melanogaster... 168 2e-40
gi|24646022|ref|NP_731607.1| CG17309-PB [Drosophila melanogaster... 168 2e-40
gi|40215698|gb|AAR82769.1| LP09923p [Drosophila melanogaster] 168 2e-40
gi|7506080|pir||T23792 hypothetical protein M176.9 - Caenorhabdi... 168 3e-40
gi|17542230|ref|NP_501307.1| SH2 motif and protein kinase family... 167 4e-40
gi|31746497|gb|AAP68901.1| Fes-like tyrosine kinase protein [Sch... 167 4e-40
gi|39585622|emb|CAE65382.1| Hypothetical protein CBG10328 [Caeno... 164 3e-39
gi|17542548|ref|NP_501994.1| tyrosine kinase family member (62.0... 164 5e-39
gi|39585866|emb|CAE61280.1| Hypothetical protein CBG05099 [Caeno... 164 5e-39
gi|17508735|ref|NP_490680.1| defective SPErmatogenesis SPE-8, pr... 162 1e-38
gi|7504091|pir||T29030 hypothetical protein F53G12.6 - Caenorhab... 162 1e-38
gi|30145713|emb|CAB02882.2| Hypothetical protein F01D4.3 [Caenor... 159 9e-38
gi|18150824|dbj|BAA81712.3| protein tyrosine kinase [Ephydatia f... 159 2e-37
gi|40352731|gb|AAH64688.1| MGC69056 protein [Xenopus laevis] 156 1e-36
gi|17539630|ref|NP_501934.1| SH2 motif and protein kinase family... 156 1e-36
gi|18150838|dbj|BAA81719.3| protein tyrosine kinase [Ephydatia f... 155 1e-36
gi|17544448|ref|NP_503024.1| protein kinase and SH2 motif family... 155 2e-36
gi|17544472|ref|NP_503039.1| protein kinase and SH2 motif family... 155 2e-36
gi|39590755|emb|CAE65127.1| Hypothetical protein CBG09992 [Caeno... 155 2e-36
gi|30145800|emb|CAB55139.2| Hypothetical protein Y116A8C.38 [Cae... 155 2e-36
gi|32563673|ref|NP_492594.2| protein kinase transforming protein... 154 3e-36
gi|625222|pir||TVCHSR kinase-related protein ros precursor - chi... 153 9e-36
gi|39586256|emb|CAE66667.1| Hypothetical protein CBG12006 [Caeno... 152 2e-35
gi|38073524|ref|XP_136360.2| v-abl Abelson murine leukemia viral... 151 3e-35
gi|212637|gb|AAA49058.1| cellular-ros protein (c-ros) 150 4e-35
gi|125678|sp|P08941|KROS_CHICK ROS proto-oncogene tyrosine kinas... 150 4e-35
gi|50751126|ref|XP_422269.1| PREDICTED: similar to v-abl Abelson... 150 4e-35
gi|9627733|ref|NP_042289.1| P68 protein [Avian sarcoma virus] >g... 150 4e-35
gi|125677|sp|P00529|KROS_AVISU Tyrosine-protein kinase transform... 150 4e-35
gi|47225646|emb|CAG07989.1| unnamed protein product [Tetraodon n... 150 6e-35
gi|13242263|ref|NP_077344.1| src related tyrosine kinase [Rattus... 150 6e-35
gi|61488|emb|CAA24781.1| oncogene v-abl [Abelson murine leukemia... 149 1e-34
gi|9626954|ref|NP_057866.1| p120 polyprotein [Abelson murine leu... 149 1e-34
gi|5912560|emb|CAB56204.1| unnamed protein product [Abelson muri... 149 1e-34
gi|125137|sp|P00520|ABL1_MOUSE Proto-oncogene tyrosine-protein k... 149 1e-34
gi|33859504|ref|NP_033724.1| v-abl Abelson murine leukemia oncog... 149 1e-34
gi|37590684|gb|AAH59260.1| Abl1 protein [Mus musculus] 149 1e-34
gi|40796142|ref|NP_955595.1| ABL [Abelson murine leukemia virus]... 149 1e-34
gi|514268|gb|AAB60393.1| proto-oncogene tyrosine-protein kinase ... 149 1e-34
gi|31874804|emb|CAD98092.1| hypothetical protein [Homo sapiens] 149 1e-34
gi|6382062|ref|NP_009298.1| v-abl Abelson murine leukemia viral ... 149 1e-34
gi|42406387|gb|AAH65912.1| ABL2 protein [Homo sapiens] 149 1e-34
gi|6382060|ref|NP_005149.2| v-abl Abelson murine leukemia viral ... 149 1e-34
gi|2144425|pir||TVHUA protein-tyrosine kinase (EC 2.7.1.112) abl... 149 1e-34
gi|514267|gb|AAB60394.1| proto-oncogene tyrosine-protein kinase ... 149 1e-34
gi|125135|sp|P00519|ABL1_HUMAN Proto-oncogene tyrosine-protein k... 149 1e-34
gi|50757306|ref|XP_415463.1| PREDICTED: similar to Proto-oncogen... 149 2e-34
gi|3002963|gb|AAC08966.1| Etk/Bmx cytosolic tyrosine kinase [Hom... 149 2e-34
gi|39583248|emb|CAE60040.1| Hypothetical protein CBG03551 [Caeno... 148 2e-34
gi|4502435|ref|NP_001712.1| BMX non-receptor tyrosine kinase [Ho... 148 3e-34
gi|33303803|gb|AAQ02415.1| BMX non-receptor tyrosine kinase [syn... 148 3e-34
gi|6382058|ref|NP_009297.1| v-abl Abelson murine leukemia viral ... 148 3e-34
gi|39587880|emb|CAE67898.1| Hypothetical protein CBG13495 [Caeno... 148 3e-34
gi|4885045|ref|NP_005148.1| v-abl Abelson murine leukemia viral ... 148 3e-34
gi|17544596|ref|NP_502037.1| tyrosine kinase family member (4L70... 148 3e-34
gi|17541902|ref|NP_500644.1| fps oncogene analog family member (... 147 4e-34
gi|30749934|pdb|1OPK|A Chain A, Structural Basis For The Auto-In... 147 4e-34
gi|17534145|ref|NP_493812.1| SH2 motif and protein kinase family... 147 4e-34
gi|30749935|pdb|1OPL|A Chain A, Structural Basis For The Auto-In... 147 5e-34
gi|10835731|pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase ... 146 8e-34
