Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y62E10A_9
(633 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543864|ref|NP_502576.1| RAB family member (rab-19) [Caenorh... 427 e-119
gi|39587673|emb|CAE58611.1| Hypothetical protein CBG01778 [Caeno... 401 e-111
gi|17737545|ref|NP_523970.1| CG7062-PA [Drosophila melanogaster]... 234 1e-60
gi|50754287|ref|XP_414313.1| PREDICTED: similar to Ras-related p... 219 3e-56
gi|37550537|ref|XP_290714.2| RAB41 protein [Homo sapiens] >gnl|B... 219 4e-56
gi|31199429|ref|XP_308662.1| ENSANGP00000011129 [Anopheles gambi... 218 6e-56
gi|48141271|ref|XP_397201.1| similar to ENSANGP00000011129 [Apis... 213 2e-54
gi|26986192|emb|CAD58914.1| Ras-related protein Rab [Mus musculus] 213 3e-54
gi|41150482|ref|XP_370980.1| similar to RAB41 [Homo sapiens] 204 1e-51
gi|47211718|emb|CAF95873.1| unnamed protein product [Tetraodon n... 196 2e-49
gi|50728924|ref|XP_416347.1| PREDICTED: similar to dGTPase (EC 3... 195 5e-49
gi|47222068|emb|CAG12094.1| unnamed protein product [Tetraodon n... 193 2e-48
gi|33859608|ref|NP_035356.1| RAB19, member RAS oncogene family [... 189 3e-47
gi|3041721|sp|P35294|RB19_MOUSE Ras-related protein Rab-19 >gnl|... 189 3e-47
gi|39586275|emb|CAE66686.1| Hypothetical protein CBG12025 [Caeno... 189 3e-47
gi|11558647|emb|CAC17832.1| secretion related GTPase, (SrgA) [As... 188 6e-47
gi|21361418|ref|NP_055303.2| RAB30, member RAS oncogene family [... 188 6e-47
gi|49901476|gb|AAH76437.1| Zgc:100889 protein [Danio rerio] 188 6e-47
gi|25150215|ref|NP_491199.2| RAB family member (24.0 kD) (rab-8)... 188 6e-47
gi|50731203|ref|XP_417213.1| PREDICTED: similar to RAB30 [Gallus... 187 1e-46
gi|466170|sp|P16976|YPT1_MAIZE GTP-binding protein YPTM1 >gnl|BL... 187 1e-46
gi|19115492|ref|NP_594580.1| ypt1-related protein 2 [Schizosacch... 186 2e-46
gi|49522647|gb|AAH71176.1| Unknown (protein for IMAGE:7098881) [... 186 4e-46
gi|38372905|ref|NP_075615.2| cell line NK14 derived transforming... 186 4e-46
gi|2136076|pir||JC4962 rab protein 30 - human >gnl|BL_ORD_ID|188... 186 4e-46
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar... 186 4e-46
gi|12856302|dbj|BAB30625.1| unnamed protein product [Mus musculus] 185 7e-46
gi|49102994|ref|XP_411111.1| hypothetical protein AN6974.2 [Aspe... 184 9e-46
gi|16933567|ref|NP_005361.2| mel transforming oncogene; ras-asso... 184 9e-46
gi|47937791|gb|AAH72360.1| MGC83515 protein [Xenopus laevis] 184 9e-46
gi|30585389|gb|AAP36967.1| Homo sapiens mel transforming oncogen... 184 9e-46
gi|227603|prf||1707300A guanine nucleotide binding protein 184 1e-45
gi|4293|emb|CAA25036.1| unnamed protein product [Saccharomyces c... 184 2e-45
gi|1710002|sp|P55258|RB8A_MOUSE Ras-related protein Rab-8A (Onco... 183 2e-45
gi|234746|gb|AAB19681.1| RAS-related protein MEL [Homo sapiens] 183 2e-45
gi|49250515|gb|AAH74609.1| Unknown (protein for MGC:69471) [Xeno... 183 2e-45
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno... 183 2e-45
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)... 183 2e-45
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y... 183 3e-45
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B... 183 3e-45
gi|14318480|ref|NP_116615.1| Ras-like small GTPase, involved in ... 183 3e-45
gi|7498104|pir||T33855 hypothetical protein D1037.4 - Caenorhabd... 182 4e-45
gi|50292669|ref|XP_448767.1| unnamed protein product [Candida gl... 182 4e-45
gi|10129780|emb|CAC08198.1| putative GTP-binding protein [Kluyve... 182 5e-45
gi|13537429|dbj|BAB40669.1| small GTPase Rab1 [Entamoeba histoly... 182 6e-45
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g... 182 6e-45
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n... 181 8e-45
gi|38106736|gb|EAA53007.1| hypothetical protein MG06135.4 [Magna... 181 1e-44
gi|32398899|emb|CAD98364.1| small GTP binding protein rab1a, pro... 181 1e-44
gi|3273209|dbj|BAA31150.1| Rab1C [Dictyostelium discoideum] 181 1e-44
gi|32411557|ref|XP_326259.1| RAS-RELATED PROTEIN RAB1BV [Neurosp... 181 1e-44
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_... 180 2e-44
gi|24306110|gb|AAN52527.1| GTP-binding protein [Pichia angusta] ... 180 2e-44
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R... 180 2e-44
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_... 180 2e-44
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni... 180 2e-44
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max] 179 3e-44
gi|38175435|dbj|BAC83185.2| putative ras-related protein [Oryza ... 179 3e-44
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD... 179 3e-44
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p... 179 4e-44
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp... 179 4e-44
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1... 179 4e-44
gi|15236555|ref|NP_193486.1| Ras-related GTP-binding protein, pu... 179 5e-44
gi|16974365|gb|AAL31108.1| AT4g17530/dl4800c [Arabidopsis thaliana] 179 5e-44
