Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZC477_6
(885 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17544508|ref|NP_501109.1| putative protein, with a coiled coi... 518 e-146
gi|39593510|emb|CAE61802.1| Hypothetical protein CBG05768 [Caeno... 463 e-129
gi|7510798|pir||T27606 hypothetical protein ZC477.3 - Caenorhabd... 392 e-108
gi|34866427|ref|XP_236639.2| similar to RIKEN cDNA 5730568A12 [R... 109 7e-23
gi|21362024|ref|NP_078937.2| hypothetical protein FLJ12436 [Homo... 108 1e-22
gi|21313384|ref|NP_079965.1| RIKEN cDNA 5730568A12 [Mus musculus... 108 2e-22
gi|50754439|ref|XP_414385.1| PREDICTED: similar to hypothetical ... 106 8e-22
gi|31202895|ref|XP_310396.1| ENSANGP00000018920 [Anopheles gambi... 93 9e-18
gi|47199086|emb|CAF88086.1| unnamed protein product [Tetraodon n... 89 2e-16
gi|10433919|dbj|BAB14060.1| unnamed protein product [Homo sapien... 87 6e-16
gi|48139173|ref|XP_397613.1| hypothetical protein XP_397613 [Api... 64 4e-09
gi|34864325|ref|XP_236385.2| similar to KIAA1749 protein [Rattus... 46 0.001
gi|31982906|ref|NP_116255.2| hypothetical protein FLJ14957 [Homo... 44 0.006
gi|29421206|dbj|BAB21840.2| KIAA1749 protein [Homo sapiens] 44 0.006
gi|16552142|dbj|BAB71249.1| unnamed protein product [Homo sapiens] 43 0.008
gi|50511089|dbj|BAD32530.1| mKIAA1749 protein [Mus musculus] 43 0.011
gi|34868748|ref|XP_220174.2| similar to periplakin [Rattus norve... 43 0.011
gi|47199272|emb|CAF89432.1| unnamed protein product [Tetraodon n... 42 0.018
gi|14042847|dbj|BAB55415.1| unnamed protein product [Homo sapiens] 42 0.018
gi|22218336|ref|NP_032935.1| periplakin; 195-kD protein; 195kDa ... 41 0.040
gi|42561539|ref|NP_975990.1| Conserved hypothetical protein [Myc... 41 0.040
gi|26389677|dbj|BAC25772.1| unnamed protein product [Mus musculus] 41 0.040
gi|41059877|gb|AAF29436.2| periplakin [Mus musculus] 41 0.040
gi|33331993|gb|AAQ11212.1| major surface protein 3 [Anaplasma ma... 40 0.053
gi|50752881|ref|XP_413790.1| PREDICTED: similar to hypothetical ... 40 0.069
gi|15219336|ref|NP_178048.1| expressed protein [Arabidopsis thal... 40 0.090
gi|47125165|gb|AAH70659.1| LOC431812 protein [Xenopus laevis] 39 0.15
gi|158698|gb|AAA28971.1| tropomyosin isoform 127 39 0.15
gi|16758420|ref|NP_446072.1| Cdc42-binding protein kinase beta [... 39 0.15
gi|7513023|pir||T00337 hypothetical protein KIAA0568 - human (fr... 39 0.15
gi|46156168|ref|ZP_00133302.2| COG0497: ATPase involved in DNA r... 39 0.20
gi|23467741|ref|ZP_00123320.1| COG0497: ATPase involved in DNA r... 39 0.20
gi|47575580|ref|ZP_00245615.1| COG1196: Chromosome segregation A... 39 0.20
gi|50547193|ref|XP_501066.1| hypothetical protein [Yarrowia lipo... 39 0.20
