Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y71H2AM_16
(366 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17556420|ref|NP_497618.1| cytochrome C oxidase (14.8 kD) (3D8... 270 4e-72
gi|39590614|emb|CAE64984.1| Hypothetical protein CBG09819 [Caeno... 268 2e-71
gi|24643375|ref|NP_728294.1| CG14235-PA [Drosophila melanogaster... 90 9e-18
gi|24643377|ref|NP_728295.1| CG14235-PB [Drosophila melanogaster... 88 4e-17
gi|38048151|gb|AAR09978.1| similar to Drosophila melanogaster CG... 88 4e-17
gi|47221675|emb|CAF97940.1| unnamed protein product [Tetraodon n... 87 8e-17
gi|41055614|ref|NP_956800.1| hypothetical protein MGC66195 [Dani... 86 1e-16
gi|33339250|gb|AAQ14281.1| cytochrome c oxidase subunit VIb prec... 86 2e-16
gi|49097864|ref|XP_410392.1| hypothetical protein AN6255.2 [Aspe... 86 2e-16
gi|32815861|gb|AAP88308.1| cytochrome c oxidase polypeptide VIb ... 83 1e-15
gi|48101983|ref|XP_392729.1| similar to CG14235-PA [Apis mellifera] 80 1e-14
gi|47226014|emb|CAG04388.1| unnamed protein product [Tetraodon n... 79 2e-14
gi|32413094|ref|XP_327027.1| hypothetical protein [Neurospora cr... 79 3e-14
gi|46329498|gb|AAH68886.1| MGC82428 protein [Xenopus laevis] 78 4e-14
gi|31217809|ref|XP_316509.1| ENSANGP00000024683 [Anopheles gambi... 78 5e-14
gi|50540462|ref|NP_001002695.1| zgc:92631 [Danio rerio] >gnl|BL_... 78 5e-14
gi|4586449|dbj|BAA76393.1| cytochrome c oxidase subunit 6b-1 [Or... 77 6e-14
gi|38102635|gb|EAA49453.1| hypothetical protein MG01111.4 [Magna... 77 8e-14
gi|4502985|ref|NP_001854.1| cytochrome c oxidase subunit VIb; hu... 77 1e-13
gi|30584127|gb|AAP36312.1| Homo sapiens cytochrome c oxidase sub... 77 1e-13
gi|13385090|ref|NP_079904.1| cytochrome c oxidase, subunit VIb [... 76 1e-13
gi|227130|prf||1614425A chymodenin 75 2e-13
gi|1942993|pdb|1OCC|H Chain H, Structure Of Bovine Heart Cytochr... 75 2e-13
gi|28603814|ref|NP_788848.1| cytochrome c oxidase subunit VIb [B... 75 2e-13
gi|48428035|sp|Q7YRK6|COXG_TARSY Cytochrome c oxidase polypeptid... 75 2e-13
gi|50311661|ref|XP_455857.1| unnamed protein product [Kluyveromy... 74 7e-13
gi|45188113|ref|NP_984336.1| ADR240Cp [Eremothecium gossypii] >g... 74 7e-13
gi|19075822|ref|NP_588322.1| cytochrome c oxidase polypeptide vi... 73 2e-12
gi|6323067|ref|NP_013139.1| Subunit VIb of cytochrome c oxidase,... 72 2e-12
gi|18424030|ref|NP_568867.1| cytochrome c oxidase subunit 6b, pu... 72 2e-12
gi|22204116|gb|AAM92706.1| putative cytochrome c oxidase subunit... 72 3e-12
gi|50284985|ref|XP_444921.1| unnamed protein product [Candida gl... 72 3e-12
gi|21554378|gb|AAM63485.1| cytochrome c oxidase subunit, putativ... 72 3e-12
gi|15219886|ref|NP_173661.1| cytochrome c oxidase subunit 6b, pu... 72 3e-12