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen... 179 5e-44
gi|103720|pir||D38625 GTP-binding protein o-rab1 - electric ray ... 179 5e-44
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-... 179 5e-44
gi|7438373|pir||S72515 GTP-binding protein RAB1 - garden petunia... 178 7e-44
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_... 178 7e-44
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens] 178 7e-44
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C... 178 9e-44
gi|14475537|emb|CAC41973.1| putative Rab/GTPase [Colletotrichum ... 178 9e-44
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO... 178 9e-44
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ... 178 9e-44
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori] 178 9e-44
gi|37747686|gb|AAH60015.1| MGC68629 protein [Xenopus laevis] 178 9e-44
gi|7438375|pir||H71444 GTP-binding protein - Arabidopsis thalian... 177 1e-43
gi|46123663|ref|XP_386385.1| hypothetical protein FG06209.1 [Gib... 177 1e-43
gi|303748|dbj|BAA02115.1| GTP-binding protein [Pisum sativum] >g... 177 1e-43
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus] 177 1e-43
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus... 177 1e-43
gi|1053065|gb|AAA80679.1| small GTP-binding protein 177 1e-43
gi|7438417|pir||JE0318 GTP-binding protein rabB - silkworm >gnl|... 177 2e-43
gi|50413456|ref|XP_457265.1| unnamed protein product [Debaryomyc... 177 2e-43
gi|1053067|gb|AAA80680.1| small GTP-binding protein 176 3e-43
gi|7643790|gb|AAF65510.1| small GTP-binding protein [Capsicum an... 176 3e-43
gi|1616614|emb|CAA69701.1| small GTP-binding protein [Nicotiana ... 176 3e-43
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT... 176 3e-43
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi... 176 3e-43
gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] >g... 176 3e-43
gi|134236|sp|P20791|SAS2_DICDI GTP-binding protein SAS2 >gnl|BL_... 176 3e-43
gi|5902803|sp|P28188|ARA5_ARATH Ras-related protein ARA-5 >gnl|B... 176 4e-43
gi|29789271|ref|NP_112354.1| RAB13 [Rattus norvegicus] >gnl|BL_O... 176 4e-43
gi|15217622|ref|NP_171715.1| Ras-related protein (ARA-5) / small... 176 4e-43
gi|7710086|ref|NP_057885.1| RAB10, member RAS oncogene family [M... 176 4e-43
gi|349484|gb|AAA18826.1| GTP-binding protein homologue 176 4e-43
gi|47222415|emb|CAG12935.1| unnamed protein product [Tetraodon n... 176 4e-43
gi|134228|sp|P20790|SAS1_DICDI GTP-binding protein SAS1 >gnl|BL_... 176 4e-43
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy... 176 4e-43
gi|21311975|ref|NP_080953.1| RAS-associated protein RAB13 [Mus m... 175 6e-43
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens] 175 6e-43
gi|23463313|ref|NP_695229.1| GTPase Rab8b [Rattus norvegicus] >g... 175 6e-43
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni... 175 6e-43
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R... 175 6e-43
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni... 175 6e-43
gi|50752811|ref|XP_413757.1| PREDICTED: similar to GTPase Rab8b ... 175 6e-43
gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ... 175 7e-43
gi|50540198|ref|NP_001002566.1| zgc:92757 [Danio rerio] >gnl|BL_... 175 7e-43
gi|1370162|emb|CAA66447.1| RAB1A [Lotus corniculatus var. japoni... 175 7e-43
gi|34906164|ref|NP_914429.1| putative GTP-binding protein [Oryza... 175 7e-43
gi|12843097|dbj|BAB25858.1| unnamed protein product [Mus musculus] 175 7e-43
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor... 174 1e-42
gi|17737663|ref|NP_524172.1| CG8287-PA [Drosophila melanogaster]... 174 1e-42
gi|2500073|sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1 >gnl|B... 174 1e-42
gi|541948|pir||S39565 GTP-binding protein rab1 - soybean >gnl|BL... 174 1e-42
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B... 174 1e-42
gi|47209142|emb|CAF90455.1| unnamed protein product [Tetraodon n... 174 1e-42
gi|131804|sp|P24409|RB10_CANFA Ras-related protein Rab-10 >gnl|B... 174 1e-42
gi|479442|pir||S33900 GTP-binding protein ypt2 - tomato >gnl|BL_... 174 1e-42
gi|18422766|ref|NP_568678.1| Ras-related GTP-binding protein, pu... 174 1e-42
gi|7706563|ref|NP_057614.1| RAB8B, member RAS oncogene family; R... 174 1e-42
gi|466172|sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2 >gnl|BL... 174 1e-42
gi|17737369|ref|NP_523419.1| CG17060-PA [Drosophila melanogaster... 174 1e-42
gi|466171|sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 >gnl|BL_... 174 2e-42
gi|17509233|ref|NP_491857.1| RAB family member (22.7 kD) (rab-10... 174 2e-42
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g... 174 2e-42
gi|29841143|gb|AAP06156.1| similar to NM_070996 RAS-related prot... 173 2e-42
gi|32492050|gb|AAP85297.1| Rab1b [Babesia bovis] 173 2e-42
gi|1053063|gb|AAA80678.1| small GTP-binding protein 173 2e-42
gi|48104721|ref|XP_392967.1| similar to CG3320-PA [Apis mellifera] 173 2e-42