gi|31542823|ref|NP_034367.2| fyn-related kinase; B-cell src-homo... 146 8e-34
gi|736264|emb|CAA88658.1| intestinal tyrosine kinase [Mus musculus] 146 8e-34
gi|6753196|ref|NP_033889.1| BMX non-receptor tyrosine kinase [Mu... 146 8e-34
gi|4503787|ref|NP_002022.1| fyn-related kinase; tyrosine-protein... 146 1e-33
gi|2117804|pir||I49552 protein-tyrosine kinase (EC 2.7.1.112) bs... 146 1e-33
gi|33304127|gb|AAQ02571.1| fyn-related kinase [synthetic construct] 146 1e-33
gi|125133|sp|P00522|ABL_DROME Tyrosine-protein kinase Abl (D-ash... 145 1e-33
gi|24665444|ref|NP_524843.2| CG4032-PA [Drosophila melanogaster]... 145 1e-33
gi|31240083|ref|XP_320455.1| ENSANGP00000009228 [Anopheles gambi... 145 2e-33
gi|625609|pir||A26132 gag-abl-pol polyprotein - feline sarcoma v... 145 2e-33
gi|732528|gb|AAC50116.1| Rak 144 4e-33
gi|34880098|ref|XP_346303.1| similar to protein tyrosine kinase ... 144 5e-33
gi|39598289|emb|CAE68982.1| Hypothetical protein CBG14966 [Caeno... 143 7e-33
gi|125134|sp|P10447|ABL_FSVHY Tyrosine-protein kinase transformi... 143 7e-33
gi|31230842|ref|XP_318436.1| ENSANGP00000014190 [Anopheles gambi... 143 7e-33
gi|7499927|pir||T21417 hypothetical protein F26E4.5 - Caenorhabd... 143 7e-33
gi|12655286|emb|CAC27542.1| bA702N8.1 (fyn-related kinase) [Homo... 143 7e-33
gi|39595514|emb|CAE60552.1| Hypothetical protein CBG04179 [Caeno... 143 7e-33
gi|50744566|ref|XP_419779.1| PREDICTED: similar to src related t... 143 9e-33
gi|39595711|emb|CAE67214.1| Hypothetical protein CBG12650 [Caeno... 143 9e-33
gi|39595195|emb|CAE60232.1| Hypothetical protein CBG03803 [Caeno... 142 2e-32
gi|25141286|ref|NP_491620.2| fps oncogene analog family member (... 141 3e-32
gi|7504726|pir||T29911 hypothetical protein F59A3.8 - Caenorhabd... 141 3e-32
gi|34877399|ref|XP_223365.2| similar to Txk [Rattus norvegicus] 140 4e-32
gi|34880173|ref|XP_347278.1| similar to protein tyrosine kinase ... 140 4e-32
gi|17541454|ref|NP_501761.1| tyrosine kinase family member (kin-... 140 4e-32
gi|9837322|gb|AAG00530.1| TEC kinase [Rattus norvegicus] 140 8e-32
gi|32264368|gb|AAP78682.1| MBSRC1 [Monosiga brevicollis] 140 8e-32
gi|18151363|dbj|BAA81722.3| protein tyrosine kinase [Ephydatia f... 139 1e-31
gi|31212217|ref|XP_315093.1| ENSANGP00000002451 [Anopheles gambi... 139 1e-31
gi|2967840|gb|AAC05835.1| c-Src kinase [Xenopus laevis] 139 1e-31
gi|26332200|dbj|BAC29830.1| unnamed protein product [Mus musculus] 139 2e-31
gi|33304173|gb|AAQ02594.1| TXK tyrosine kinase [synthetic constr... 139 2e-31
gi|34877298|ref|XP_341209.1| similar to protein tyrosine kinase ... 139 2e-31
gi|220614|dbj|BAA03129.1| tyrosine kinase [Mus musculus] >gnl|BL... 139 2e-31
gi|6754386|ref|NP_034713.1| IL2-inducible T-cell kinase [Mus mus... 139 2e-31
gi|4507743|ref|NP_003319.1| TXK tyrosine kinase; PTK4 protein ty... 139 2e-31
gi|157176|gb|AAA28443.1| dash peptide 139 2e-31
gi|33304179|gb|AAQ02597.1| tec protein tyrosine kinase [syntheti... 138 2e-31
gi|18146640|dbj|BAA81723.2| protein tyrosine kinase [Ephydatia f... 138 2e-31
gi|4507429|ref|NP_003206.1| tec protein tyrosine kinase [Homo sa... 138 2e-31
gi|18150840|dbj|BAA81720.2| protein tyrosine kinase [Ephydatia f... 138 3e-31
gi|1161364|gb|AAB60412.1| tyrosine kinase 138 3e-31
gi|20152059|gb|AAM11389.1| LP03070p [Drosophila melanogaster] 137 4e-31
gi|21358251|ref|NP_652600.1| CG8250-PA [Drosophila melanogaster]... 137 4e-31
gi|34555808|emb|CAA92623.2| Hypothetical protein W01B6.5 [Caenor... 137 5e-31
gi|39581072|emb|CAE57374.1| Hypothetical protein CBG00320 [Caeno... 137 5e-31
gi|17541406|ref|NP_502591.1| protein kinase with SH2 domain, exp... 137 5e-31
gi|34871240|ref|XP_343881.1| similar to tyrosine kinase [Rattus ... 137 6e-31
gi|33859614|ref|NP_035412.1| Ros1 proto-oncogene [Mus musculus] ... 137 6e-31
gi|17505885|ref|NP_492827.1| tyrosine kinase family member (1L38... 136 8e-31
gi|3387870|gb|AAC28629.1| protein-tyrosine kinase HTK98 [Hydra v... 136 8e-31
gi|6981480|ref|NP_037006.1| v-ros UR2 sarcoma virus oncogene hom... 136 8e-31
gi|203596|gb|AAA40966.1| c-ros-1 tyrosine kinase (put.); putative 136 8e-31
gi|22654236|sp|P34152|FAK1_MOUSE Focal adhesion kinase 1 (FADK 1... 136 1e-30
gi|2117869|pir||I48310 kinase-related protein ros - mouse >gnl|B... 136 1e-30
gi|17508235|ref|NP_493502.1| src family, fyn and suppressor of p... 136 1e-30
gi|27529716|dbj|BAC53890.1| focal adhesion kinase spliced varian... 136 1e-30
gi|7305601|ref|NP_038726.1| TXK tyrosine kinase [Mus musculus] >... 136 1e-30
gi|17542550|ref|NP_501993.1| tyrosine kinase family member (4L51... 136 1e-30