gi|28376422|gb|AAM97265.1| major surface protein 3 [Anaplasma ma... 39 0.20
gi|28376359|gb|AAO41093.1| major surface protein 3 [Anaplasma ma... 38 0.26
gi|45551906|ref|NP_732013.2| CG4843-PC [Drosophila melanogaster]... 38 0.26
gi|42559676|sp|Q95VA8|TPM_TRISP Tropomyosin >gnl|BL_ORD_ID|15068... 38 0.26
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 38 0.34
gi|50755359|ref|XP_414712.1| PREDICTED: similar to periplakin; 1... 38 0.34
gi|2992541|gb|AAC39668.1| periplakin [Homo sapiens] >gnl|BL_ORD_... 38 0.34
gi|3168846|gb|AAC17738.1| 195 kDa cornified envelope precursor [... 38 0.34
gi|14195005|sp|O60437|PEPL_HUMAN Periplakin (195 kDa cornified e... 38 0.34
gi|45439327|ref|NP_002696.3| periplakin; 195 kDa cornified envel... 38 0.34
gi|24417308|gb|AAN60264.1| unknown [Arabidopsis thaliana] 38 0.34
gi|28376440|gb|AAM97274.1| major surface protein 3 [Anaplasma ma... 38 0.34
gi|47215788|emb|CAG02584.1| unnamed protein product [Tetraodon n... 37 0.45
gi|14250918|emb|CAC39247.1| SMC5 protein [Homo sapiens] 37 0.45
gi|20149233|gb|AAM12868.1| periplakin [Canis familiaris] 37 0.45
gi|26334119|dbj|BAC30777.1| unnamed protein product [Mus musculus] 37 0.58
gi|47219756|emb|CAG03383.1| unnamed protein product [Tetraodon n... 37 0.58
gi|23508812|ref|NP_701480.1| hypothetical protein [Plasmodium fa... 37 0.58
gi|38079128|ref|XP_194144.3| RIKEN cDNA 4930473A06 [Mus musculus] 37 0.58
gi|552138|gb|AAA28970.1| tropomyosin isoform 129 37 0.58
gi|12853956|dbj|BAB29896.1| unnamed protein product [Mus musculus] 37 0.58
gi|50728154|ref|XP_416008.1| PREDICTED: similar to ankyrin repea... 37 0.76
gi|30841498|gb|AAP34403.1| CDC42-binding protein kinase beta [Ra... 37 0.76
gi|42559665|sp|Q8WR63|TPM_TRIPS Tropomyosin >gnl|BL_ORD_ID|12206... 37 0.76
gi|17945305|gb|AAL48709.1| RE15528p [Drosophila melanogaster] 37 0.76
gi|24647095|ref|NP_732012.1| CG4843-PB [Drosophila melanogaster]... 37 0.76
gi|31215108|ref|XP_315964.1| ENSANGP00000013561 [Anopheles gambi... 37 0.76
gi|20521019|dbj|BAA20832.2| KIAA0378 [Homo sapiens] 36 0.99
gi|34577114|ref|NP_056391.1| cytomatrix protein p110 [Homo sapiens] 36 0.99
gi|22138113|gb|AAL07517.1| CAST1 [Rattus norvegicus] 36 0.99
gi|27468046|ref|NP_764683.1| ebhA protein [Staphylococcus epider... 36 0.99
gi|28972187|dbj|BAC65547.1| mKIAA0378 protein [Mus musculus] 36 0.99
gi|37360977|ref|NP_808482.2| CAZ-associated structural protein h... 36 0.99
gi|47847434|dbj|BAD21389.1| mFLJ00150 protein [Mus musculus] 36 0.99
gi|47497096|dbj|BAD19147.1| putative phragmoplast-associated kin... 36 1.3
gi|40789066|dbj|BAA02794.2| KIAA0004 [Homo sapiens] 36 1.3
gi|2134903|pir||I53799 CG1 protein - human >gnl|BL_ORD_ID|851351... 36 1.3