gi|15242773|ref|NP_195972.1| Ras-related GTP-binding protein, pu... 173 2e-42
gi|50604253|gb|AAH78133.1| Unknown (protein for MGC:84543) [Xeno... 173 3e-42
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL... 173 3e-42
gi|18447915|dbj|BAB84323.1| ras-related protein RAB8-2 [Nicotian... 173 3e-42
gi|33695095|ref|NP_057215.2| ras-related GTP-binding protein RAB... 173 3e-42
gi|19920864|ref|NP_609094.1| CG9100-PB [Drosophila melanogaster]... 172 4e-42
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1... 172 4e-42
gi|82803|pir||S04590 GTP-binding protein ypt1 - fission yeast (... 172 4e-42
gi|15077428|gb|AAK83158.1| small GTP-binding protein Ypt1p [Cand... 172 4e-42
gi|31243023|ref|XP_321946.1| ENSANGP00000013866 [Anopheles gambi... 172 4e-42
gi|420269|pir||B42148 GTP-binding protein rab10 - rat 172 4e-42
gi|49074658|ref|XP_401448.1| YPT1_NEUCR GTP-binding protein ypt1... 172 4e-42
gi|50550177|ref|XP_502561.1| hypothetical protein [Yarrowia lipo... 172 5e-42
gi|7438392|pir||T14391 GTP-binding protein homolog - turnip >gnl... 172 5e-42
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn... 172 5e-42
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip... 172 5e-42
gi|19112997|ref|NP_596205.1| ypt1-related protein 1 [Schizosacch... 172 6e-42
gi|303732|dbj|BAA02117.1| GTP-binding protein [Pisum sativum] >g... 172 6e-42
gi|39595692|emb|CAE67195.1| Hypothetical protein CBG12631 [Caeno... 172 6e-42
gi|11558500|emb|CAC17744.1| small GTP-binding protein YPTI [Hypo... 171 8e-42
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]... 171 8e-42
gi|15229836|ref|NP_187779.1| Ras-related GTP-binding protein, pu... 171 8e-42
gi|21592670|gb|AAM64619.1| putative Ras-like GTP-binding protein... 171 8e-42
gi|50259473|gb|EAL22146.1| hypothetical protein CNBC2840 [Crypto... 171 8e-42
gi|38109427|gb|EAA55305.1| hypothetical protein MG06962.4 [Magna... 171 1e-41
gi|15232784|ref|NP_187601.1| Ras-related GTP-binding protein, pu... 171 1e-41
gi|47223089|emb|CAG07176.1| unnamed protein product [Tetraodon n... 171 1e-41
gi|41152205|ref|NP_958486.1| RAB13, member RAS oncogene family [... 171 1e-41
gi|31241057|ref|XP_320947.1| ENSANGP00000017643 [Anopheles gambi... 171 1e-41
gi|1370198|emb|CAA98176.1| RAB8E [Lotus corniculatus var. japoni... 171 1e-41
gi|421942|pir||S34253 GTP-binding protein, ras-related - common ... 171 1e-41
gi|2808638|emb|CAA04701.1| small GTP-binding protein [Daucus car... 171 1e-41
gi|31204497|ref|XP_311197.1| ENSANGP00000019091 [Anopheles gambi... 171 1e-41
gi|33146687|dbj|BAC80082.1| putative ethylene-responsive small G... 170 2e-41
gi|47225841|emb|CAF98321.1| unnamed protein product [Tetraodon n... 170 2e-41
gi|15235980|ref|NP_193449.1| Ras-related GTP-binding protein, pu... 170 2e-41
gi|50256143|gb|EAL18870.1| hypothetical protein CNBI1310 [Crypto... 170 2e-41
gi|18447917|dbj|BAB84324.1| ras-related protein RAB8-3 [Nicotian... 170 2e-41
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian... 170 2e-41
gi|1370190|emb|CAA98172.1| RAB8A [Lotus corniculatus var. japoni... 170 2e-41
gi|131847|sp|P22127|RB10_DISOM Ras-related protein Rab-10 (ORA1)... 170 2e-41
gi|29124128|gb|AAO65869.1| ethylene-responsive small GTP-binding... 170 2e-41
gi|1362067|pir||S57478 GTP-binding protein GTP13 - garden pea >g... 170 2e-41
gi|3024527|sp|Q39433|RAB1_BETVU Ras-related protein RAB1BV >gnl|... 170 2e-41
gi|38194437|gb|AAR13228.1| Rab family GTPase Rab8 [Fucus distichus] 170 2e-41
gi|15238542|ref|NP_200792.1| Ras-related GTP-binding family prot... 170 2e-41
gi|47900325|gb|AAT39172.1| putative GTP-binding protein [Oryza s... 170 2e-41
gi|15231847|ref|NP_190929.1| Ras-related GTP-binding protein, pu... 170 2e-41
gi|40225607|gb|AAH09227.2| RAB13 protein [Homo sapiens] 169 3e-41
gi|1370196|emb|CAA98175.1| RAB8D [Lotus corniculatus var. japoni... 169 3e-41
gi|131848|sp|P22128|RAB8_DISOM Ras-related protein Rab-8 (ORA2) ... 169 4e-41
gi|1362065|pir||S57462 GTP-binding protein GTP11 - garden pea >g... 169 5e-41
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge... 169 5e-41
gi|34853590|ref|XP_229401.2| similar to Ras-related protein Rab-... 169 5e-41
gi|1370194|emb|CAA98174.1| RAB8C [Lotus corniculatus var. japoni... 168 7e-41
gi|81634|pir||PS0279 GTP-binding protein ara-5 - Arabidopsis tha... 168 7e-41
gi|5764095|gb|AAD51132.1| small GTP-binding protein rab1 [Theile... 168 7e-41
gi|15231322|ref|NP_190192.1| Ras-related protein (ARA-3) / small... 168 7e-41
gi|7438394|pir||T14405 small GTP-binding protein rab-1 - turnip ... 168 7e-41
gi|217841|dbj|BAA00832.1| small GTP-binding protein [Arabidopsis... 168 9e-41
gi|7438439|pir||T07609 GTP-binding protein SYPT - soybean >gnl|B... 168 9e-41
gi|18447921|dbj|BAB84326.1| ras-related protein RAB8-5 [Nicotian... 168 9e-41
gi|47225370|emb|CAG11853.1| unnamed protein product [Tetraodon n... 167 1e-40
gi|5669640|gb|AAD46405.1| ethylene-responsive small GTP-binding ... 167 1e-40