gi|7229261|gb|AAF42734.1| TRK-fused gene-anaplastic lymphoma kin... 135 1e-30
gi|6739535|gb|AAF27292.1| TRK-fused gene/anaplastic lymphoma kin... 135 1e-30
gi|20137251|sp|Q9UM73|ALK_HUMAN ALK tyrosine kinase receptor pre... 135 1e-30
gi|609342|gb|AAA58698.1| nucleophosmin-anaplastic lymphoma kinas... 135 1e-30
gi|29029632|ref|NP_004295.2| anaplastic lymphoma kinase Ki-1; AL... 135 1e-30
gi|1483131|dbj|BAA08343.1| p80 protein [Homo sapiens] 135 1e-30
gi|1848244|gb|AAC51104.1| anaplastic lymphoma kinase receptor 135 1e-30
gi|20269390|gb|AAM17922.1| TRK-fused gene/anaplastic large cell ... 135 1e-30
gi|16197923|gb|AAL13726.1| LD03455p [Drosophila melanogaster] 135 1e-30
gi|1174826|sp|P42682|TXK_MOUSE Tyrosine-protein kinase TXK (PTK-... 135 1e-30
gi|8134450|sp|Q91736|EPBB_XENLA Ephrin type-B receptor 1B (Tyros... 135 2e-30
gi|34862507|ref|XP_233867.2| similar to tyrosine kinase [Rattus ... 135 2e-30
gi|50739026|ref|XP_419364.1| PREDICTED: similar to anaplastic ly... 135 2e-30
gi|39580736|emb|CAE64122.1| Hypothetical protein CBG08738 [Caeno... 135 2e-30
gi|50960|emb|CAA36175.1| precursor polypeptide (AA -21 to 799) [... 135 2e-30
gi|6680680|ref|NP_031465.1| anaplastic lymphoma kinase [Mus musc... 135 2e-30
gi|1174631|sp|P24604|TEC_MOUSE Tyrosine-protein kinase Tec >gnl|... 135 2e-30
gi|337483|gb|AAA36580.1| transmembrane protein kinase 3) 135 2e-30
gi|49617834|gb|AAT67600.1| Src tyrosine kinase 2 [Suberites domu... 135 2e-30
gi|31377435|gb|AAN38839.1| focal adhesion kinase [Lytechinus var... 135 2e-30
gi|6755706|ref|NP_035648.1| spleen tyrosine kinase [Mus musculus... 135 2e-30
gi|625223|pir||TVHURS kinase-related protein ros-1 precursor - h... 135 2e-30
gi|19924165|ref|NP_002935.2| proto-oncogene c-ros-1 protein prec... 135 2e-30
gi|496092|gb|AAA60277.1| ROS1 135 2e-30
gi|50748173|ref|XP_421140.1| PREDICTED: similar to SI:dZ107O16.1... 135 2e-30
gi|5453029|gb|AAD43402.1| protein tyrosine kinase TecIV [Mus mus... 135 2e-30
gi|38079278|ref|XP_355556.1| similar to Txk [Mus musculus] 135 2e-30
gi|38566061|gb|AAH62884.1| Tec protein [Mus musculus] 135 2e-30
gi|50417446|gb|AAH77278.1| Unknown (protein for MGC:80052) [Xeno... 135 2e-30
gi|13186234|ref|NP_075593.1| fibroblast growth factor receptor 1... 134 3e-30
gi|2117858|pir||I49293 fibroblast growth factor receptor-1, shor... 134 3e-30
gi|5453033|gb|AAD43406.1| protein tyrosine kinase TecIII [Mus mu... 134 3e-30
gi|20141440|sp|Q91738|FAK1_XENLA Focal adhesion kinase 1 (FADK 1... 134 3e-30
gi|182534|gb|AAA35837.1| fibroblast growth factor receptor (FGFr... 134 3e-30
gi|2117855|pir||I49289 fibroblast growth factor receptor-1, long... 134 3e-30
gi|31368|emb|CAA36101.1| unnamed protein product [Homo sapiens] 134 3e-30
gi|13186236|ref|NP_075594.1| fibroblast growth factor receptor 1... 134 3e-30
gi|11276087|ref|NP_000595.1| fibroblast growth factor receptor 1... 134 3e-30
gi|179415|gb|AAA75007.1| basic fibroblast growth factor receptor... 134 3e-30
gi|183879|gb|AAA35958.1| heparin-binding growth factor receptor 134 3e-30
gi|13186251|ref|NP_056934.2| fibroblast growth factor receptor 1... 134 3e-30
gi|22450878|gb|AAH18128.1| Fibroblast growth factor receptor 1, ... 134 3e-30
gi|182530|gb|AAA35835.1| FGF receptor-1 precursor [Homo sapiens] 134 3e-30
gi|7305569|ref|NP_038717.1| cytoplasmic tyrosine kinase, Dscr28C... 134 3e-30
gi|558584|emb|CAA68679.1| tyrosine kinase [Homo sapiens] 134 3e-30
gi|2392334|pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine... 134 3e-30
gi|1174439|sp|P42690|SRK4_SPOLA Tyrosine-protein kinase isoform ... 134 4e-30
gi|90489|pir||JH0393 fibroblast growth factor receptor precursor... 134 4e-30
gi|26390450|dbj|BAC25899.1| unnamed protein product [Mus musculus] 134 4e-30
gi|56095|emb|CAA31777.1| elk protein [Rattus rattus] 134 4e-30
gi|15718680|ref|NP_005537.3| IL2-inducible T-cell kinase; homolo... 134 4e-30
gi|7705029|gb|AAB28072.2| EMT [Homo sapiens] 134 4e-30
gi|26331180|dbj|BAC29320.1| unnamed protein product [Mus musculus] 134 4e-30
gi|27721289|ref|XP_217250.1| similar to Ephrin type-B receptor 1... 134 4e-30
gi|120047|sp|P16092|FGR1_MOUSE Basic fibroblast growth factor re... 134 4e-30
gi|6753856|ref|NP_034336.1| fibroblast growth factor receptor 1 ... 134 4e-30
gi|23959045|gb|AAH33447.1| Fgfr1 protein [Mus musculus] 134 4e-30
gi|22800394|gb|AAH10200.1| Fibroblast growth factor receptor 1 [... 134 4e-30
gi|2506798|sp|P08922|KROS_HUMAN Proto-oncogene tyrosine-protein ... 134 4e-30
gi|40675709|gb|AAH65121.1| Spleen tyrosine kinase [Mus musculus] 134 4e-30
gi|1711636|sp|P48025|KSYK_MOUSE Tyrosine-protein kinase SYK (Spl... 134 4e-30
