Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y67H2A_6
(438 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543984|ref|NP_502556.1| putative protein (15.5 kD) (4O65) [... 293 5e-79
gi|39587688|emb|CAE58626.1| Hypothetical protein CBG01794 [Caeno... 283 5e-76
gi|45686071|ref|YP_003834.1| unknown [Regina ranavirus] >gnl|BL_... 37 0.11
gi|7441347|pir||T06779 clathrin heavy chain - soybean >gnl|BL_OR... 35 0.32
gi|42563757|ref|NP_187466.4| clathrin heavy chain, putative [Ara... 35 0.32
gi|12322717|gb|AAG51341.1| putative clathrin heavy chain, 3' par... 35 0.32
gi|12321552|gb|AAG50828.1| clathrin heavy chain, putative [Arabi... 35 0.32
gi|6016683|gb|AAF01510.1| putative clathrin heavy chain [Arabido... 35 0.32
gi|30681617|ref|NP_187724.2| clathrin heavy chain, putative [Ara... 35 0.32
gi|48847691|ref|ZP_00301941.1| hypothetical protein Saro02003768... 34 0.55
gi|23104809|ref|ZP_00091269.1| COG2225: Malate synthase [Azotoba... 34 0.55
gi|30698979|ref|NP_177540.2| strictosidine synthase family prote... 34 0.71
gi|21431845|sp|P92976|STS3_ARATH Strictosidine synthase 3 precur... 34 0.71
gi|15221106|ref|NP_177542.1| strictosidine synthase family prote... 33 0.93
gi|41054625|ref|NP_955870.1| splicing factor, arginine/serine-ri... 33 0.93
gi|1079170|pir||S50125 larval glue protein Lgp3 precursor - frui... 33 0.93
gi|37520194|ref|NP_923571.1| prolyl endopeptidase [Gloeobacter v... 33 0.93
gi|1335699|emb|CAA53797.1| glue protein [Drosophila virilis] 33 0.93
gi|50553106|ref|XP_503963.1| hypothetical protein [Yarrowia lipo... 33 0.93
gi|50732764|ref|XP_418752.1| PREDICTED: similar to Ubiquitin-con... 33 1.2
gi|50259720|gb|EAL22390.1| hypothetical protein CNBB5630 [Crypto... 33 1.2
gi|46806254|dbj|BAD17462.1| unknown protein [Oryza sativa (japon... 33 1.6
gi|47223329|emb|CAF98713.1| unnamed protein product [Tetraodon n... 33 1.6
gi|49068980|ref|XP_398779.1| hypothetical protein UM01164.1 [Ust... 32 2.1
gi|34876036|ref|XP_223168.2| similar to RIKEN cDNA 0610025G21 [R... 32 2.1
gi|23508304|ref|NP_700973.1| asparagine-rich antigen [Plasmodium... 32 2.1
gi|1754987|gb|AAB40595.1| strictosidine synthase 32 2.1
gi|29346272|ref|NP_809775.1| putative ABC-transporter permease p... 32 2.7
gi|41406264|ref|NP_959100.1| hypothetical protein MAP0166 [Mycob... 32 2.7
gi|30684163|ref|NP_180484.2| splicing factor PWI domain-containi... 32 2.7
gi|25408026|pir||G84693 probable proline-rich protein [imported]... 32 2.7
gi|39583451|emb|CAE73909.1| Hypothetical protein CBG21517 [Caeno... 32 2.7
gi|50546655|ref|XP_500797.1| hypothetical protein [Yarrowia lipo... 32 2.7
gi|46119930|ref|ZP_00179203.2| hypothetical protein Cwat020066 [... 32 2.7
gi|9843651|emb|CAC03679.1| SRM102 [Arabidopsis thaliana] 32 2.7
gi|48927601|dbj|BAD23895.1| Down-regulated in nephrectomized rat... 32 2.7
gi|21225487|ref|NP_631266.1| conserved hypothetical protein SC2H... 32 2.7
gi|34859210|ref|XP_230602.2| similar to transmembrane channel-li... 32 2.7