gi|49074732|ref|XP_401480.1| hypothetical protein UM03865.1 [Ust... 167 1e-40
gi|38303826|gb|AAH61984.1| Rab26 protein [Rattus norvegicus] 167 2e-40
gi|46326983|gb|AAS88430.1| ethylene-responsive small GTP-binding... 167 2e-40
gi|103724|pir||B38625 GTP-binding protein ora2 - electric ray (D... 167 2e-40
gi|39591868|emb|CAE71446.1| Hypothetical protein CBG18357 [Caeno... 167 2e-40
gi|17555898|ref|NP_499328.1| RAB family member (rab-30) [Caenorh... 167 2e-40
gi|2500074|sp|Q39570|YPT4_CHLRE GTP-binding protein YPTC4 >gnl|B... 166 4e-40
gi|15233367|ref|NP_195311.1| Ras-related GTP-binding protein, pu... 165 6e-40
gi|1370164|emb|CAA98159.1| RAB1B [Lotus corniculatus var. japoni... 165 8e-40
gi|38082075|ref|XP_283428.2| RAB26, member RAS oncogene family [... 164 1e-39
gi|32492048|gb|AAP85296.1| Rab1a [Babesia bovis] 164 1e-39
gi|5738166|gb|AAD50280.1| putative intermediate compartment prot... 164 1e-39
gi|50308977|ref|XP_454494.1| unnamed protein product [Kluyveromy... 164 1e-39
gi|464525|sp|P34140|RB1B_DICDI Ras-related protein Rab1B >gnl|BL... 164 2e-39
gi|1016750|gb|AAA79138.1| rab-related GTP-binding protein 164 2e-39
gi|549811|sp|P36863|YPT4_VOLCA GTP-binding protein yptV4 (RAB2 h... 163 2e-39
gi|23479748|gb|EAA16491.1| putative GTPase [Plasmodium yoelii yo... 163 2e-39
gi|6688535|emb|CAB65172.1| Rab11 GTPase [Lycopersicon esculentum] 163 3e-39
gi|44890744|gb|AAH66913.1| RAB26, member RAS oncogene family [Ho... 163 3e-39
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B... 163 3e-39
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi... 162 4e-39
gi|26892279|gb|AAN86142.1| RAB2B [Homo sapiens] 162 4e-39
gi|16755592|gb|AAL28022.1| small GTPase Rab2 [Nicotiana tabacum] 162 4e-39
gi|1362064|pir||S57474 GTP-binding protein - garden pea >gnl|BL_... 162 5e-39
gi|49257196|gb|AAH71068.1| Unknown (protein for MGC:78967) [Xeno... 162 5e-39
gi|549809|sp|P36861|YPT2_VOLCA GTP-binding protein yptV2 >gnl|BL... 162 5e-39
gi|21361884|ref|NP_116235.2| RAB2B protein; RAS family, member R... 162 5e-39
gi|46359909|gb|AAS88841.1| putative GTP-binding protein [Oryza s... 162 5e-39
gi|50751596|ref|XP_422470.1| PREDICTED: similar to RAB3C, member... 162 6e-39
gi|8394124|ref|NP_059055.1| ras-related protein rab10 [Rattus no... 162 6e-39
gi|17507539|ref|NP_491233.1| RAB family member (23.6 kD) (rab-2)... 162 6e-39
gi|27675132|ref|XP_223991.1| similar to Ras-related protein Rab-... 161 8e-39
gi|46361978|ref|NP_055168.2| RAB26, member RAS oncogene family [... 161 8e-39
gi|33873723|gb|AAH07681.2| RAB26 protein [Homo sapiens] 161 8e-39
gi|50539696|ref|NP_001002318.1| zgc:86635 [Danio rerio] >gnl|BL_... 161 1e-38
gi|49257826|gb|AAH74632.1| Unknown (protein for MGC:69558) [Xeno... 161 1e-38
gi|32451720|gb|AAH54719.1| Unknown (protein for MGC:64765) [Mus ... 161 1e-38
gi|267527|sp|Q01111|YPT3_NICPL Ras-related protein YPT3 >gnl|BL_... 161 1e-38
gi|3024502|sp|Q40194|R11D_LOTJA Ras-related protein Rab11D >gnl|... 161 1e-38
gi|4837727|gb|AAD30658.1| small GTP binding protein Rab2 [Sporob... 161 1e-38
gi|30525051|ref|NP_766189.1| RAB2B protein [Mus musculus] >gnl|B... 161 1e-38
gi|25294107|pir||JC7589 Sec4p homolog - yeast (Pichia pastoris) ... 161 1e-38
gi|48096697|ref|XP_392500.1| similar to Ras-related protein Rab-... 161 1e-38
gi|20139581|sp|Q96AX2|RB37_HUMAN Ras-related protein Rab-37 >gnl... 160 1e-38
gi|17568765|ref|NP_510572.1| RAB family member (23.4 kD) (rab-14... 160 1e-38
gi|464523|sp|P34139|RB1A_DICDI Ras-related protein Rab1A >gnl|BL... 160 1e-38
gi|34882806|ref|XP_229263.2| similar to Ras-related protein Rab-... 160 1e-38
gi|548666|sp|P36410|RAB4_DICDI Ras-related protein Rab4 >gnl|BL_... 160 1e-38
gi|6517192|dbj|BAA87878.1| Drab2 [Drosophila melanogaster] 160 1e-38
gi|7438379|pir||E71440 GTP-binding protein RAB2A - Arabidopsis t... 160 1e-38
gi|15235981|ref|NP_193450.1| Rab2-like GTP-binding protein (RAB2... 160 1e-38
gi|1370176|emb|CAA98165.1| RAB2A [Lotus corniculatus var. japoni... 160 1e-38
gi|39586261|emb|CAE66672.1| Hypothetical protein CBG12011 [Caeno... 160 1e-38
gi|30583917|gb|AAP36207.1| Homo sapiens RAB3D, member RAS oncoge... 160 2e-38
gi|4759000|ref|NP_004274.1| RAB3D, member RAS oncogene family; R... 160 2e-38
gi|32401324|gb|AAP80834.1| GTP-binding protein [Griffithsia japo... 160 2e-38
gi|27696356|gb|AAH43857.1| Rab3d protein [Xenopus laevis] 160 2e-38
gi|49257746|gb|AAH74589.1| Unknown (protein for MGC:69316) [Xeno... 160 2e-38
gi|15221477|ref|NP_172128.1| Ras-related GTP-binding protein (AR... 160 2e-38
gi|4506365|ref|NP_002856.1| RAB2, member RAS oncogene family [Ho... 160 2e-38
gi|10946940|ref|NP_067493.1| RAB2, member RAS oncogene family; G... 160 2e-38
gi|41393075|ref|NP_958862.1| RAB2, member RAS oncogene family [D... 160 2e-38
gi|34849826|gb|AAH58382.1| RAB2, member RAS oncogene family [Mus... 160 2e-38