gi|33304019|gb|AAQ02517.1| IL2-inducible T-cell kinase [syntheti... 134 4e-30
gi|48101228|ref|XP_392652.1| similar to CG4032-PA [Apis mellifera] 134 5e-30
gi|2134387|pir||I50612 protein-tyrosine kinase (EC 2.7.1.112) Ce... 134 5e-30
gi|8134448|sp|Q07494|EPB1_CHICK Ephrin type-B receptor 1 (Tyrosi... 134 5e-30
gi|4758284|ref|NP_004432.1| ephrin receptor EphB1 precursor; eph... 134 5e-30
gi|47211144|emb|CAF96564.1| unnamed protein product [Tetraodon n... 134 5e-30
gi|31201161|ref|XP_309528.1| ENSANGP00000008377 [Anopheles gambi... 134 5e-30
gi|4104413|gb|AAD02031.1| Eph-like receptor tyrosine kinase hEph... 133 7e-30
gi|39589478|emb|CAE74507.1| Hypothetical protein CBG22259 [Caeno... 133 7e-30
gi|49617828|gb|AAT67597.1| Src tyrosine kinase 2 [Suberites domu... 133 7e-30
gi|25150323|ref|NP_490866.2| SRC oncogene related (60.7 kD) (src... 133 7e-30
gi|41352675|gb|AAS01046.1| Src family kinase [Asterina miniata] 133 7e-30
gi|24636132|gb|AAK29735.3| Src oncogene related protein 1 [Caeno... 133 7e-30
gi|48139712|ref|XP_397038.1| similar to receptor tyrosine kinase... 133 9e-30
gi|309240|gb|AAA37622.1| FGF receptor precursor 133 9e-30
gi|48106047|ref|XP_396043.1| similar to ENSANGP00000005994 [Apis... 133 9e-30
gi|496900|emb|CAA82737.1| protein-tyrosine kinase [Homo sapiens]... 133 9e-30
gi|48139059|ref|XP_396962.1| similar to ENSANGP00000008377 [Apis... 133 9e-30
gi|21361553|ref|NP_003168.2| spleen tyrosine kinase [Homo sapien... 133 9e-30
gi|266436|sp|Q00655|KSYK_PIG Tyrosine-protein kinase SYK (Spleen... 133 9e-30
gi|21955340|gb|AAH15035.1| FGFR1 protein [Homo sapiens] 133 9e-30
gi|515871|emb|CAA51970.1| protein tyrosin kinase [Homo sapiens] 133 9e-30
gi|448916|prf||1918215A protein Tyr kinase 133 9e-30
gi|17544060|ref|NP_502040.1| protein kinase and SH2 motif family... 133 9e-30
gi|26329847|dbj|BAC28662.1| unnamed protein product [Mus musculus] 133 9e-30
gi|1363289|pir||A56795 fibroblast growth factor receptor 1 beta-... 133 9e-30
gi|445300|prf||1909124A fibroblast growth factor receptor:ISOTYP... 133 9e-30
gi|47225664|emb|CAG08007.1| unnamed protein product [Tetraodon n... 132 2e-29
gi|422678|pir||S33506 protein-tyrosine kinase (EC 2.7.1.112) Cek... 132 2e-29
gi|45382885|ref|NP_990841.1| cek1 protein [Gallus gallus] >gnl|B... 132 2e-29
gi|476554|pir||TVCHFG fibroblast growth factor receptor 1 precur... 132 2e-29
gi|4104411|gb|AAD02030.1| Eph-like receptor tyrosine kinase hEph... 132 2e-29
gi|18146650|dbj|BAB82422.1| protein tyrosine kinase [Ephydatia f... 132 2e-29
gi|104045|pir||A39752 fibroblast growth factor receptor A1 precu... 132 2e-29
gi|39591698|emb|CAE71276.1| Hypothetical protein CBG18159 [Caeno... 132 2e-29
gi|48121983|ref|XP_396503.1| similar to ENSANGP00000008846 [Apis... 132 2e-29
gi|18858911|ref|NP_571179.1| IL2-inducible T-cell kinase; tec-fa... 132 2e-29
gi|35505522|gb|AAH57401.1| Epha5 protein [Mus musculus] 132 2e-29
gi|31216963|ref|XP_316335.1| ENSANGP00000005994 [Anopheles gambi... 132 2e-29
gi|11177904|ref|NP_068631.1| non-receptor protein kinase protein... 132 2e-29
gi|1708331|sp|P53356|HT16_HYDAT Tyrosine-protein kinase HTK16 >g... 132 2e-29
gi|23308617|ref|NP_694494.1| fibroblast growth factor receptor 1... 131 3e-29
gi|26331236|dbj|BAC29348.1| unnamed protein product [Mus musculus] 131 3e-29
gi|47221383|emb|CAF97301.1| unnamed protein product [Tetraodon n... 131 3e-29
gi|47227996|emb|CAF97625.1| unnamed protein product [Tetraodon n... 131 3e-29
gi|13924736|gb|AAK49117.1| spleen protein tyrosine kinase [Cypri... 131 3e-29
gi|47213587|emb|CAF93490.1| unnamed protein product [Tetraodon n... 131 3e-29
gi|21450846|ref|NP_647612.1| megakaryocyte-associated tyrosine k... 131 3e-29
gi|1363318|pir||A56707 protein-tyrosine kinase (EC 2.7.1.112) sy... 131 3e-29
gi|15230168|ref|NP_189116.1| protein kinase family protein [Arab... 131 3e-29
gi|416153|gb|AAA42308.1| tyrosine kinase receptor 131 3e-29
gi|6808457|emb|CAB70906.1| hypothetical protein [Homo sapiens] 131 3e-29
gi|21450842|ref|NP_002369.2| megakaryocyte-associated tyrosine k... 131 3e-29
gi|21450844|ref|NP_647611.1| megakaryocyte-associated tyrosine k... 131 3e-29
gi|33303945|gb|AAQ02480.1| megakaryocyte-associated tyrosine kin... 131 3e-29
gi|26348235|dbj|BAC37757.1| unnamed protein product [Mus musculus] 131 4e-29
gi|7446401|pir||JC5494 protein-tyrosine kinase (EC 2.7.1.112) - rat 131 4e-29
gi|6679741|ref|NP_032008.1| PTK2 protein tyrosine kinase 2; foca... 131 4e-29
gi|24476013|ref|NP_722560.1| PTK2 protein tyrosine kinase 2 isof... 131 4e-29
gi|47087153|ref|NP_990436.1| receptor-type protein-tyrosine kina... 131 4e-29
