Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= ZC395_8
(564 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17552756|ref|NP_498128.1| CLocK (biological timing) abnormali... 373 e-102
gi|39586553|emb|CAE73680.1| Hypothetical protein CBG21190 [Caeno... 352 3e-96
gi|3806019|gb|AAC69179.1| ubiquinone biosynthesis protein coq7 [... 209 3e-53
gi|20587962|ref|NP_034070.1| demethyl-Q 7 [Mus musculus] >gnl|BL... 209 3e-53
gi|12643397|sp|Q99807|COQ7_HUMAN Ubiquinone biosynthesis protein... 207 1e-52
gi|25453484|ref|NP_057222.2| COQ7 protein; COQ7 coenzyme Q, 7 ho... 207 1e-52
gi|20385593|gb|AAM21346.1| placental protein KG-20 [Homo sapiens] 207 1e-52
gi|50755854|ref|XP_414911.1| PREDICTED: similar to CLK-1 [Gallus... 206 3e-52
gi|3811295|gb|AAC69451.1| timing protein CLK-1; ubiquinone biosy... 205 4e-52
gi|25453396|ref|NP_036917.1| demethyl-Q 7; Coenzyme q (ubiquinon... 205 4e-52
gi|12052820|emb|CAB66582.1| hypothetical protein [Homo sapiens] 204 9e-52
gi|6682309|emb|CAB64655.1| putative COQ7 isologue [Drosophila me... 192 3e-48
gi|24640215|ref|NP_651967.2| CG14437-PA [Drosophila melanogaster... 192 3e-48
gi|47157064|gb|AAT12412.1| ubiquinone biosynthesis protein COQ7-... 187 8e-47
gi|47220282|emb|CAG03316.1| unnamed protein product [Tetraodon n... 184 9e-46
gi|31218166|ref|XP_316597.1| ENSANGP00000011540 [Anopheles gambi... 180 2e-44
gi|7446710|pir||S71353 Coq7 protein homolog - rat 169 4e-41
gi|48102158|ref|XP_392748.1| similar to ubiquinone biosynthesis ... 159 4e-38
gi|50258444|gb|EAL21133.1| hypothetical protein CNBD5090 [Crypto... 146 2e-34
gi|20380261|gb|AAH28276.1| Coq7 protein [Mus musculus] 145 4e-34
gi|46202110|ref|ZP_00053751.2| COG2941: Ubiquinone biosynthesis ... 145 6e-34
gi|50553126|ref|XP_503973.1| hypothetical protein [Yarrowia lipo... 142 4e-33
gi|19112208|ref|NP_595416.1| ubiquinone biosynthesis protein [Sc... 141 7e-33
gi|32405326|ref|XP_323276.1| hypothetical protein [Neurospora cr... 138 8e-32
gi|50422771|ref|XP_459962.1| unnamed protein product [Debaryomyc... 135 5e-31
gi|37362696|ref|NP_014768.2| may encode a protein involved in on... 132 3e-30
gi|46437280|gb|EAK96629.1| hypothetical protein CaO19.9495 [Cand... 132 3e-30
gi|1168783|sp|P41735|CAT5_YEAST CAT5 protein (Ubiquinone biosynt... 132 3e-30
gi|16126436|ref|NP_421000.1| Coq7 family protein [Caulobacter cr... 132 4e-30
gi|42520906|ref|NP_966821.1| Coq7 family protein [Wolbachia endo... 132 4e-30
gi|50308113|ref|XP_454057.1| unnamed protein product [Kluyveromy... 130 1e-29
gi|45185526|ref|NP_983242.1| ACL162Cp [Eremothecium gossypii] >g... 129 4e-29
gi|48763904|ref|ZP_00268457.1| COG2941: Ubiquinone biosynthesis ... 129 5e-29
gi|46308539|ref|ZP_00210732.1| COG2941: Ubiquinone biosynthesis ... 128 8e-29
gi|48850378|ref|ZP_00304620.1| COG2941: Ubiquinone biosynthesis ... 125 4e-28
gi|50292467|ref|XP_448666.1| unnamed protein product [Candida gl... 124 1e-27
gi|46136805|ref|XP_390094.1| hypothetical protein FG09918.1 [Gib... 119 3e-26
gi|38102466|gb|EAA49301.1| hypothetical protein MG00959.4 [Magna... 119 3e-26
gi|1841536|gb|AAC53055.1| COQ7 [Mus musculus] 114 9e-25
gi|49094490|ref|XP_408706.1| hypothetical protein AN4569.2 [Aspe... 94 2e-18
gi|15892162|ref|NP_359876.1| ubiquinone biosynthesis protein coq... 92 6e-18
gi|34580808|ref|ZP_00142288.1| ubiquinone biosynthesis protein c... 92 6e-18
gi|42453390|ref|ZP_00153297.1| hypothetical protein Rick023101 [... 90 3e-17
gi|15604064|ref|NP_220579.1| UBIQUINONE BIOSYNTHESIS PROTEIN COQ... 90 3e-17
gi|23105981|ref|ZP_00092435.1| COG2941: Ubiquinone biosynthesis ... 69 7e-11
gi|34498826|ref|NP_903041.1| conserved hypothetical protein [Chr... 68 1e-10
gi|50085492|ref|YP_047002.1| putative ubiquinone biosynthesis pr... 67 2e-10
gi|48728585|ref|ZP_00262341.1| COG2941: Ubiquinone biosynthesis ... 67 3e-10
gi|41689892|ref|ZP_00146425.1| COG2941: Ubiquinone biosynthesis ... 63 3e-09
gi|48781033|ref|ZP_00277687.1| COG2941: Ubiquinone biosynthesis ... 63 3e-09