gi|464526|sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 >gnl|BL... 160 2e-38
gi|266878|sp|Q01971|RB2A_RABIT Ras-related protein Rab-2A >gnl|B... 160 2e-38
gi|45382561|ref|NP_990559.1| GTP-binding protein [Gallus gallus]... 160 2e-38
gi|106185|pir||B34323 GTP-binding protein Rab2 - human >gnl|BL_O... 160 2e-38
gi|1588651|prf||2209256A rab2 gene 160 2e-38
gi|27806111|ref|NP_776871.1| RAB3A, member RAS oncogene family [... 160 2e-38
gi|420272|pir||E42148 GTP-binding protein rab14 - rat 160 2e-38
gi|730512|sp|P40393|RIC2_ORYSA Ras-related protein RIC2 >gnl|BL_... 160 2e-38
gi|13195452|gb|AAK15703.1| GTP-binding protein [Oryza sativa] 160 2e-38
gi|7438438|pir||T04362 GTP-binding protein yptm3 - maize >gnl|BL... 160 2e-38
gi|31212835|ref|XP_315402.1| ENSANGP00000020903 [Anopheles gambi... 160 2e-38
gi|19923985|ref|NP_612462.1| RAB3C, member RAS oncogene family [... 160 2e-38
gi|89584|pir||C29224 GTP-binding protein smg-25C - bovine 160 2e-38
gi|7438425|pir||T07059 GTP-binding protein sra1 - soybean (fragm... 160 2e-38
gi|41393147|ref|NP_958903.1| RAB14, member RAS oncogene family [... 159 3e-38
gi|46806275|dbj|BAD17483.1| putative GTP-binding protein yptm3 [... 159 3e-38
gi|31199873|ref|XP_308884.1| ENSANGP00000012769 [Anopheles gambi... 159 3e-38
gi|50258123|gb|EAL20817.1| hypothetical protein CNBE1790 [Crypto... 159 3e-38
gi|48101226|ref|XP_392651.1| similar to ENSANGP00000020903 [Apis... 159 3e-38
gi|27734452|sp|P59190|RB15_HUMAN Ras-related protein Rab-15 159 4e-38
gi|38454238|ref|NP_942044.1| Ras-related protein Rab-15 [Rattus ... 159 4e-38
gi|18390323|ref|NP_080973.1| RAB14, member RAS oncogene family [... 159 4e-38
gi|16758368|ref|NP_446041.1| GTPase Rab14 [Rattus norvegicus] >g... 159 4e-38
gi|15218719|ref|NP_174177.1| Ras-related GTP-binding protein, pu... 159 4e-38
gi|1346957|sp|P49104|RB2B_MAIZE Ras-related protein Rab-2-B >gnl... 159 4e-38
gi|39596714|emb|CAE63333.1| Hypothetical protein CBG07733 [Caeno... 159 4e-38
gi|13929006|ref|NP_113906.1| RAB2, member RAS oncogene family [R... 159 5e-38
gi|31559981|ref|NP_598811.2| RAB15, member RAS oncogene family [... 159 5e-38
gi|29841087|gb|AAP06100.1| similar to GenBank Accession Number A... 159 5e-38
gi|46575955|gb|AAT01316.1| putative GTP-binding protein RIC2 [Or... 159 5e-38
gi|18034781|ref|NP_542147.1| RAB3D, member RAS oncogene family [... 159 5e-38
gi|17647849|ref|NP_523777.1| CG4921-PB [Drosophila melanogaster]... 159 5e-38
gi|23508994|ref|NP_701662.1| Rab2 GTPase, putative [Plasmodium f... 159 5e-38
gi|17137088|ref|NP_477090.1| CG3269-PA [Drosophila melanogaster]... 159 5e-38
gi|19424194|ref|NP_598220.1| RAB3C, member RAS oncogene family [... 159 5e-38
gi|17737457|ref|NP_523687.1| CG7576-PA [Drosophila melanogaster]... 158 7e-38
gi|6679593|ref|NP_033027.1| RAB3A, member RAS oncogene family [M... 158 7e-38
gi|4506367|ref|NP_002857.1| RAB3A, member RAS oncogene family; R... 158 7e-38
gi|6981452|ref|NP_037150.1| RAB3A, member RAS oncogene family; R... 158 7e-38
gi|89582|pir||A29224 GTP-binding protein smg-25A - bovine 158 7e-38
gi|41053455|ref|NP_956977.1| hypothetical protein MGC63643 [Dani... 158 7e-38
gi|50540122|ref|NP_001002530.1| zgc:92916 [Danio rerio] >gnl|BL_... 158 7e-38
gi|31210411|ref|XP_314172.1| ENSANGP00000015837 [Anopheles gambi... 158 7e-38
gi|13397937|emb|CAC34627.1| putative Rab2 GTPase [Plasmodium fal... 158 7e-38
gi|23480789|gb|EAA17254.1| putative Rab2 GTPase [Plasmodium yoel... 158 7e-38
gi|13470090|ref|NP_076341.1| RAB3C, member RAS oncogene family [... 158 7e-38
gi|12837642|dbj|BAB23894.1| unnamed protein product [Mus musculus] 158 7e-38
gi|7677422|gb|AAF67162.1| GTPase Rab37 [Mus musculus] >gnl|BL_OR... 158 9e-38
gi|1045640|gb|AAC52704.1| rab3c 158 9e-38
gi|19424272|ref|NP_598264.1| RAB26, member RAS oncogene family [... 158 9e-38
gi|3024500|sp|Q40191|R11A_LOTJA Ras-related protein Rab11A >gnl|... 158 9e-38
gi|15219955|ref|NP_173136.1| Ras-related GTP-binding protein, pu... 158 9e-38
gi|15230422|ref|NP_187823.1| Ras-related GTP-binding family prot... 158 9e-38
gi|7438383|pir||S71559 GTP-binding protein rab2 - soybean >gnl|B... 158 9e-38
gi|3024528|sp|Q39434|RAB2_BETVU Ras-related protein Rab2BV >gnl|... 158 9e-38
gi|15224226|ref|NP_181842.1| Ras-related protein (ARA-4) / small... 158 9e-38
gi|15042957|ref|NP_114080.2| RAB3D, member RAS oncogene family [... 157 1e-37
gi|346947|pir||A45384 GTP-binding protein rab3D - mouse 157 1e-37
gi|38524287|emb|CAD57744.1| RAB-like small G-protein [Hordeum vu... 157 1e-37
gi|14318517|ref|NP_116650.1| Secretory vesicle associated Rab GT... 157 1e-37
gi|14423577|gb|AAK62471.1| small GTP-binding protein Rab8 [Entam... 157 1e-37
gi|31205793|ref|XP_311848.1| ENSANGP00000018202 [Anopheles gambi... 157 2e-37
gi|3334326|sp|O14462|SEC4_CANAL Ras-related protein SEC4 >gnl|BL... 157 2e-37
gi|47217500|emb|CAG10880.1| unnamed protein product [Tetraodon n... 157 2e-37
gi|7438437|pir||T03767 GTP-binding protein rab2 - rice >gnl|BL_O... 157 2e-37