gi|21592329|gb|AAM64280.1| cytochrome c oxidase subunit 6b [Arab... 71 4e-12
gi|49900163|gb|AAH77036.1| Unknown (protein for MGC:89881) [Xeno... 71 6e-12
gi|32401320|gb|AAP80832.1| cytochrome c oxidase subunit 6b-1 [Gr... 71 6e-12
gi|34536823|ref|NP_899665.1| cytochrome c oxidase subunit VIb, t... 70 1e-11
gi|34906824|ref|NP_914759.1| putative cytochrome c oxidase subun... 70 1e-11
gi|50257301|gb|EAL20010.1| hypothetical protein CNBF3370 [Crypto... 70 1e-11
gi|33867283|gb|AAN46754.1| cytochrome c oxidase subunit VIb test... 68 5e-11
gi|33867279|gb|AAN46752.1| cytochrome c oxidase subunit VIb test... 67 8e-11
gi|34854503|ref|XP_218220.2| similar to hypothetical protein 493... 67 8e-11
gi|15234375|ref|NP_194535.1| cytochrome c oxidase subunit 6b, pu... 67 8e-11
gi|50421689|ref|XP_459400.1| unnamed protein product [Debaryomyc... 67 1e-10
gi|46123781|ref|XP_386444.1| hypothetical protein FG06268.1 [Gib... 65 3e-10
gi|9967162|dbj|BAB12275.1| cytochrome c oxidase subunit 6b [Oryz... 65 3e-10
gi|34190658|gb|AAH26123.2| COXVIB2 protein [Homo sapiens] 64 5e-10
gi|50553248|ref|XP_504034.1| hypothetical protein [Yarrowia lipo... 64 9e-10
gi|34222387|ref|NP_653214.2| cytochrome c oxidase subunit VIb, t... 63 2e-09
gi|47497069|dbj|BAD19121.1| putative cytochrome c oxidase subuni... 62 4e-09
gi|49071938|ref|XP_400258.1| hypothetical protein UM02643.1 [Ust... 62 4e-09
gi|418749|pir||A60325 cytochrome-c oxidase (EC 1.9.3.1) chain VI... 61 6e-09
gi|34855791|ref|XP_344880.1| similar to Uroplakin Ia (UPIa) (UPK... 58 4e-08
gi|15223279|ref|NP_174548.1| cytochrome c oxidase subunit VIb fa... 41 0.005
gi|6714273|gb|AAF25969.1| F6N18.10 [Arabidopsis thaliana] 40 0.008
gi|23613797|ref|NP_704818.1| hypothetical protein [Plasmodium fa... 37 0.094
gi|50288227|ref|XP_446542.1| unnamed protein product [Candida gl... 37 0.12
gi|563375|emb|CAA84031.1| mucin [Homo sapiens] 35 0.27
gi|15226905|ref|NP_181056.1| HEM protein-related [Arabidopsis th... 35 0.36
gi|4996503|dbj|BAA78503.1| serine repeat antigen [Plasmodium fal... 35 0.46
gi|50287941|ref|XP_446399.1| unnamed protein product [Candida gl... 35 0.46
gi|46321597|ref|ZP_00221973.1| COG0457: FOG: TPR repeat [Burkhol... 34 0.61
gi|4996505|dbj|BAA78504.1| serine repeat antigen [Plasmodium fal... 34 0.79
gi|2290124|gb|AAC58900.1| envelope glycoprotein [Human immunodef... 34 0.79
gi|1694958|dbj|BAA13747.1| serine repeat antigen [Plasmodium fal... 33 1.0
gi|4996489|dbj|BAA78496.1| serine repeat antigen [Plasmodium fal... 33 1.0
gi|32188095|gb|AAP75772.1| serine repeat antigen [Plasmodium fal... 33 1.0
gi|32188091|gb|AAP75770.1| serine repeat antigen [Plasmodium fal... 33 1.0
gi|160687|gb|AAA29765.1| serine rich protein (SERP I) 33 1.0