gi|422888|pir||S32763 kinectin 1 - human >gnl|BL_ORD_ID|1851636 ... 36 1.3
gi|24850456|ref|NP_055925.1| SMC5 protein [Homo sapiens] >gnl|BL... 36 1.3
gi|9453739|emb|CAB99348.1| bA386J22.1 (novel protein (contains K... 36 1.3
gi|420071|pir||A43336 microtubule-vesicle linker CLIP-170 - huma... 36 1.3
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel... 36 1.3
gi|47229697|emb|CAG06893.1| unnamed protein product [Tetraodon n... 36 1.3
gi|33620775|ref|NP_891556.1| kinectin 1; CG-1 antigen; kinesin r... 36 1.3
gi|50549347|ref|XP_502144.1| hypothetical protein [Yarrowia lipo... 36 1.3
gi|20521095|dbj|BAA25520.2| KIAA0594 protein [Homo sapiens] 36 1.3
gi|6323654|ref|NP_013725.1| CLU1 is similar to the Dictyostelium... 36 1.3
gi|29792250|gb|AAH50555.1| KTN1 protein [Homo sapiens] 36 1.3
gi|15899022|ref|NP_343627.1| Purine NTPase [Sulfolobus solfatari... 36 1.3
gi|4249703|gb|AAD13773.1| myosin heavy chain [Rana catesbeiana] 36 1.3
gi|27468405|ref|NP_765042.1| replication-associated protein [Sta... 36 1.3
gi|50510791|dbj|BAD32381.1| mKIAA1124 protein [Mus musculus] 35 1.7
gi|33942081|ref|NP_898837.1| Cdc42 binding protein kinase beta [... 35 1.7
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 35 1.7
gi|29245389|gb|EAA37030.1| GLP_16_10672_15699 [Giardia lamblia A... 35 1.7
gi|39587824|emb|CAE67842.1| Hypothetical protein CBG13429 [Caeno... 35 1.7
gi|5453820|ref|NP_006176.1| nuclear mitotic apparatus protein 1 ... 35 1.7
gi|50783410|ref|XP_427584.1| PREDICTED: similar to Myosin Vc (My... 35 1.7
gi|8039794|sp|O58441|SYS_PYRHO Seryl-tRNA synthetase (Serine--tR... 35 1.7
gi|47221621|emb|CAF97886.1| unnamed protein product [Tetraodon n... 35 1.7
gi|50757613|ref|XP_415578.1| PREDICTED: similar to myosin heavy ... 35 1.7
gi|14590588|ref|NP_142656.1| seryl-tRNA synthetase [Pyrococcus h... 35 1.7
gi|20093560|ref|NP_613407.1| Uncharacterized archaeal coiled-coi... 35 2.2
gi|1085294|pir||PC4035 cell-cycle-dependent 350K nuclear protein... 35 2.2
gi|1345731|sp|P49454|CENF_HUMAN CENP-F kinetochore protein (Cent... 35 2.2
gi|48894044|ref|ZP_00327242.1| COG0419: ATPase involved in DNA r... 35 2.2
gi|50512294|ref|NP_694514.2| myosin, heavy polypeptide 2, fast m... 35 2.2
gi|38074621|ref|XP_130205.4| expressed sequence AA968343 [Mus mu... 35 2.2
gi|45384370|ref|NP_990334.1| heat shock cognate 70 [Gallus gallu... 35 2.2
gi|14423976|sp|Q9NAS5|TPM_ANISI Tropomyosin (Allergen Ani s 3) >... 35 2.2
gi|15678568|ref|NP_275683.1| intracellular protein transport pro... 35 2.2
gi|4249701|gb|AAD13772.1| myosin heavy chain [Rana catesbeiana] 35 2.2
gi|32421329|ref|XP_331108.1| hypothetical protein [Neurospora cr... 35 2.2
gi|50756341|ref|XP_415120.1| PREDICTED: similar to M-phase phosp... 35 2.2