gi|7689363|gb|AAF67748.1| GTP-binding protein RAB3A [Homo sapiens] 157 2e-37
gi|1083775|pir||JC2528 GTP-binding protein Rab26 - rat 157 2e-37
gi|34897394|ref|NP_910043.1| Ras-related GTP-binding protein [Or... 157 2e-37
gi|23490566|gb|EAA22313.1| Rab1 protein [Plasmodium yoelii yoelii] 157 2e-37
gi|28556900|dbj|BAC57527.1| GTP-binding protein rab-2 homologue ... 157 2e-37
gi|50258203|gb|EAL20897.1| hypothetical protein CNBE2580 [Crypto... 157 2e-37
gi|1346956|sp|P49103|RB2A_MAIZE Ras-related protein Rab-2-A >gnl... 157 2e-37
gi|26335369|dbj|BAC31385.1| unnamed protein product [Mus musculus] 156 3e-37
gi|20129057|ref|NP_608373.1| CG9575-PA [Drosophila melanogaster]... 156 3e-37
gi|21555752|gb|AAM63927.1| guanine nucleotide regulatory protein... 156 3e-37
gi|28376635|ref|NP_783865.1| RAB37, member RAS oncogene family; ... 156 3e-37
gi|3024505|sp|Q40522|R11D_TOBAC Ras-related protein Rab11D >gnl|... 156 3e-37
gi|549810|sp|P36862|YPT3_VOLCA GTP-binding protein yptV3 >gnl|BL... 156 4e-37
gi|50755689|ref|XP_414855.1| PREDICTED: similar to RAB26, member... 156 4e-37
gi|38344743|emb|CAE03047.2| OSJNBa0089K21.1 [Oryza sativa (japon... 156 4e-37
gi|50582491|dbj|BAD32700.1| Rab3 [Loligo pealei] 155 5e-37
gi|4930237|pdb|3RAB|A Chain A, Gppnhp-Bound Rab3a At 2.0 A Resol... 155 5e-37
gi|47216418|emb|CAG01969.1| unnamed protein product [Tetraodon n... 155 5e-37
gi|106187|pir||D34323 GTP-binding protein Rab3B - human >gnl|BL_... 155 5e-37
gi|15231462|ref|NP_187397.1| Ras-related GTP-binding family prot... 155 5e-37
gi|45360657|ref|NP_989002.1| hypothetical protein MGC75714 [Xeno... 155 5e-37
gi|7438430|pir||T06445 GTP-binding protein - garden pea >gnl|BL_... 155 5e-37
gi|5738168|gb|AAD50281.1| putative intermediate compartment prot... 155 5e-37
gi|6624302|dbj|BAA88497.1| small GTP-binding protein [Carica pap... 155 5e-37
gi|47219617|emb|CAG02662.1| unnamed protein product [Tetraodon n... 155 5e-37
gi|45201075|ref|NP_986645.1| AGL021Wp [Eremothecium gossypii] >g... 155 6e-37
gi|1845598|gb|AAB47925.1| Rab3 [Loligo pealei] 155 6e-37
gi|50370044|gb|AAH75980.1| Unknown (protein for MGC:92276) [Dani... 155 6e-37
gi|19923750|ref|NP_002858.2| RAB3B, member RAS oncogene family; ... 155 6e-37
gi|31745716|gb|AAP57202.1| Rab11 [Toxoplasma gondii] 155 6e-37
gi|50287271|ref|XP_446065.1| unnamed protein product [Candida gl... 155 6e-37
gi|28875789|ref|NP_789862.1| RAB3C, member RAS oncogene family; ... 155 6e-37
gi|23503094|sp|P10949|RB3C_BOVIN Ras-related protein Rab-3C (SMG... 155 6e-37
gi|15238392|ref|NP_201330.1| Ras-related GTP-binding family prot... 155 6e-37
gi|47224370|emb|CAG09216.1| unnamed protein product [Tetraodon n... 155 6e-37
gi|32398960|emb|CAD98425.1| rab1a protein, probable [Cryptospori... 155 6e-37
gi|29841146|gb|AAP06159.1| similar to NM_078963 GTP-binding prot... 155 6e-37
gi|3024503|sp|Q40520|R11C_TOBAC Ras-related protein Rab11C >gnl|... 155 6e-37
gi|19114579|ref|NP_593667.1| YPT1-related rab subfamily protein ... 155 6e-37
gi|31543568|ref|NP_067386.2| RAB37, member of RAS oncogene famil... 155 8e-37
gi|28572143|ref|NP_524432.4| CG3320-PB [Drosophila melanogaster]... 155 8e-37
gi|13592037|ref|NP_112353.1| Rab3B protein [Rattus norvegicus] >... 155 8e-37
gi|31209781|ref|XP_313857.1| ENSANGP00000024287 [Anopheles gambi... 155 8e-37
gi|7438433|pir||T06448 GTP-binding protein - garden pea >gnl|BL_... 155 8e-37
gi|34909538|ref|NP_916116.1| putative GTP-binding protein [Oryza... 155 8e-37
gi|46577634|sp|P61017|RB4B_CANFA Ras-related protein Rab-4B >gnl... 155 8e-37
gi|7508349|pir||T28972 hypothetical protein T23H2.6 - Caenorhabd... 155 8e-37
gi|3024501|sp|Q40193|R11C_LOTJA Ras-related protein Rab11C >gnl|... 155 8e-37
gi|3024506|sp|Q40523|R11A_TOBAC Ras-related protein Rab11A >gnl|... 155 8e-37
gi|7438404|pir||T03626 GTP-binding protein Rab11e - common tobac... 155 8e-37
gi|28574179|ref|NP_788057.1| CG4212-PC [Drosophila melanogaster]... 154 1e-36
gi|30354316|gb|AAH51918.1| Rab3b protein [Mus musculus] 154 1e-36
gi|27806113|ref|NP_776872.1| RAB3B, member RAS oncogene family [... 154 1e-36
gi|12963723|ref|NP_076026.1| RAB3B, member RAS oncogene family [... 154 1e-36
gi|46561764|gb|AAT01087.1| putative rab11 [Homalodisca coagulata] 154 1e-36
gi|17137218|ref|NP_477171.1| CG4212-PA [Drosophila melanogaster]... 154 1e-36
gi|22597170|gb|AAN03472.1| GTP-binding protein [Glycine max] 154 1e-36
gi|28574177|ref|NP_788056.1| CG4212-PB [Drosophila melanogaster]... 154 1e-36
gi|23613161|ref|NP_703483.1| Rab1 protein [Plasmodium falciparum... 154 1e-36
gi|4585808|emb|CAB40900.1| putative Rab1A protein [Plasmodium fa... 154 1e-36
gi|34908298|ref|NP_915496.1| Ras-related GTP-binding protein [Or... 154 1e-36
gi|38051907|gb|AAH60562.1| Unknown (protein for MGC:72799) [Ratt... 154 1e-36
gi|1370154|emb|CAA98183.1| RAB11G [Lotus corniculatus var. japon... 154 1e-36