gi|2134388|pir||I50613 protein-tyrosine kinase (EC 2.7.1.112) Ce... 131 4e-29
gi|20988799|gb|AAH30180.1| Ptk2 protein [Mus musculus] 131 4e-29
gi|21754176|dbj|BAC04470.1| unnamed protein product [Homo sapiens] 131 4e-29
gi|23273417|gb|AAH35404.1| PTK2 protein [Homo sapiens] 131 4e-29
gi|22382094|gb|AAH28733.1| PTK2 protein [Homo sapiens] 131 4e-29
gi|50761846|ref|XP_424854.1| PREDICTED: similar to Tyrosine-prot... 131 4e-29
gi|555619|gb|AAB60613.1| receptor-type protein-tyrosine kinase 131 4e-29
gi|555620|gb|AAB60614.1| receptor-type protein-tyrosine kinase 131 4e-29
gi|7505944|pir||T29581 hypothetical protein M03A1.1 - Caenorhabd... 131 4e-29
gi|6981440|ref|NP_037213.1| protein tyrosine kinase 2; Protein t... 131 4e-29
gi|2117853|pir||I51023 fibroblast growth factor receptor 1 - eas... 131 4e-29
gi|17535165|ref|NP_494807.1| ephrin receptor type-A, Variable AB... 131 4e-29
gi|432966|emb|CAA42023.1| fibroblast growth factor receptor [Ple... 131 4e-29
gi|477514|pir||A49151 fibroblast growth factor receptor 1 - Iber... 131 4e-29
gi|50729483|ref|XP_416531.1| PREDICTED: similar to Chicken embry... 131 4e-29
gi|27886593|ref|NP_005598.3| PTK2 protein tyrosine kinase 2 isof... 131 4e-29
gi|2833209|sp|Q07497|EPB5_CHICK Ephrin type-B receptor 5 precurs... 131 4e-29
gi|17136690|ref|NP_476849.1| CG7873-PA [Drosophila melanogaster]... 130 5e-29
gi|1536790|dbj|BAA07705.1| Dsrc41 [Drosophila melanogaster] 130 5e-29
gi|1362692|pir||JC4200 protein-tyrosine kinase (EC 2.7.1.112) - ... 130 5e-29
gi|6175864|gb|AAF05312.1| fibroblast growth factor receptor 1-II... 130 5e-29
gi|22204233|emb|CAD43463.1| SI:dZ107O16.1 (novel protein similar... 130 5e-29
gi|17542722|ref|NP_501826.1| protein kinase and SH2 motif family... 130 5e-29
gi|47551197|ref|NP_999783.1| src-family protein tyrosine kinase ... 130 5e-29
gi|40254274|ref|NP_775623.2| Eph receptor B1; ELK homolog [Mus m... 130 5e-29
gi|103966|pir||S19947 fibroblast growth factor receptor - Iberia... 130 5e-29
gi|477891|pir||B49151 fibroblast growth factor receptor 4 - Iber... 130 5e-29
gi|37926803|pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhes... 130 5e-29
gi|15021868|dbj|BAB62210.1| hypothetical protein [Macaca fascicu... 130 5e-29
gi|34876735|ref|XP_341202.1| eck-like sequence 1 [Rattus norvegi... 130 6e-29
gi|45382883|ref|NP_990840.1| tyrosine kinase (cek2) [Gallus gall... 130 6e-29
gi|41352671|gb|AAS01044.1| C-terminal Src kinase [Asterina miniata] 130 6e-29
gi|1345852|sp|P41242|MATK_MOUSE Megakaryocyte-associated tyrosin... 130 6e-29
gi|6754646|ref|NP_034898.1| megakaryocyte-associated tyrosine ki... 130 6e-29
gi|975277|gb|AAA75166.1| p72 130 6e-29
gi|120048|sp|P22182|FGR1_XENLA Fibroblast growth factor receptor... 130 6e-29
gi|631880|pir||S47489 receptor tyrosine kinase - rat >gnl|BL_ORD... 130 6e-29
gi|12851035|dbj|BAB28926.1| unnamed protein product [Mus musculus] 130 6e-29
gi|1524143|emb|CAA58806.1| HYL tyrosine kinase [Mus musculus] 130 6e-29
gi|2117810|pir||I48926 protein-tyrosine kinase (EC 2.7.1.112) Ct... 130 6e-29
gi|639859|dbj|BAA08199.1| ctk [Mus musculus] 130 6e-29
gi|957296|gb|AAB33566.1| nonreceptor protein-tyrosine kinase [Mu... 130 6e-29
gi|47220802|emb|CAG00009.1| unnamed protein product [Tetraodon n... 130 6e-29
gi|6981620|ref|NP_036890.1| spleen tyrosine kinase [Rattus norve... 130 6e-29
gi|1168177|gb|AAB35359.1| fibroblast growth factor receptor type... 130 6e-29
gi|18858679|ref|NP_571505.1| fibroblast growth factor receptor 4... 130 6e-29
gi|5052337|gb|AAD38508.1| Eph receptor tyrosine kinase [Drosophi... 130 6e-29
gi|8134449|sp|Q91571|EPBA_XENLA Ephrin type-B receptor 1A precur... 130 6e-29
gi|47507478|gb|AAH71046.1| MGC83487 protein [Xenopus laevis] 130 8e-29
gi|47086887|ref|NP_997735.1| protein tyrosine kinase 2 beta; pro... 130 8e-29
gi|28630925|gb|AAO45658.1| fibroblast growth factor receptor 1 i... 129 1e-28
gi|28630929|gb|AAO45660.1| fibroblast growth factor receptor 1 i... 129 1e-28
gi|45382167|ref|NP_990766.1| focal adhesion kinase [Gallus gallu... 129 1e-28
gi|28630927|gb|AAO45659.1| fibroblast growth factor receptor 1 i... 129 1e-28
gi|11037736|gb|AAG27717.1| FGF receptor [Halocynthia roretzi] 129 1e-28
gi|47086347|ref|NP_998008.1| spleen tyrosine kinase; spleen prot... 129 1e-28
gi|14278929|dbj|BAB59007.1| FGFR [Halocynthia roretzi] 129 1e-28
gi|45383436|ref|NP_989691.1| protein tyrosine kinase EphA9 [Gall... 129 1e-28
gi|345664|pir||A45388 protein-tyrosine kinase (EC 2.7.1.112) - c... 129 1e-28
gi|1706629|sp|P54757|EPA5_RAT Ephrin type-A receptor 5 precursor... 129 1e-28
gi|1083782|pir||S51604 receptor-like tyrosine kinase Ehk-1 - rat 129 1e-28