gi|8698685|gb|AAF78476.1| fast skeletal muscle myosin heavy poly... 35 2.2
gi|14670381|ref|NP_057427.2| centromere protein F (350/400kD); m... 35 2.2
gi|29570808|gb|AAK73348.2| fast muscle-specific myosin heavy cha... 35 2.2
gi|423123|pir||S33124 tpr protein - human 35 2.9
gi|29788770|ref|NP_598708.2| nuclear mitotic apparatus protein 1... 35 2.9
gi|27660717|ref|XP_219011.1| similar to 52kD Ro/SSA autoantigen ... 35 2.9
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 35 2.9
gi|24308518|ref|NP_714962.1| sodium channel associated protein 1... 35 2.9
gi|11498637|ref|NP_069865.1| purine NTPase, putative [Archaeoglo... 35 2.9
gi|4507659|ref|NP_003283.1| translocated promoter region (to act... 35 2.9
gi|48094742|ref|XP_392176.1| similar to Rho-kinase [Apis mellifera] 35 2.9
gi|16330602|ref|NP_441330.1| hypothetical protein [Synechocystis... 35 2.9
gi|23271208|gb|AAH34991.1| Meiosis-specific nuclear structural p... 35 2.9
gi|8922950|ref|NP_060835.1| meiosis-specific nuclear structural ... 35 2.9
gi|21411351|gb|AAH31046.1| Meiosis-specific nuclear structural p... 35 2.9
gi|47551013|ref|NP_999680.1| axonemal dynein light chain p33 [St... 35 2.9
gi|6094504|sp|Q25456|TPM_METEN Tropomyosin (Allergen Met e 1) (M... 35 2.9
gi|1850342|gb|AAB48030.1| Tpr [Homo sapiens] 35 2.9
gi|41473297|gb|AAS07503.1| unknown [Homo sapiens] 35 2.9
gi|37528680|ref|NP_932025.1| hypothetical protein [Photorhabdus ... 35 2.9
gi|38044112|ref|NP_937883.1| restin isoform b; cytoplasmic linke... 35 2.9
gi|45190844|ref|NP_985098.1| AER241Wp [Eremothecium gossypii] >g... 35 2.9
gi|21465469|pdb|1GO4|E Chain E, Crystal Structure Of Mad1-Mad2 R... 35 2.9
gi|4505065|ref|NP_003541.1| MAD1-like 1; MAD1 (mitotic arrest de... 35 2.9
gi|42524115|ref|NP_969495.1| hypothetical protein predicted by G... 35 2.9
gi|4580767|gb|AAD24498.1| mitotic checkpoint protein isoform MAD... 35 2.9
gi|19879404|gb|AAK85118.1| non-muscle myosin II heavy chain [Lol... 35 2.9
gi|4416457|gb|AAD20359.1| mitotic checkpoint protein [Homo sapie... 35 2.9
gi|4506751|ref|NP_002947.1| restin isoform a; cytoplasmic linker... 35 2.9
gi|23451286|gb|AAN32725.1| sodium channel associated protein 1B ... 35 2.9
gi|24637031|gb|AAN63528.1| sodium channel Nav1.8-binding protein... 35 2.9
gi|2351221|dbj|BAA22068.1| myosin heavy chain [Cyprinus carpio] 35 2.9
gi|13186154|emb|CAC33465.1| hypothetical protein [Legionella pne... 35 2.9
gi|20387029|emb|CAC84593.2| troposmyosin [Lepisma saccharina] 35 2.9
gi|24637033|gb|AAN63529.1| sodium channel Nav1.8-binding protein... 35 2.9
gi|19705509|ref|NP_599220.1| outer dense fiber ODF3 [Rattus norv... 35 2.9
gi|806513|dbj|BAA09068.1| myosin heavy chain [Cyprinus carpio] 35 2.9