gi|48831610|ref|ZP_00288668.1| COG0642: Signal transduction hist... 32 3.5
gi|7503938|pir||T16419 hypothetical protein F52C9.8a - Caenorhab... 32 3.5
gi|17548628|ref|NP_521968.1| PROBABLE TRANSMEMBRANE PROTEIN [Ral... 32 3.5
gi|4502919|ref|NP_001288.1| cyclic nucleotide gated channel beta... 32 3.5
gi|32410345|ref|XP_325653.1| predicted protein [Neurospora crass... 32 3.5
gi|30840990|ref|NP_083546.1| Rho GTPase activating protein 24 [M... 32 3.5
gi|1754983|gb|AAB40593.1| strictosidine synthase >gnl|BL_ORD_ID|... 32 3.5
gi|50756401|ref|XP_415149.1| PREDICTED: similar to MondoA [Gallu... 32 3.5
gi|29164893|gb|AAO65178.1| sarcoma antigen NY-SAR-88 [Homo sapiens] 32 3.5
gi|2134905|pir||S32538 cGMP-gated cation channel 2, rod - human ... 32 3.5
gi|50881452|gb|AAT85297.1| hypothetical protein [Oryza sativa (j... 32 3.5
gi|16764268|ref|NP_459883.1| hypothetical protein STM0906 [Phage... 32 3.5
gi|23505495|ref|NP_700424.1| lysis protein (holin) [Salmonella t... 32 3.5
gi|16078451|ref|NP_389270.1| ykvZ [Bacillus subtilis subsp. subt... 32 3.5
gi|50603927|gb|AAH77393.1| Unknown (protein for MGC:81677) [Xeno... 32 3.5
gi|22122687|ref|NP_666273.1| Rho GTPase activating protein 24 [M... 32 3.5
gi|50120786|ref|YP_049953.1| putative FAD-binding oxidase [Erwin... 32 3.5
gi|32413515|ref|XP_327237.1| hypothetical protein [Neurospora cr... 32 3.5
gi|28868557|ref|NP_791176.1| conserved hypothetical protein [Pse... 32 3.5
gi|21749509|dbj|BAC03606.1| unnamed protein product [Homo sapiens] 32 3.5
gi|31210609|ref|XP_314271.1| ENSANGP00000000967 [Anopheles gambi... 31 4.6
gi|7494698|pir||T18630 hypothetical protein B0001.5 - Caenorhabd... 31 4.6
gi|47226842|emb|CAG06684.1| unnamed protein product [Tetraodon n... 31 4.6
gi|28569879|dbj|BAC57916.1| reverse transcriptase [Anopheles gam... 31 4.6
gi|15895431|ref|NP_348780.1| Flagellar basal body M-ring protein... 31 4.6
gi|31210611|ref|XP_314272.1| ENSANGP00000018646 [Anopheles gambi... 31 4.6
gi|15219287|ref|NP_173107.1| arginine/serine-rich protein, putat... 31 4.6
gi|15027957|gb|AAK76509.1| putative arginine/serine-rich protein... 31 4.6
gi|32566425|ref|NP_502305.2| putative protein family member (56.... 31 4.6
gi|42571507|ref|NP_973844.1| arginine/serine-rich protein, putat... 31 4.6
gi|41107690|ref|XP_371239.1| similar to EAPG6122 [Homo sapiens] ... 31 4.6
gi|45709285|gb|AAH67859.1| GTF2IRD2 protein [Homo sapiens] 31 4.6
gi|34868111|ref|XP_231361.2| similar to splicing factor, arginin... 31 4.6
gi|50752991|ref|XP_413822.1| PREDICTED: similar to normal mucosa... 31 4.6
gi|4759172|ref|NP_004710.1| splicing factor, arginine/serine-ric... 31 4.6
gi|50755152|ref|XP_414629.1| PREDICTED: similar to Prp5-like DEA... 31 4.6
gi|38104097|gb|EAA50714.1| hypothetical protein MG04473.4 [Magna... 31 6.0
gi|31198003|ref|XP_307949.1| ENSANGP00000006261 [Anopheles gambi... 31 6.0
gi|50427101|ref|XP_462158.1| unnamed protein product [Debaryomyc... 31 6.0