gi|34872522|ref|XP_345597.1| similar to Eph receptor A2 [Rattus ... 129 1e-28
gi|45383964|ref|NP_990588.1| c-ros mRNA [Gallus gallus] >gnl|BL_... 129 1e-28
gi|4809260|gb|AAD30170.1| Eph tyrosine kinase [Drosophila melano... 129 1e-28
gi|1083781|pir||S51603 receptor-like tyrosine kinase Ehk-1 - rat 129 1e-28
gi|26326477|dbj|BAC26982.1| unnamed protein product [Mus musculus] 129 2e-28
gi|39580840|emb|CAE73101.1| Hypothetical protein CBG20481 [Caeno... 129 2e-28
gi|18146654|dbj|BAB82424.1| protein tyrosine kinase [Ephydatia f... 129 2e-28
gi|20070702|gb|AAH26153.1| Epha7 protein [Mus musculus] 129 2e-28
gi|49115521|gb|AAH73428.1| Unknown (protein for MGC:80912) [Xeno... 129 2e-28
gi|7503796|pir||T22405 protein-tyrosine kinase (EC 2.7.1.112) F4... 129 2e-28
gi|40642785|emb|CAD58836.1| ephrin receptor gamma [Ciona intesti... 129 2e-28
gi|556789|emb|CAA57224.1| Embryo Brain Kinase [Mus musculus] 129 2e-28
gi|31216714|ref|XP_316289.1| ENSANGP00000020604 [Anopheles gambi... 128 2e-28
gi|599959|emb|CAA53271.1| fibroblast growth factor receptor 3 [P... 128 2e-28
gi|481393|pir||S38579 fibroblast growth factor receptor 3 - Iber... 128 2e-28
gi|38488741|ref|NP_942114.1| protein tyrosine kinase 2.2; protei... 128 2e-28
gi|251793|gb|AAB22579.1| srk1 protein kinase=src-related tyrosin... 128 2e-28
gi|40642783|emb|CAD58835.1| ephrin receptor delta [Ciona intesti... 128 2e-28
gi|17541452|ref|NP_501758.1| protein kinase and SH2 motif family... 128 2e-28
gi|47208879|emb|CAF98181.1| unnamed protein product [Tetraodon n... 128 2e-28
gi|48138377|ref|XP_393399.1| similar to CG17309-PB [Apis mellifera] 128 2e-28
gi|39595860|emb|CAE67363.1| Hypothetical protein CBG12830 [Caeno... 128 2e-28
gi|34555831|emb|CAA94238.2| Hypothetical protein W08D2.8 [Caenor... 128 2e-28
gi|125479|sp|P08923|KLTK_MOUSE Leukocyte tyrosine kinase recepto... 128 3e-28
gi|45935373|ref|NP_976220.1| leukocyte tyrosine kinase isoform D... 128 3e-28
gi|3426184|dbj|BAA32407.1| SEVENLESS [Anopheles sp.] 128 3e-28
gi|110874|pir||S12792 protein-tyrosine kinase (EC 2.7.1.112) ltk... 128 3e-28
gi|45935375|ref|NP_032549.2| leukocyte tyrosine kinase isoform A... 128 3e-28
gi|1617135|emb|CAA30793.1| protein-tyrosine kinase [Mus musculus] 128 3e-28
gi|38303921|gb|AAH61936.1| MGC68754 protein [Xenopus laevis] 128 3e-28
gi|25147104|ref|NP_509778.2| related to oncogene ABL (138.3 kD) ... 128 3e-28
gi|32967317|ref|NP_004430.2| ephrin receptor EphA5 isoform a; ep... 128 3e-28
gi|1706628|sp|P54756|EPA5_HUMAN Ephrin type-A receptor 5 precurs... 128 3e-28
gi|7506130|pir||T23832 protein-tyrosine kinase (EC 2.7.1.112) ab... 128 3e-28
gi|37926807|pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (... 128 3e-28
gi|47218091|emb|CAG09963.1| unnamed protein product [Tetraodon n... 128 3e-28
gi|25147111|ref|NP_509779.2| related to oncogene ABL (abl-1) [Ca... 128 3e-28
gi|13162333|ref|NP_077060.1| FGF receptor-1 [Rattus norvegicus] ... 128 3e-28
gi|7434436|pir||I78843 receptor protein-tyrosine kinase - human ... 128 3e-28
gi|45935377|ref|NP_996824.1| leukocyte tyrosine kinase isoform B... 128 3e-28
gi|45935379|ref|NP_996825.1| leukocyte tyrosine kinase isoform C... 128 3e-28
gi|32484983|ref|NP_034269.2| Eph receptor A2 [Mus musculus] 128 3e-28
gi|32967319|ref|NP_872272.1| ephrin receptor EphA5 isoform b; ep... 128 3e-28
gi|552072|gb|AAA28129.1| abl-like putative oncogene; putative [C... 128 3e-28
gi|226051|prf||1408259A transmembrane protein kinase 128 3e-28
gi|125333|sp|P29317|EPA2_HUMAN Ephrin type-A receptor 2 precurso... 128 3e-28
gi|32967311|ref|NP_004422.2| ephrin receptor EphA2; epithelial c... 128 3e-28
gi|25147108|ref|NP_509777.2| related to oncogene ABL (abl-1) [Ca... 128 3e-28
gi|2137700|pir||I48759 protein-tyrosine kinase (EC 2.7.1.112) se... 128 3e-28
gi|25146840|ref|NP_741859.1| fibroblast growth factor receptor f... 127 4e-28
gi|15227883|ref|NP_179361.1| protein kinase family protein [Arab... 127 4e-28
gi|45384174|ref|NP_990414.1| Eph-like receptor tyrosine kinase [... 127 4e-28
gi|2497569|sp|Q61851|FGR3_MOUSE Fibroblast growth factor recepto... 127 4e-28
gi|6679659|ref|NP_031963.1| Eph receptor A5; eck-like sequence 1... 127 4e-28
gi|25146843|ref|NP_741858.1| fibroblast growth factor receptor f... 127 4e-28
gi|47222126|emb|CAG11552.1| unnamed protein product [Tetraodon n... 127 4e-28
gi|2117857|pir||I50128 fibroblast growth factor receptor - quail... 127 4e-28
gi|30851439|gb|AAH52421.1| Tnk2 protein [Mus musculus] 127 5e-28
gi|214900|gb|AAA49993.1| fibroblast growth factor receptor 127 5e-28
gi|223452|prf||0806225A genome Y73 127 5e-28