gi|46135833|ref|XP_389608.1| conserved hypothetical protein [Gib... 34 3.8
gi|50751217|ref|XP_422300.1| PREDICTED: similar to Tpr [Gallus g... 34 3.8
gi|28278258|gb|AAH46212.1| Similar to cytomatrix protein p110 [H... 34 3.8
gi|14249928|gb|AAH08345.1| Unknown (protein for IMAGE:3531356) [... 34 3.8
gi|30912698|sp|Q8NB25|CF60_HUMAN Hypothetical protein C6orf60 34 3.8
gi|49115503|gb|AAH73415.1| Unknown (protein for MGC:80881) [Xeno... 34 3.8
gi|211109|gb|AAA48579.1| alpha-tropomyosin [Gallus gallus] 34 3.8
gi|50806321|ref|XP_424414.1| PREDICTED: similar to hypothetical ... 34 3.8
gi|28376430|gb|AAM97269.1| major surface protein 3 [Anaplasma ma... 34 3.8
gi|31455194|gb|AAH13023.1| NUMA1 protein [Homo sapiens] 34 3.8
gi|34364814|emb|CAE45844.1| hypothetical protein [Homo sapiens] 34 3.8
gi|39582799|emb|CAE74262.1| Hypothetical protein CBG21953 [Caeno... 34 3.8
gi|730094|sp|Q05000|MYS_PODCA Myosin heavy chain >gnl|BL_ORD_ID|... 34 3.8
gi|40255143|ref|NP_078857.3| chromosome 6 open reading frame 60 ... 34 3.8
gi|23491269|gb|EAA22849.1| hypothetical protein [Plasmodium yoel... 34 3.8
gi|806511|dbj|BAA09067.1| myosin heavy chain [Cyprinus carpio] 34 3.8
gi|15924665|ref|NP_372199.1| prolyl isomerase [Staphylococcus au... 34 3.8
gi|33088007|gb|AAP93134.1| fast skeletal myosin heavy chain 3 [D... 34 3.8
gi|49483918|ref|YP_041142.1| trigger factor (prolyl isomerase) [... 34 3.8
gi|21750108|dbj|BAC03719.1| unnamed protein product [Homo sapiens] 34 3.8
gi|18026842|gb|AAL55651.1| P194 [Rice tungro bacilliform virus] 34 3.8
gi|2351219|dbj|BAA22067.1| myosin heavy chain [Cyprinus carpio] 34 3.8
gi|33088009|gb|AAP93135.1| fast skeletal myosin heavy chain 4 [D... 34 3.8
gi|31874640|emb|CAD98058.1| hypothetical protein [Homo sapiens] 34 3.8
gi|45383211|ref|NP_989809.1| Nuf2 protein [Gallus gallus] >gnl|B... 34 3.8
gi|111999|pir||S21801 myosin heavy chain, neuronal [similarity] ... 34 3.8
gi|38048155|gb|AAR09980.1| similar to Drosophila melanogaster Tm... 34 3.8
gi|15799704|ref|NP_285716.1| Z0025 gene product [Escherichia col... 34 4.9
gi|38158018|ref|NP_008949.3| centrosomal protein 1; centriole as... 34 4.9
gi|13431711|sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skelet... 34 4.9
gi|8922940|ref|NP_060830.1| chromosome X open reading frame 15; ... 34 4.9
gi|17539164|ref|NP_501001.1| bicaudal D like (4H330) [Caenorhabd... 34 4.9
gi|46592839|ref|NP_997553.1| GRIP-associated protein 1 [Mus musc... 34 4.9
gi|50304743|ref|XP_452327.1| unnamed protein product [Kluyveromy... 34 4.9
gi|50510823|dbj|BAD32397.1| mKIAA1167 protein [Mus musculus] 34 4.9
gi|18676506|dbj|BAB84905.1| FLJ00150 protein [Homo sapiens] 34 4.9
gi|806515|dbj|BAA09069.1| myosin heavy chain [Cyprinus carpio] 34 4.9