gi|34870492|ref|XP_346387.1| hypothetical protein XP_346386 [Rat... 31 6.0
gi|2576413|gb|AAB82330.1| major fimbrial subunit of aggregative ... 31 6.0
gi|30248332|ref|NP_840402.1| possible multicopper oxidase [Nitro... 31 6.0
gi|41222515|emb|CAF19045.1| ferredoxin nitrite reductase [Halofe... 31 6.0
gi|22024392|ref|NP_665884.1| kinesin 1C [Rattus norvegicus] >gnl... 31 6.0
gi|38101832|gb|EAA48735.1| hypothetical protein MG00393.4 [Magna... 31 6.0
gi|18640128|ref|NP_570202.1| SPV042 ribonucleotide reductase lar... 31 6.0
gi|46137443|ref|XP_390413.1| hypothetical protein FG10237.1 [Gib... 31 6.0
gi|47573122|ref|ZP_00243162.1| hypothetical protein Rgel01002705... 31 6.0
gi|13775230|ref|NP_112595.1| Rho GTPase activating protein 24 [H... 31 6.0
gi|42568499|ref|NP_200114.2| expressed protein [Arabidopsis thal... 30 7.9
gi|47218309|emb|CAG04141.1| unnamed protein product [Tetraodon n... 30 7.9
gi|23103637|ref|ZP_00090115.1| COG0769: UDP-N-acetylmuramyl trip... 30 7.9
gi|49086812|ref|XP_405423.1| hypothetical protein AN1286.2 [Aspe... 30 7.9
gi|2501494|sp|Q40287|UFO5_MANES Flavonol 3-O-glucosyltransferase... 30 7.9
gi|37521326|ref|NP_924703.1| hypothetical protein glr1757 [Gloeo... 30 7.9
gi|178527|gb|AAA62826.1| amelogenin >gnl|BL_ORD_ID|1877827 gi|38... 30 7.9
gi|23104892|ref|ZP_00091352.1| COG0508: Pyruvate/2-oxoglutarate ... 30 7.9
gi|17567237|ref|NP_508248.1| predicted CDS, reverse transcriptas... 30 7.9
gi|116256|sp|P08825|CHA2_BOMMO Chorion class A protein L12 precu... 30 7.9
gi|24662475|ref|NP_648433.1| CG6279-PA [Drosophila melanogaster]... 30 7.9
gi|16124702|ref|NP_419266.1| beta-N-acetylhexosaminidase, putati... 30 7.9
gi|6649242|gb|AAF21439.1| splicing coactivator subunit SRm300 [H... 30 7.9
gi|8809591|dbj|BAA97142.1| unnamed protein product [Arabidopsis ... 30 7.9
gi|37533424|ref|NP_921014.1| hypothetical protein [Oryza sativa ... 30 7.9
gi|93505|pir||B34768 ORF5 protein - Orf virus (strain NZ2) >gnl|... 30 7.9
gi|13129479|gb|AAK13137.1| Hypothetical protein [Oryza sativa] 30 7.9
gi|17826951|dbj|BAB79288.1| cellulase [Pseudomonas sp. ND137] 30 7.9
gi|17531187|ref|NP_496041.1| putative nuclear protein, with a co... 30 7.9
>gi|17543984|ref|NP_502556.1| putative protein (15.5 kD) (4O65)
[Caenorhabditis elegans]
gi|14787739|emb|CAC44306.1| Hypothetical protein Y67H2A.5
[Caenorhabditis elegans]
Length = 145
Score = 293 bits (750), Expect = 5e-79
Identities = 145/145 (100%), Positives = 145/145 (100%)
Frame = +1
Query: 1 MSLALRKTLGVARFSMRTASFQAVPTNAGKTPPTLEQFDPLNPGEWQLGAGGKILPRLPE 180
MSLALRKTLGVARFSMRTASFQAVPTNAGKTPPTLEQFDPLNPGEWQLGAGGKILPRLPE
Sbjct: 1 MSLALRKTLGVARFSMRTASFQAVPTNAGKTPPTLEQFDPLNPGEWQLGAGGKILPRLPE 60
Query: 181 GTKCGNLVMGKYGLYDPILKKRVDTYANALLEGKKSEEAGPFDVAVSKIAKVLSYICFVI 360
GTKCGNLVMGKYGLYDPILKKRVDTYANALLEGKKSEEAGPFDVAVSKIAKVLSYICFVI
Sbjct: 61 GTKCGNLVMGKYGLYDPILKKRVDTYANALLEGKKSEEAGPFDVAVSKIAKVLSYICFVI 120
Query: 361 AIYNLISLVNGTPLPPLSHVKAPGS 435
AIYNLISLVNGTPLPPLSHVKAPGS
Sbjct: 121 AIYNLISLVNGTPLPPLSHVKAPGS 145