gi|1694964|dbj|BAA13750.1| serine repeat antigen [Plasmodium fal... 33 1.0
gi|28828512|gb|AAO51120.1| similar to Homo sapiens (Human). Hist... 33 1.0
gi|50423891|ref|XP_460530.1| unnamed protein product [Debaryomyc... 33 1.0
gi|47569905|ref|ZP_00240572.1| tetrapyrrole methylase family pro... 33 1.4
gi|42779135|ref|NP_976382.1| tetrapyrrole methylase family prote... 33 1.4
gi|21398019|ref|NP_654004.1| TP_methylase, Tetrapyrrole (Corrin/... 33 1.4
gi|47219462|emb|CAG10826.1| unnamed protein product [Tetraodon n... 33 1.4
gi|15612635|ref|NP_240938.1| BH0072~unknown conserved protein [B... 33 1.4
gi|28416389|gb|AAO42667.1| GH07949p [Drosophila melanogaster] 33 1.8
gi|19571553|emb|CAD27464.1| SPAPB15E9.01c [Schizosaccharomyces p... 33 1.8
gi|48474505|sp|Q8TFG9|YL61_SCHPO Hypothetical serine/threonine-r... 33 1.8
gi|41107725|ref|XP_371350.1| similar to RIKEN cDNA 1810063B05 [H... 33 1.8
gi|19343962|gb|AAH25793.1| Unknown (protein for IMAGE:3858121) [... 33 1.8
gi|16183002|gb|AAL13608.1| GH14389p [Drosophila melanogaster] 33 1.8
gi|23481309|gb|EAA17625.1| hypothetical protein [Plasmodium yoel... 33 1.8
gi|24643415|ref|NP_608360.2| CG32529-PA [Drosophila melanogaster... 33 1.8
gi|24762383|ref|NP_611824.1| CG12491-PA [Drosophila melanogaster... 33 1.8
gi|24643419|ref|NP_728309.1| CG32529-PC [Drosophila melanogaster... 33 1.8
gi|48891352|ref|ZP_00324892.1| COG5659: FOG: Transposase [Tricho... 33 1.8
gi|23097521|ref|NP_690987.1| hypothetical protein OB0066 [Oceano... 32 2.3
gi|17934688|ref|NP_531478.1| conserved hypothetical protein [Agr... 32 2.3
gi|32472951|ref|NP_865945.1| probable serine/threonine protein k... 32 2.3
gi|32188107|gb|AAP75778.1| serine repeat antigen [Plasmodium fal... 32 2.3
gi|15888121|ref|NP_353802.1| AGR_C_1421p [Agrobacterium tumefaci... 32 2.3
gi|32188109|gb|AAP75779.1| serine repeat antigen [Plasmodium fal... 32 3.0
gi|32188115|gb|AAP75782.1| serine repeat antigen [Plasmodium fal... 32 3.0
gi|50751546|ref|XP_422448.1| PREDICTED: similar to MUF1 protein;... 32 3.0
gi|32188117|gb|AAP75783.1| serine repeat antigen [Plasmodium fal... 32 3.0
gi|45515466|ref|ZP_00167021.1| COG0176: Transaldolase [Ralstonia... 32 3.0
gi|32566560|ref|NP_510349.2| putative protein family member (XO7... 32 3.0
gi|32188087|gb|AAP75768.1| serine repeat antigen [Plasmodium fal... 32 3.0
gi|32188111|gb|AAP75780.1| serine repeat antigen [Plasmodium fal... 32 3.0
gi|7499225|pir||T21012 hypothetical protein F16B12.6 - Caenorhab... 32 3.0
gi|6321759|ref|NP_011835.1| cell wall integrity and stress respo... 32 3.9
gi|48769566|ref|ZP_00273911.1| COG0176: Transaldolase [Ralstonia... 32 3.9
gi|5922597|dbj|BAA21393.2| alpha-1,2-mannosyltransferase homolog... 32 3.9