gi|37956533|gb|AAP20593.1| effector protein B [Legionella pneumo... 34 4.9
gi|27735429|gb|AAH41219.1| LOC398674 protein [Xenopus laevis] 34 4.9
gi|283831|pir||S23470 beta-tropomyosin - African clawed frog >gn... 34 4.9
gi|46431839|gb|EAK91363.1| hypothetical protein CaO19.187 [Candi... 34 4.9
gi|23508297|ref|NP_700966.1| hypothetical protein [Plasmodium fa... 34 4.9
gi|32766463|gb|AAH55266.1| LOC398674 protein [Xenopus laevis] 34 4.9
gi|42560833|ref|NP_975284.1| Prolipoprotein [Mycoplasma mycoides... 34 4.9
gi|20093662|ref|NP_613509.1| TOPRIM-domain-containing protein, p... 34 4.9
gi|23397483|ref|NP_694955.1| hypothetical protein FLJ36090 [Homo... 34 4.9
gi|34853852|ref|XP_231168.2| similar to CENTRIOLIN [Rattus norve... 34 4.9
gi|50748610|ref|XP_421324.1| PREDICTED: similar to thyroid hormo... 34 4.9
gi|18070853|emb|CAD20123.1| bA165P4.2 (centrosomal protein 1) [H... 34 4.9
gi|21754949|dbj|BAC04596.1| unnamed protein product [Homo sapiens] 34 4.9
gi|27768973|gb|AAH42609.1| ZCWCC3 protein [Homo sapiens] 34 4.9
gi|47717984|gb|AAH70990.1| LOC398674 protein [Xenopus laevis] 34 4.9
gi|50403775|sp|Q14149|ZCW3_HUMAN Zinc finger CW-type coiled-coil... 34 4.9
gi|30725808|ref|NP_849266.1| CXORF15 [Mus musculus] >gnl|BL_ORD_... 34 4.9
gi|28872812|ref|NP_056173.1| zinc finger, CW-type with coiled-co... 34 4.9
gi|10864047|ref|NP_067058.1| epidermal growth factor receptor pa... 34 4.9
gi|1469195|dbj|BAA09485.1| The KIAA0136 gene product is novel. [... 34 4.9
gi|17158629|ref|NP_478050.1| wsv528 [shrimp white spot syndrome ... 33 6.4
gi|12045309|ref|NP_073120.1| conserved hypothetical protein [Myc... 33 6.4
gi|18978304|ref|NP_579661.1| hypothetical protein PF1932 [Pyroco... 33 6.4
gi|38422774|emb|CAC70113.2| Hypothetical protein Y105E8B.1b [Cae... 33 6.4
gi|29653883|ref|NP_819575.1| hypothetical protein CBU0543 [Coxie... 33 6.4
gi|11497187|ref|NP_051262.1| hypothetical protein [Borrelia burg... 33 6.4
gi|10047357|dbj|BAB13466.1| KIAA1640 protein [Homo sapiens] 33 6.4
gi|32563577|ref|NP_493537.2| tropomyosin, LEVamisole resistant L... 33 6.4
gi|2660868|gb|AAC48288.1| fast tropomyosin isoform [Homarus amer... 33 6.4
gi|10121709|gb|AAG13334.1| myosin heavy chain [Gillichthys mirab... 33 6.4
gi|1208409|dbj|BAA07540.1| CeTMI [Caenorhabditis elegans] 33 6.4
gi|32563575|ref|NP_493538.2| tropomyosin, LEVamisole resistant L... 33 6.4
gi|23485601|gb|EAA20486.1| vacuolar protein sorting homolog r-vp... 33 6.4
gi|39579921|emb|CAE56239.1| Hypothetical protein CBG23876 [Caeno... 33 6.4
gi|4826594|gb|AAD30190.1| polyprotein P194 [Rice tungro bacillif... 33 6.4
gi|23612152|ref|NP_703732.1| translation initiation factor IF-2,... 33 6.4