gi|26987168|ref|NP_742593.1| conserved hypothetical protein [Pse... 62 7e-09
gi|15838139|ref|NP_298827.1| ubiquinone biosynthesis protein [Xy... 62 7e-09
gi|23472792|ref|ZP_00128114.1| COG2941: Ubiquinone biosynthesis ... 61 2e-08
gi|28198659|ref|NP_778973.1| ubiquinone biosynthesis protein [Xy... 60 3e-08
gi|22994717|ref|ZP_00039211.1| COG2941: Ubiquinone biosynthesis ... 60 3e-08
gi|15595852|ref|NP_249346.1| hypothetical protein [Pseudomonas a... 60 3e-08
gi|28867827|ref|NP_790446.1| conserved hypothetical protein [Pse... 60 3e-08
gi|30249633|ref|NP_841703.1| conserved hypothetical protein [Nit... 60 3e-08
gi|49078290|gb|AAT49770.1| PA0655 [synthetic construct] 59 5e-08
gi|17547573|ref|NP_520975.1| CONSERVED HYPOTHETICAL PROTEIN [Ral... 59 6e-08
gi|21229952|ref|NP_635869.1| ubiquinone biosynthesis protein [Xa... 58 1e-07
gi|22997977|ref|ZP_00042176.1| COG2941: Ubiquinone biosynthesis ... 58 1e-07
gi|21241259|ref|NP_640841.1| ubiquinone biosynthesis protein [Xa... 57 2e-07
gi|47571935|ref|ZP_00241982.1| COG2941: Ubiquinone biosynthesis ... 55 7e-07
gi|46319426|ref|ZP_00219833.1| COG2941: Ubiquinone biosynthesis ... 55 9e-07
gi|48767571|ref|ZP_00271925.1| COG2941: Ubiquinone biosynthesis ... 55 1e-06
gi|46310992|ref|ZP_00211606.1| COG2941: Ubiquinone biosynthesis ... 54 2e-06
gi|48861001|ref|ZP_00314907.1| COG2941: Ubiquinone biosynthesis ... 53 4e-06
gi|33594073|ref|NP_881717.1| conserved hypothetical protein [Bor... 52 9e-06
gi|33599863|ref|NP_887423.1| conserved hypothetical protein [Bor... 51 2e-05
gi|31204157|ref|XP_311027.1| ENSANGP00000019901 [Anopheles gambi... 51 2e-05
gi|33595478|ref|NP_883121.1| conserved hypothetical protein [Bor... 51 2e-05
gi|1841534|gb|AAC51120.1| CLK-1 [Homo sapiens] 49 6e-05
gi|29655155|ref|NP_820847.1| conserved hypothetical protein [Cox... 45 7e-04
gi|45517272|ref|ZP_00168824.1| COG2941: Ubiquinone biosynthesis ... 43 0.004
gi|6324478|ref|NP_014547.1| RFC is a DNA binding protein and ATP... 35 0.92
gi|50513622|pdb|1SXJ|B Chain B, Crystal Structure Of The Eukaryo... 35 0.92
gi|27542757|gb|AAO16690.1| hypothetical protein-like protein [So... 34 1.6
gi|11497172|ref|NP_051281.1| conserved hypothetical protein [Bor... 34 2.0
gi|10177671|dbj|BAB11031.1| unnamed protein product [Arabidopsis... 33 2.7
gi|22973819|ref|ZP_00020302.1| hypothetical protein [Chloroflexu... 33 2.7
gi|46981332|gb|AAT07650.1| unknown protein [Oryza sativa (japoni... 33 4.5
gi|45915954|ref|ZP_00194767.2| COG3843: Type IV secretory pathwa... 32 5.9
gi|47169184|pdb|1SPV|A Chain A, Crystal Structure Of The Putativ... 32 5.9
gi|39936250|ref|NP_948526.1| sensor histidine kinase with a PAS/... 32 5.9
>gi|17552756|ref|NP_498128.1| CLocK (biological timing) abnormality
CLK-1, ubiquinone biosynthesis protein (20.5 kD) (clk-1)
[Caenorhabditis elegans]
gi|1353115|sp|P48376|COQ7_CAEEL Ubiquinone biosynthesis protein
COQ7 homolog (Clock abnormal protein 1) (Protein clk-1)
gi|7498053|pir||T27545 hypothetical protein clk-1 - Caenorhabditis
elegans
gi|9803028|gb|AAG00035.1| Clock (biological timing) abnormality
protein 1 [Caenorhabditis elegans]
Length = 187
Score = 373 bits (957), Expect = e-102
Identities = 187/187 (100%), Positives = 187/187 (100%)
Frame = +1
Query: 1 MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEE 180
MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEE
Sbjct: 1 MFRVITRGAHTAASRQALIEKIIRVDHAGELGADRIYAGQLAVLQGSSVGSVIKKMWDEE 60
Query: 181 KEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYN 360
KEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYN
Sbjct: 61 KEHLDTMERLAAKHNVPHTVFSPVFSVAAYALGVGSALLGKEGAMACTIAVEELIGQHYN 120
Query: 361 DQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGA 540
DQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGA
Sbjct: 121 DQLKELLADDPETHKELLKILTRLRDEELHHHDTGVEHDGMKAPAYSALKWIIQTGCKGA 180
Query: 541 IAIAEKI 561
IAIAEKI
Sbjct: 181 IAIAEKI 187