gi|1370156|emb|CAA98184.1| RAB11H [Lotus corniculatus var. japon... 154 1e-36
gi|3024529|sp|Q40195|R11E_LOTJA Ras-related protein Rab11E >gnl|... 154 1e-36
gi|48103608|ref|XP_392879.1| similar to ENSANGP00000012769 [Apis... 154 1e-36
gi|2342660|gb|AAB67800.1| GTP-binding protein sprab3 [Strongyloc... 154 1e-36
gi|6321228|ref|NP_011305.1| probably involved in intra-Golgi tra... 154 1e-36
gi|39595276|emb|CAE60313.1| Hypothetical protein CBG03904 [Caeno... 154 1e-36
gi|25012906|gb|AAN71540.1| RH21315p [Drosophila melanogaster] 154 1e-36
gi|50753230|ref|XP_413914.1| PREDICTED: similar to RAB11a, membe... 154 2e-36
gi|34913324|ref|NP_918009.1| putative Rab GTP-binding protein Ra... 154 2e-36
gi|392973|gb|AAA03315.1| Rab3 154 2e-36
gi|1076457|pir||S52024 GTP-binding protein bra - rape >gnl|BL_OR... 154 2e-36
gi|50285709|ref|XP_445283.1| unnamed protein product [Candida gl... 154 2e-36
gi|22597172|gb|AAN03473.1| small GTP-binding protein [Glycine max] 154 2e-36
gi|15233873|ref|NP_193578.1| Ras-related GTP-binding protein, pu... 154 2e-36
gi|50418486|gb|AAH77124.1| Unknown (protein for MGC:100812) [Dan... 154 2e-36
gi|13785146|emb|CAA72626.2| rab4A-like protein [Trichinella pseu... 154 2e-36
gi|26337951|dbj|BAC32661.1| unnamed protein product [Mus musculus] 154 2e-36
gi|21361509|ref|NP_057238.2| ras-related GTP-binding protein 4b ... 154 2e-36
gi|15226182|ref|NP_180943.1| Ras-related GTP-binding protein, pu... 153 2e-36
gi|15225121|ref|NP_180726.1| Ras-related GTP-binding protein, pu... 153 2e-36
gi|7438428|pir||T06443 GTP-binding protein - garden pea >gnl|BL_... 153 2e-36
gi|37545057|ref|XP_113967.2| similar to Rab12 protein [Homo sapi... 153 2e-36
gi|49256375|gb|AAH74481.1| Unknown (protein for MGC:84786) [Xeno... 153 2e-36
gi|7438432|pir||T06447 GTP-binding protein - garden pea >gnl|BL_... 153 2e-36
gi|283769|pir||A43958 GTP-binding protein, synaptic vesicle spec... 153 2e-36
gi|8394136|ref|NP_059051.1| ras-related GTP-binding protein 4b [... 153 2e-36
gi|17507543|ref|NP_490675.1| RAB family member (23.4 kD) (rab-11... 153 2e-36
gi|39584751|emb|CAE67646.1| Hypothetical protein CBG13205 [Caeno... 153 2e-36
gi|17137216|ref|NP_477170.1| CG5771-PB [Drosophila melanogaster]... 153 2e-36
gi|34910940|ref|NP_916817.1| putative GTP-binding protein [Oryza... 153 3e-36
gi|1546067|gb|AAB08102.1| GTPase SUrab10p [Strongylocentrotus pu... 153 3e-36
gi|30584069|gb|AAP36283.1| Homo sapiens RAB11A, member RAS oncog... 153 3e-36
gi|15239462|ref|NP_200894.1| Ras-related GTP-binding protein, pu... 153 3e-36
gi|31324876|gb|AAP48704.1| rab11-2 [Limulus polyphemus] 153 3e-36
gi|46559001|emb|CAG27070.1| small GTPase [Medicago sativa] 153 3e-36
gi|1613773|gb|AAB16753.1| Rab1 153 3e-36
gi|50424201|ref|XP_460687.1| unnamed protein product [Debaryomyc... 153 3e-36
gi|4758984|ref|NP_004654.1| Ras-related protein Rab-11A; RAB 11A... 153 3e-36
gi|7108528|gb|AAF36458.1| small GTPase [Mus musculus] 153 3e-36
gi|3025293|sp|Q39572|YPT6_CHLRE Ras-related protein YPTC6 >gnl|B... 153 3e-36
gi|15234020|ref|NP_193615.1| Ras-related GTP-binding family prot... 153 3e-36
gi|41469625|gb|AAS07348.1| putative GTP-binding protein [Oryza s... 152 4e-36
gi|1184985|gb|AAA87884.1| ATGB3 [Arabidopsis thaliana] 152 4e-36
gi|15236099|ref|NP_195709.1| Ras-related GTP-binding protein, pu... 152 4e-36
gi|21617896|gb|AAM66946.1| GTP-binding protein GB3 [Arabidopsis ... 152 4e-36
gi|17862462|gb|AAL39708.1| LD29476p [Drosophila melanogaster] 152 4e-36
gi|34365467|emb|CAE46061.1| hypothetical protein [Homo sapiens] 152 4e-36
gi|15237828|ref|NP_200723.1| Ras-related GTP-binding protein, pu... 152 4e-36
gi|15242483|ref|NP_199387.1| Ras-related GTP-binding protein, pu... 152 4e-36
gi|1710015|sp|P51152|RB12_CANFA Ras-related protein Rab-12 >gnl|... 152 4e-36
gi|26341800|dbj|BAC34562.1| unnamed protein product [Mus musculus] 152 4e-36
gi|5714658|gb|AAD48018.1| Rab GTP-binding protein Rab11a [Gossyp... 152 5e-36
gi|50540426|ref|NP_001002679.1| zgc:86892 [Danio rerio] >gnl|BL_... 152 5e-36
gi|12230537|sp|Q9ULW5|RB26_HUMAN Ras-related protein Rab-26 >gnl... 152 5e-36
gi|541979|pir||S41431 GTP-binding protein, ras-like - fava bean ... 152 5e-36
gi|46485881|gb|AAS98506.1| putative GTP-binding protein Rab11 [O... 152 5e-36
gi|131849|sp|P22129|R11B_DISOM Ras-related protein Rab-11B (ORA3... 152 5e-36
gi|24649793|ref|NP_733043.1| CG31118-PA [Drosophila melanogaster... 152 5e-36
gi|5926718|dbj|BAA84640.1| PRA2 [Pisum sativum] 152 7e-36
gi|47217560|emb|CAG02487.1| unnamed protein product [Tetraodon n... 152 7e-36
gi|50760924|ref|XP_418183.1| PREDICTED: similar to GTP-binding p... 152 7e-36
gi|50511479|gb|AAT77401.1| putative GTP-binding protein [Oryza s... 152 7e-36
gi|3024552|sp|Q40723|RGP2_ORYSA Ras-related protein RGP2 (GTP-bi... 152 7e-36
gi|15217568|ref|NP_172434.1| Ras-related GTP-binding protein, pu... 152 7e-36
gi|14249144|ref|NP_116006.1| RAB11B, member RAS oncogene family ... 152 7e-36