gi|47550911|ref|NP_999628.1| kinesin heavy chain [Strongylocentr... 33 6.4
gi|41150761|ref|XP_371082.1| hypothetical protein FLJ20753 [Homo... 33 6.4
gi|30581135|ref|NP_006297.2| SMC1 structural maintenance of chro... 33 6.4
gi|414985|gb|AAA17371.1| fast myosin heavy chain 33 6.4
gi|2135244|pir||I54383 chromosome segregation protein smc1 [simi... 33 6.4
gi|13928946|ref|NP_113871.1| SMC1 structural maintenance of chro... 33 6.4
gi|9790237|ref|NP_062684.1| SMC1 structural maintenance of chrom... 33 6.4
gi|30172566|ref|NP_777039.1| SMC1 structural maintenance of chro... 33 6.4
gi|32415207|ref|XP_328083.1| hypothetical protein ( (AL390189) r... 33 6.4
gi|19703613|ref|NP_603175.1| DNA repair protein recN [Fusobacter... 33 6.4
gi|37534452|ref|NP_921528.1| putative centromere protein [Oryza ... 33 6.4
gi|48102332|ref|XP_392766.1| similar to 309 kDa centrosomal prot... 33 6.4
gi|38567877|emb|CAE03025.3| OSJNBa0091D06.23 [Oryza sativa (japo... 33 8.4
gi|7496461|pir||T15598 hypothetical protein C25A11.4a - Caenorha... 33 8.4
gi|23509253|ref|NP_701920.1| hypothetical protein [Plasmodium fa... 33 8.4
gi|7496462|pir||T15597 hypothetical protein C25A11.4b - Caenorha... 33 8.4
gi|50729004|ref|XP_416384.1| PREDICTED: similar to Rab6-interact... 33 8.4
gi|16329624|ref|NP_440352.1| unknown protein [Synechocystis sp. ... 33 8.4
gi|39582203|emb|CAE64154.1| Hypothetical protein CBG08772 [Caeno... 33 8.4
gi|17568589|ref|NP_509537.1| apical Junction Molecule AJM-1, Jun... 33 8.4
gi|25148106|ref|NP_741868.1| apical Junction Molecule AJM-1, Jun... 33 8.4
gi|50748282|ref|XP_429303.1| PREDICTED: hypothetical protein XP_... 33 8.4
gi|47220321|emb|CAF98420.1| unnamed protein product [Tetraodon n... 33 8.4
gi|45382421|ref|NP_990707.1| kinectin [Gallus gallus] >gnl|BL_OR... 33 8.4
gi|11467513|ref|NP_043659.1| ATP synthase CF0 beta' chain [Odont... 33 8.4
gi|15643938|ref|NP_228987.1| chromosome segregation SMC protein,... 33 8.4
gi|39597242|emb|CAE59470.1| Hypothetical protein CBG02854 [Caeno... 33 8.4
gi|23491382|gb|EAA22927.1| hypothetical protein [Plasmodium yoel... 33 8.4
gi|13278786|gb|AAH04165.1| NUMA1 protein [Homo sapiens] 33 8.4
gi|3435244|gb|AAC32373.1| centriole associated protein CEP110 [H... 33 8.4
gi|50554303|ref|XP_504560.1| hypothetical protein [Yarrowia lipo... 33 8.4
gi|50400858|sp|Q14980|NUMA_HUMAN Nuclear mitotic apparatus prote... 33 8.4
gi|32879817|gb|AAP88739.1| nuclear mitotic apparatus protein 1 [... 33 8.4
gi|46228226|gb|EAK89125.1| hypothetical protein, within locus of... 33 8.4
gi|48477928|ref|YP_023634.1| chromosome partition protein smc [P... 33 8.4
gi|12852824|dbj|BAB29547.1| unnamed protein product [Mus musculus] 33 8.4
gi|21727892|emb|CAD38260.1| hypothetical protein [Plasmodium fal... 33 8.4