gi|44890024|emb|CAF32142.1| hypothetical protein [Aspergillus fu... 32 3.9
gi|2135766|pir||S53362 mucin 5AC (clone JER47) - human (fragment) 32 3.9
gi|19112406|ref|NP_595614.1| putative alpha-1,2 mannosyltransfer... 32 3.9
gi|34896584|ref|NP_909636.1| putative gag-pol precursor [Oryza s... 32 3.9
gi|32188123|gb|AAP75786.1| serine repeat antigen [Plasmodium fal... 31 5.1
gi|32188099|gb|AAP75774.1| serine repeat antigen [Plasmodium fal... 31 5.1
gi|50255273|gb|EAL18008.1| hypothetical protein CNBK0290 [Crypto... 31 5.1
gi|134437|sp|P13823|SERA_PLAFG Serine-repeat antigen protein pre... 31 5.1
gi|48094840|ref|XP_394282.1| similar to CG6335-PA [Apis mellifera] 31 5.1
gi|50307991|ref|XP_453995.1| unnamed protein product [Kluyveromy... 31 5.1
gi|627053|pir||A54512 serine-repeat antigen (clone 366) - malari... 31 5.1
gi|50285585|ref|XP_445221.1| unnamed protein product [Candida gl... 31 5.1
gi|27694890|gb|AAH41754.1| Fga-prov protein [Xenopus laevis] 31 5.1
gi|46137159|ref|XP_390271.1| hypothetical protein FG10095.1 [Gib... 31 5.1
gi|552180|gb|AAA29488.1| parasite protein 31 5.1
gi|48860888|ref|ZP_00314795.1| COG3866: Pectate lyase [Microbulb... 31 5.1
gi|4996491|dbj|BAA78497.1| serine repeat antigen [Plasmodium fal... 31 5.1
gi|34015171|gb|AAQ56367.1| putative reverse transcriptase [Oryza... 31 6.7
gi|4996499|dbj|BAA78501.1| serine repeat antigen [Plasmodium fal... 31 6.7
gi|50305735|ref|XP_452828.1| unnamed protein product [Kluyveromy... 31 6.7
gi|32188093|gb|AAP75771.1| serine repeat antigen [Plasmodium fal... 31 6.7
gi|32418266|ref|XP_329611.1| hypothetical protein [Neurospora cr... 31 6.7
gi|4996497|dbj|BAA78500.1| serine repeat antigen [Plasmodium fal... 31 6.7
gi|45552113|ref|NP_788758.2| CG33204-PA [Drosophila melanogaster... 31 6.7
gi|34015152|gb|AAQ56348.1| putative reverse transcriptase [Oryza... 31 6.7
gi|33328815|gb|AAQ09814.1| CG4363 [Drosophila yakuba] 31 6.7
gi|47224678|emb|CAG03662.1| unnamed protein product [Tetraodon n... 31 6.7
gi|6324467|ref|NP_014536.1| cell wall integrity and stress respo... 31 6.7
gi|21229160|ref|NP_635082.1| iron-sulfur flavoprotein [Methanosa... 31 6.7
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can... 31 6.7
gi|3132790|gb|AAC16380.1| CACK protein [Crithidia fasciculata] 31 6.7
gi|38106059|gb|EAA52414.1| hypothetical protein MG05106.4 [Magna... 31 6.7
gi|4996551|dbj|BAA78527.1| serine repeat antigen [Plasmodium fal... 31 6.7
gi|50761154|ref|XP_418257.1| PREDICTED: similar to Paired amphip... 31 6.7
gi|24642136|ref|NP_511161.2| CG6146-PA [Drosophila melanogaster]... 31 6.7
gi|41197087|ref|XP_371809.1| chromosome 6 open reading frame 205... 31 6.7
gi|50260862|gb|EAL23512.1| hypothetical protein CNBA1590 [Crypto... 31 6.7