gi|47227410|emb|CAF96959.1| unnamed protein product [Tetraodon n... 127 5e-28
gi|26352866|dbj|BAC40063.1| unnamed protein product [Mus musculus] 127 5e-28
gi|23308649|ref|NP_694500.1| insulin-like growth factor 1a recep... 127 5e-28
gi|7948995|ref|NP_058068.1| tyrosine kinase, non-receptor, 2; Cd... 127 5e-28
gi|66797|pir||TVFVG9 protein-tyrosine kinase (EC 2.7.1.112) yes ... 127 5e-28
gi|45385807|ref|NP_990632.1| proto-oncogene tyrosine-protein kin... 127 5e-28
gi|63363|emb|CAA31595.1| unnamed protein product [Gallus gallus] 127 5e-28
gi|34328170|ref|NP_034271.2| Eph receptor A7 [Mus musculus] >gnl... 127 5e-28
gi|4758282|ref|NP_004431.1| ephrin receptor EphA7; ephrin type-A... 127 5e-28
gi|19705437|ref|NP_599158.1| EphA7 [Rattus norvegicus] >gnl|BL_O... 127 5e-28
gi|15706312|dbj|BAB68344.1| EPH receptor tyrosine kinase [Ciona ... 127 5e-28
gi|482917|emb|CAA81796.1| receptor tyrosine kinase eph [Homo sap... 127 7e-28
gi|551274|emb|CAA84511.1| fibroblast growth factor receptor 2b, ... 127 7e-28
gi|32967309|ref|NP_005223.2| ephrin receptor EphA1; oncogene EPH... 127 7e-28
gi|47117832|sp|P21709|EPA1_HUMAN Ephrin type-A receptor 1 precur... 127 7e-28
gi|41472551|gb|AAS07458.1| unknown [Homo sapiens] 127 7e-28
gi|50747015|ref|XP_420720.1| PREDICTED: similar to Tyrosine-prot... 127 7e-28
gi|87779|pir||A34076 protein-tyrosine kinase (EC 2.7.1.112) rece... 127 7e-28
gi|40642787|emb|CAD58837.1| ephrin receptor epsilon [Ciona intes... 127 7e-28
gi|2425188|dbj|BAA22281.1| FGF receptor 3 [Xenopus laevis] 127 7e-28
gi|6679789|ref|NP_032037.1| fibroblast growth factor receptor 4 ... 127 7e-28
gi|26351311|dbj|BAC39292.1| unnamed protein product [Mus musculus] 127 7e-28
gi|1706570|sp|Q03145|EPA2_MOUSE Ephrin type-A receptor 2 precurs... 127 7e-28
gi|1083665|pir||S51635 fibroblast growth factor receptor 2b, ker... 127 7e-28
gi|31204393|ref|XP_311145.1| ENSANGP00000004762 [Anopheles gambi... 127 7e-28
gi|3560565|gb|AAC35011.1| non-receptor protein-tyrosine kinase C... 127 7e-28
gi|47077584|dbj|BAD18675.1| unnamed protein product [Homo sapiens] 126 9e-28
gi|37776869|emb|CAE51198.1| src tyrosine kinase [Schistosoma man... 126 9e-28
gi|31203311|ref|XP_310604.1| ENSANGP00000007421 [Anopheles gambi... 126 9e-28
gi|8922075|ref|NP_005772.2| activated p21cdc42Hs kinase [Homo sa... 126 9e-28
gi|47220112|emb|CAF99025.1| unnamed protein product [Tetraodon n... 126 9e-28
gi|284747|pir||S18209 fibroblast growth factor receptor 4 precur... 126 9e-28
gi|23273873|gb|AAH33313.1| Fgfr4 protein [Mus musculus] 126 9e-28
gi|20380414|gb|AAH28164.1| ACK1 protein [Homo sapiens] 126 9e-28
gi|423137|pir||S33596 protein-tyrosine kinase (EC 2.7.1.112) - h... 126 9e-28
gi|280850|pir||A43625 protein-tyrosine kinase (EC 2.7.1.112) ltk... 126 9e-28
gi|18420244|ref|NP_568041.1| protein kinase family protein [Arab... 126 9e-28
gi|3025159|sp|Q28923|YES_CANFA Proto-oncogene tyrosine-protein k... 126 9e-28
gi|2137701|pir||I48760 protein-tyrosine kinase (EC 2.7.1.112) se... 126 1e-27
gi|34872119|ref|XP_233574.2| similar to Ephrin type-B receptor 2... 126 1e-27
gi|106231|pir||A35969 heparin-binding growth factor receptor K-s... 126 1e-27
gi|1174436|sp|P42686|SRK1_SPOLA Tyrosine-protein kinase isoform ... 126 1e-27
gi|39582132|emb|CAE60809.1| Hypothetical protein CBG04507 [Caeno... 126 1e-27
gi|34855604|ref|XP_231658.2| similar to Ephrin type-A receptor 1... 126 1e-27
gi|27806931|ref|NP_776310.1| activated p21cdc42Hs kinase [Bos ta... 126 1e-27
gi|24308430|ref|NP_571170.1| eph-like kinase 1; eph-like recepto... 126 1e-27
gi|495678|dbj|BAA06506.1| tyrosine kinase precursor [Homo sapiens] 126 1e-27
gi|1177045|sp|P43404|ZA70_MOUSE Tyrosine-protein kinase ZAP-70 (... 126 1e-27
gi|7434435|pir||I78842 receptor protein-tyrosine kinase - human ... 126 1e-27
gi|38605719|sp|P54763|EPB2_MOUSE Ephrin type-B receptor 2 precur... 126 1e-27
gi|38614379|gb|AAH62924.1| Ephb2 protein [Mus musculus] 126 1e-27
gi|15988071|pdb|1JPA|A Chain A, Crystal Structure Of Unphosphory... 126 1e-27
gi|17975765|ref|NP_059145.1| ephrin receptor EphB2 isoform 1 pre... 126 1e-27
gi|12644190|sp|P29323|EPB2_HUMAN Ephrin type-B receptor 2 precur... 126 1e-27
gi|49114324|gb|AAH43088.1| Ephb2 protein [Mus musculus] 126 1e-27
gi|1100110|gb|AAA99310.1| protein-tyrosine kinase >gnl|BL_ORD_ID... 126 1e-27
gi|21396504|ref|NP_004433.2| ephrin receptor EphB2 isoform 2 pre... 126 1e-27
gi|12314010|emb|CAC10350.1| dJ74M1.1.1 (tyrosine kinase isoform ... 126 1e-27
gi|38078900|ref|XP_204072.3| Eph receptor B2 [Mus musculus] >gnl... 126 1e-27
gi|2136054|pir||A57174 protein-tyrosine kinase (EC 2.7.1.112) er... 126 1e-27