gi|214004|gb|AAA18101.1| smooth muscle beta-tropomyosin 33 8.4
gi|12848320|dbj|BAB27908.1| unnamed protein product [Mus musculus] 33 8.4
gi|32484218|gb|AAH54163.1| MGC64279 protein [Xenopus laevis] >gn... 33 8.4
gi|17568587|ref|NP_509538.1| apical Junction Molecule AJM-1, Jun... 33 8.4
gi|7512173|pir||T30336 nuclear/mitotic apparatus protein - Afric... 33 8.4
gi|12853511|dbj|BAB29764.1| unnamed protein product [Mus musculus] 33 8.4
gi|38344976|emb|CAE02777.2| OSJNBa0011L07.1 [Oryza sativa (japon... 33 8.4
gi|4249697|gb|AAD13770.1| myosin heavy chain [Rana catesbeiana] 33 8.4
gi|38100733|gb|EAA47824.1| hypothetical protein MG03067.4 [Magna... 33 8.4
gi|28436771|gb|AAH46691.1| Smc1l1-prov protein [Xenopus laevis] 33 8.4
gi|29336591|sp|O93308|SMC1_XENLA Structural maintenance of chrom... 33 8.4
gi|31223829|ref|XP_317361.1| ENSANGP00000010412 [Anopheles gambi... 33 8.4
gi|20071483|gb|AAH26498.1| 2610207F23Rik protein [Mus musculus] 33 8.4
gi|17568591|ref|NP_509536.1| apical Junction Molecule AJM-1, Jun... 33 8.4
gi|39930421|ref|NP_080284.1| RIKEN cDNA 2610207F23 [Mus musculus... 33 8.4
gi|50730227|ref|XP_416817.1| PREDICTED: similar to CXORF15 [Gall... 33 8.4
gi|47230292|emb|CAG10706.1| unnamed protein product [Tetraodon n... 33 8.4
gi|23613869|ref|NP_704890.1| hypothetical protein [Plasmodium fa... 33 8.4
>gi|17544508|ref|NP_501109.1| putative protein, with a coiled coil-4
domain, of bilaterial origin (4H869) [Caenorhabditis
elegans]
gi|14550399|gb|AAK67245.1| Hypothetical protein ZC477.3
[Caenorhabditis elegans]
Length = 294
Score = 518 bits (1334), Expect = e-146
Identities = 267/294 (90%), Positives = 267/294 (90%)
Frame = +1
Query: 1 MLTRRLGSNIRWLKHYKYSTNAQEPTKVRGKIDQYVDVYEEFIGVKTVRQAQEEVMRWEK 180
MLTRRLGSNIRWLKHYKYSTNAQEPTKVRGKIDQYVDVYEEFIGVKTVRQAQEEVMRWEK
Sbjct: 1 MLTRRLGSNIRWLKHYKYSTNAQEPTKVRGKIDQYVDVYEEFIGVKTVRQAQEEVMRWEK 60
Query: 181 KLSEAQLVRREKQSEINNLQSRLKEIHFDLDRTSRGEDKYLQLLTEEHQIIKKERELLNS 360
KLSEAQLVRREKQSEINNLQSRLKEIHFDLDRTSRGEDKYLQLLTEEHQIIKKERELLNS
Sbjct: 61 KLSEAQLVRREKQSEINNLQSRLKEIHFDLDRTSRGEDKYLQLLTEEHQIIKKERELLNS 120
Query: 361 FEGLETAEREAFHQLXXXXXXXXXXXXXXAEKTKWWGVSASLIGALLGIAGTSIGNELRM 540
FEGLETAEREAFHQL AEKTKWWGVSASLIGALLGIAGTSIGNELRM
Sbjct: 121 FEGLETAEREAFHQLSMRVRSSHERERERAEKTKWWGVSASLIGALLGIAGTSIGNELRM 180
Query: 541 RKLKEMLPIGGAQMSEMAKAIGEQNENVAIFLADMRKALQVDGVKPTDALPESDVKKVSD 720
RKLKEMLPIGGAQMSEMAKAIGEQNENVAIFLADMRKALQVDGVKPTDALPESDVKKVSD
Sbjct: 181 RKLKEMLPIGGAQMSEMAKAIGEQNENVAIFLADMRKALQVDGVKPTDALPESDVKKVSD 240
Query: 721 LDKVYVGSDMERLLEQTEKNIESKMKLRTLLXXXXXXXXXXXXXPWLYAVFRGD 882
LDKVYVGSDMERLLEQTEKNIESKMKLRTLL PWLYAVFRGD
Sbjct: 241 LDKVYVGSDMERLLEQTEKNIESKMKLRTLLTVVVIYTAVAVTAPWLYAVFRGD 294