gi|49456343|emb|CAG46492.1| RAB11B [Homo sapiens] 152 7e-36
gi|6679583|ref|NP_033023.1| RAB11B, member RAS oncogene family [... 152 7e-36
gi|5803135|ref|NP_006852.1| RAB35, member RAS oncogene family; r... 152 7e-36
gi|42543202|pdb|1OIV|A Chain A, X-Ray Structure Of The Small G P... 152 7e-36
gi|7438429|pir||T06444 GTP-binding protein - garden pea (fragmen... 152 7e-36
gi|14573837|gb|AAK68195.1| Rab family protein 3, isoform a [Caen... 151 9e-36
gi|560504|emb|CAA82710.1| guanine nucleotide regulatory protein ... 151 9e-36
gi|17535675|ref|NP_495129.1| RAB family member, small GTP-bindin... 151 9e-36
gi|50540176|ref|NP_001002555.1| zgc:92772 [Danio rerio] >gnl|BL_... 151 9e-36
gi|47216427|emb|CAG01978.1| unnamed protein product [Tetraodon n... 151 9e-36
gi|4758986|ref|NP_004209.1| RAB11B, member RAS oncogene family; ... 151 9e-36
gi|37788825|gb|AAP51290.1| Rab11-1a [Limulus polyphemus] >gnl|BL... 151 9e-36
gi|15238115|ref|NP_199563.1| Ras-related GTP-binding protein, pu... 151 9e-36
gi|17559534|ref|NP_507083.1| GTP-binding protein like (5Q673) [C... 151 9e-36
gi|33150586|gb|AAP97171.1| rab4b [Homo sapiens] 151 9e-36
gi|7496249|pir||T15546 hypothetical protein C18A3.6 - Caenorhabd... 151 9e-36
gi|12084567|pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanos... 151 1e-35
gi|47216652|emb|CAG04850.1| unnamed protein product [Tetraodon n... 151 1e-35
gi|37788823|gb|AAP51289.1| Rab11-1c [Limulus polyphemus] 151 1e-35
gi|3024504|sp|Q40521|R11B_TOBAC Ras-related protein Rab11B >gnl|... 151 1e-35
gi|15232477|ref|NP_188124.1| Ras-related GTP-binding family prot... 151 1e-35
gi|38303943|gb|AAH62016.1| Unknown (protein for MGC:72520) [Ratt... 151 1e-35
gi|34784624|gb|AAH57747.1| MGC69101 protein [Xenopus laevis] 151 1e-35
gi|17555956|ref|NP_499454.1| RAB family member (23.4 kD) (rab-35... 151 1e-35
gi|39596953|emb|CAE59180.1| Hypothetical protein CBG02488 [Caeno... 150 1e-35
gi|1279542|emb|CAA95859.1| small GTPase [Mangifera indica] 150 1e-35
gi|19923260|ref|NP_004569.2| RAB4A, member RAS oncogene family; ... 150 1e-35
gi|50741401|ref|XP_419573.1| PREDICTED: similar to RAB4A, member... 150 1e-35
gi|49168476|emb|CAG38733.1| RAB11B [Homo sapiens] 150 1e-35
gi|4557959|pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector ... 150 1e-35
gi|29337213|sp|P20338|RB4A_HUMAN Ras-related protein Rab-4A 150 1e-35
gi|131793|sp|P05714|RB4A_RAT Ras-related protein Rab-4A >gnl|BL_... 150 1e-35
gi|15986733|gb|AAL11725.1| GTP-binding protein RAB4 [Mus musculus] 150 1e-35
gi|31208277|ref|XP_313105.1| ENSANGP00000012897 [Anopheles gambi... 150 1e-35
gi|47216650|emb|CAG04848.1| unnamed protein product [Tetraodon n... 150 1e-35
gi|42561732|ref|NP_563750.2| Ras-related protein (ARA-1) (ARA) /... 150 2e-35
gi|15489394|gb|AAH13790.1| Rab15 protein [Mus musculus] 150 2e-35
gi|32492052|gb|AAP85298.1| Rab2 [Babesia bovis] 150 2e-35
gi|27370881|gb|AAH41250.1| Rab11b-prov protein [Xenopus laevis] 150 2e-35
gi|47550807|ref|NP_999935.1| zgc:55760 [Danio rerio] >gnl|BL_ORD... 150 2e-35
gi|49671143|gb|AAH75268.1| Unknown (protein for MGC:88884) [Xeno... 150 2e-35
gi|114085|sp|P19892|ARA1_ARATH Ras-related protein ARA-1 >gnl|BL... 150 2e-35
gi|6679595|ref|NP_033029.1| RAB4A, member RAS oncogene family [M... 150 2e-35
gi|9719734|gb|AAF97836.1| Contains similarity to ras-related GTP... 150 2e-35
gi|15221005|ref|NP_173258.1| Ras-related GTP-binding family prot... 150 2e-35
gi|12084563|pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp >g... 150 3e-35
gi|12322015|gb|AAG51053.1| ras-related GTP-binding protein, puta... 150 3e-35
gi|49333370|gb|AAT64010.1| putative GTP-binding protein [Gossypi... 150 3e-35
gi|46431579|gb|EAK91125.1| hypothetical protein CaO19.10153 [Can... 150 3e-35
gi|15222396|ref|NP_172221.1| Ras-related GTP-binding protein, pu... 150 3e-35
>gi|17543864|ref|NP_502576.1| RAB family member (rab-19)
[Caenorhabditis elegans]
gi|6425503|emb|CAB60605.1| Hypothetical protein Y62E10A.9
[Caenorhabditis elegans]
Length = 210
Score = 427 bits (1099), Expect = e-119
Identities = 210/210 (100%), Positives = 210/210 (100%)
Frame = -1
Query: 633 MDNDDGFDYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLVVDGKRVK 454
MDNDDGFDYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLVVDGKRVK
Sbjct: 1 MDNDDGFDYLFKIVLVGDMGVGKTCVVQRFRNGTFVDRQGTTIGVDFTMKTLVVDGKRVK 60
Query: 453 LQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFAAPNVVKLL 274
LQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFAAPNVVKLL
Sbjct: 61 LQIWDTGGQERFRTITQSYYRSANGIVLCYDITCKQSFGSLQRWIDDVSKFAAPNVVKLL 120
Query: 273 IGTKCDLEDQRAIEAEEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGV 94
IGTKCDLEDQRAIEAEEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGV
Sbjct: 121 IGTKCDLEDQRAIEAEEAEMLQRANGMFAMLETSAKGNVNVDNAFLELATILKRQYDQGV 180
Query: 93 VEQGSSGTFQLGSGGTTALGSPWQRCCQYT 4
VEQGSSGTFQLGSGGTTALGSPWQRCCQYT
Sbjct: 181 VEQGSSGTFQLGSGGTTALGSPWQRCCQYT 210