gi|12314011|emb|CAC10351.1| dJ74M1.1.2 (tyrosine kinase isosform... 126 1e-27
gi|414594|gb|AAA72411.1| Nuk receptor tyrosine kinase [Mus muscu... 126 1e-27
gi|4557377|ref|NP_000052.1| Bruton agammaglobulinemia tyrosine k... 125 1e-27
gi|50730275|ref|XP_425573.1| PREDICTED: similar to Brutons tyros... 125 1e-27
gi|48060037|gb|AAF60752.2| Hypothetical protein Y52D5A.2 [Caenor... 125 1e-27
gi|33304137|gb|AAQ02576.1| Bruton agammaglobulinemia tyrosine ki... 125 1e-27
gi|34873797|ref|XP_344571.1| similar to Fibroblast growth factor... 125 1e-27
gi|5453032|gb|AAD43405.1| protein tyrosine kinase TecIIB [Mus mu... 125 1e-27
gi|3037089|gb|AAC12942.1| insulin-like growth factor-1 receptor ... 125 1e-27
gi|346984|pir||JC1450 fibroblast growth factor receptor 4 - rat ... 125 1e-27
gi|34869253|ref|XP_221379.2| similar to non-receptor protein tyr... 125 1e-27
gi|46249416|ref|NP_996844.1| leukocyte tyrosine kinase isoform 2... 125 1e-27
gi|34420|emb|CAA43113.1| tyrosine kinase [Homo sapiens] 125 1e-27
gi|17543562|ref|NP_500813.1| predicted CDS, tyrosine kinase fami... 125 1e-27
>gi|17511023|ref|NP_491913.1| tyrosine protein kinase similar to
proto-oncogene FES/FPS, member of a C.elegans multigene
family (45.4 kD) (1H238) [Caenorhabditis elegans]
gi|14574525|gb|AAB54145.2| Hypothetical protein ZC581.7
[Caenorhabditis elegans]
Length = 395
Score = 808 bits (2087), Expect = 0.0
Identities = 395/395 (100%), Positives = 395/395 (100%)
Frame = -1
Query: 1188 MANKEKILEEDINLPYYHGALMNQDADQLLVNDGDYMIVVKMNQELNKMQLYLAVRLKKG 1009
MANKEKILEEDINLPYYHGALMNQDADQLLVNDGDYMIVVKMNQELNKMQLYLAVRLKKG
Sbjct: 1 MANKEKILEEDINLPYYHGALMNQDADQLLVNDGDYMIVVKMNQELNKMQLYLAVRLKKG 60
Query: 1008 IRRFEIKRNPTSAKIGGKSAPNIGKLVDSMQKETMEIKGERVILKRAIPKGKFQLMHKDV 829
IRRFEIKRNPTSAKIGGKSAPNIGKLVDSMQKETMEIKGERVILKRAIPKGKFQLMHKDV
Sbjct: 61 IRRFEIKRNPTSAKIGGKSAPNIGKLVDSMQKETMEIKGERVILKRAIPKGKFQLMHKDV 120
Query: 828 DFKKKLGSGAYGTVYLGRLTKNNTKIAVKKLDTEGNDEESLAEMMKEARVMQLYDHPNIV 649
DFKKKLGSGAYGTVYLGRLTKNNTKIAVKKLDTEGNDEESLAEMMKEARVMQLYDHPNIV
Sbjct: 121 DFKKKLGSGAYGTVYLGRLTKNNTKIAVKKLDTEGNDEESLAEMMKEARVMQLYDHPNIV 180
Query: 648 KFYGYIVDDIPYLLVLELCNGGSVEDKLVEKGAKLSTKTRIMYTYHAACGIEYLHKKKCI 469
KFYGYIVDDIPYLLVLELCNGGSVEDKLVEKGAKLSTKTRIMYTYHAACGIEYLHKKKCI
Sbjct: 181 KFYGYIVDDIPYLLVLELCNGGSVEDKLVEKGAKLSTKTRIMYTYHAACGIEYLHKKKCI 240
Query: 468 HRDIAARNCLIHKEIVKIADFGMCRATSIYKVDLNKPTNTRWLAPEVWDNGETRDNTDIF 289
HRDIAARNCLIHKEIVKIADFGMCRATSIYKVDLNKPTNTRWLAPEVWDNGETRDNTDIF
Sbjct: 241 HRDIAARNCLIHKEIVKIADFGMCRATSIYKVDLNKPTNTRWLAPEVWDNGETRDNTDIF 300
Query: 288 AFAITMWEFFEVPYDSPYSEWKGYMVKQKTRAGYRLPTPKGMPWDIEEIMKLCWHVDPNQ 109
AFAITMWEFFEVPYDSPYSEWKGYMVKQKTRAGYRLPTPKGMPWDIEEIMKLCWHVDPNQ
Sbjct: 301 AFAITMWEFFEVPYDSPYSEWKGYMVKQKTRAGYRLPTPKGMPWDIEEIMKLCWHVDPNQ 360
Query: 108 RPTASELREKIEETMAKPESSATPLNKSKSQTSNH 4
RPTASELREKIEETMAKPESSATPLNKSKSQTSNH
Sbjct: 361 RPTASELREKIEETMAKPESSATPLNKSKSQTSNH 395
>gi|7510847|pir||T29770 hypothetical protein ZC581.7 - Caenorhabditis
elegans
Length = 417
Score = 795 bits (2054), Expect = 0.0
Identities = 395/417 (94%), Positives = 395/417 (94%), Gaps = 22/417 (5%)
Frame = -1
Query: 1188 MANKEKILEEDINLPYYHGALMNQDADQLLV----------------------NDGDYMI 1075
MANKEKILEEDINLPYYHGALMNQDADQLLV NDGDYMI
Sbjct: 1 MANKEKILEEDINLPYYHGALMNQDADQLLVMELVSNLKNVGFFNINDFNFFQNDGDYMI 60
Query: 1074 VVKMNQELNKMQLYLAVRLKKGIRRFEIKRNPTSAKIGGKSAPNIGKLVDSMQKETMEIK 895
VVKMNQELNKMQLYLAVRLKKGIRRFEIKRNPTSAKIGGKSAPNIGKLVDSMQKETMEIK
Sbjct: 61 VVKMNQELNKMQLYLAVRLKKGIRRFEIKRNPTSAKIGGKSAPNIGKLVDSMQKETMEIK 120
Query: 894 GERVILKRAIPKGKFQLMHKDVDFKKKLGSGAYGTVYLGRLTKNNTKIAVKKLDTEGNDE 715
GERVILKRAIPKGKFQLMHKDVDFKKKLGSGAYGTVYLGRLTKNNTKIAVKKLDTEGNDE
Sbjct: 121 GERVILKRAIPKGKFQLMHKDVDFKKKLGSGAYGTVYLGRLTKNNTKIAVKKLDTEGNDE 180
Query: 714 ESLAEMMKEARVMQLYDHPNIVKFYGYIVDDIPYLLVLELCNGGSVEDKLVEKGAKLSTK 535
ESLAEMMKEARVMQLYDHPNIVKFYGYIVDDIPYLLVLELCNGGSVEDKLVEKGAKLSTK
Sbjct: 181 ESLAEMMKEARVMQLYDHPNIVKFYGYIVDDIPYLLVLELCNGGSVEDKLVEKGAKLSTK 240
Query: 534 TRIMYTYHAACGIEYLHKKKCIHRDIAARNCLIHKEIVKIADFGMCRATSIYKVDLNKPT 355
TRIMYTYHAACGIEYLHKKKCIHRDIAARNCLIHKEIVKIADFGMCRATSIYKVDLNKPT
Sbjct: 241 TRIMYTYHAACGIEYLHKKKCIHRDIAARNCLIHKEIVKIADFGMCRATSIYKVDLNKPT 300
Query: 354 NTRWLAPEVWDNGETRDNTDIFAFAITMWEFFEVPYDSPYSEWKGYMVKQKTRAGYRLPT 175
NTRWLAPEVWDNGETRDNTDIFAFAITMWEFFEVPYDSPYSEWKGYMVKQKTRAGYRLPT
Sbjct: 301 NTRWLAPEVWDNGETRDNTDIFAFAITMWEFFEVPYDSPYSEWKGYMVKQKTRAGYRLPT 360
Query: 174 PKGMPWDIEEIMKLCWHVDPNQRPTASELREKIEETMAKPESSATPLNKSKSQTSNH 4
PKGMPWDIEEIMKLCWHVDPNQRPTASELREKIEETMAKPESSATPLNKSKSQTSNH
Sbjct: 361 PKGMPWDIEEIMKLCWHVDPNQRPTASELREKIEETMAKPESSATPLNKSKSQTSNH 417