gi|46445626|gb|EAL04894.1| hypothetical protein CaO19.4906 [Cand... 31 6.7
gi|4996495|dbj|BAA78499.1| serine repeat antigen [Plasmodium fal... 31 6.7
gi|48784330|ref|ZP_00280696.1| COG0176: Transaldolase [Burkholde... 30 8.8
gi|11559994|ref|NP_071549.1| phosphatidylinositol 3-kinase p55 s... 30 8.8
gi|417175|sp|Q02362|ICP4_GAHVG Trans-acting transcriptional acti... 30 8.8
gi|4996493|dbj|BAA78498.1| serine repeat antigen [Plasmodium fal... 30 8.8
gi|30018327|ref|NP_829958.1| MazG protein [Bacillus cereus ATCC ... 30 8.8
gi|2662479|gb|AAB88301.1| LACK [Leishmania braziliensis] >gnl|BL... 30 8.8
gi|13991860|gb|AAK51530.1| p36 LACK protein [Leishmania amazonen... 30 8.8
gi|2662477|gb|AAB88300.1| LACK [Leishmania major] >gnl|BL_ORD_ID... 30 8.8
gi|1694968|dbj|BAA13752.1| serine repeat antigen [Plasmodium fal... 30 8.8
gi|39582656|emb|CAE73760.1| Hypothetical protein CBG21295 [Caeno... 30 8.8
gi|32188097|gb|AAP75773.1| serine repeat antigen [Plasmodium fal... 30 8.8
gi|32188125|gb|AAP75787.1| serine repeat antigen [Plasmodium fal... 30 8.8
gi|17544018|ref|NP_500220.1| predicted CDS, putative protein fam... 30 8.8
gi|267147|sp|P30189|TOP1_DROME DNA topoisomerase I >gnl|BL_ORD_I... 30 8.8
gi|50755210|ref|XP_414654.1| PREDICTED: similar to zinc finger, ... 30 8.8
gi|50748018|ref|XP_426415.1| PREDICTED: similar to SH3 and multi... 30 8.8
gi|46432914|gb|EAK92376.1| hypothetical protein CaO19.3380 [Cand... 30 8.8
gi|28828651|gb|AAO51254.1| similar to Plasmodium falciparum. Hyp... 30 8.8
gi|50345894|ref|YP_053222.1| ICP4 (IRS) [Gallid herpesvirus 2] >... 30 8.8
gi|32564625|ref|NP_740795.2| putative membrane protein family me... 30 8.8
gi|47205092|emb|CAF91415.1| unnamed protein product [Tetraodon n... 30 8.8
gi|130923|sp|P27458|PRLB_ACHLY Beta-lytic metalloendopeptidase p... 30 8.8
gi|643430|gb|AAC54010.1| ICP4 protein 30 8.8
gi|32188101|gb|AAP75775.1| serine repeat antigen [Plasmodium fal... 30 8.8
>gi|17556420|ref|NP_497618.1| cytochrome C oxidase (14.8 kD)
(3D877Co) [Caenorhabditis elegans]
gi|13559770|gb|AAK29974.1| Hypothetical protein Y71H2AM.5
[Caenorhabditis elegans]
Length = 121
Score = 270 bits (691), Expect = 4e-72
Identities = 121/121 (100%), Positives = 121/121 (100%)
Frame = +1
Query: 1 MPVEVEVPPTTYERLQQYKEKFSDALRHPDSPDWYKKETHESVKKDLLWAAPYDARFPQV 180
MPVEVEVPPTTYERLQQYKEKFSDALRHPDSPDWYKKETHESVKKDLLWAAPYDARFPQV
Sbjct: 1 MPVEVEVPPTTYERLQQYKEKFSDALRHPDSPDWYKKETHESVKKDLLWAAPYDARFPQV 60
Query: 181 RKQRQCFAYYVDFHRCNELMGQDYKPCKFFQNVYKDFCPGFWTERWDELLSEGRFPAKFD 360
RKQRQCFAYYVDFHRCNELMGQDYKPCKFFQNVYKDFCPGFWTERWDELLSEGRFPAKFD
Sbjct: 61 RKQRQCFAYYVDFHRCNELMGQDYKPCKFFQNVYKDFCPGFWTERWDELLSEGRFPAKFD 120
Query: 361 R 363
R
Sbjct: 121 R 121