Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y5F2A_8
(1139 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17541546|ref|NP_502064.1| autophagy (72.4 kD) (4L844) [Caenor... 690 0.0
gi|39593701|emb|CAE61993.1| Hypothetical protein CBG06001 [Caeno... 528 e-148
gi|22550098|ref|NP_083111.1| AGP7 [Mus musculus] >gnl|BL_ORD_ID|... 347 2e-94
gi|22335385|dbj|BAC10416.1| Apg7p [Mus musculus] 347 2e-94
gi|5453668|ref|NP_006386.1| APG7 autophagy 7-like; ubiquitin act... 347 4e-94
gi|7512670|pir||T34556 hypothetical protein DKFZp434N0735.1 - hu... 347 4e-94
gi|50754267|ref|XP_414304.1| PREDICTED: similar to APG7 autophag... 341 2e-92
gi|50256724|gb|EAL19445.1| hypothetical protein CNBH0170 [Crypto... 334 2e-90
gi|6321965|ref|NP_012041.1| autophagy; Atg7p [Saccharomyces cere... 326 7e-88
gi|28395467|gb|AAO39077.1| autophagy protein 7 [Dictyostelium di... 325 9e-88
gi|48138551|ref|XP_396905.1| similar to putative ubiquitin activ... 325 1e-87
gi|50302581|ref|XP_451226.1| unnamed protein product [Kluyveromy... 325 2e-87
gi|49077204|ref|XP_402495.1| hypothetical protein UM04880.1 [Ust... 321 2e-86
gi|34858331|ref|XP_232276.2| similar to AGP7 [Rattus norvegicus] 319 7e-86
gi|4262402|gb|AAD14610.1| E1-like protein [Pichia pastoris] 319 9e-86
gi|19112876|ref|NP_596084.1| putative protein involved in autoph... 318 2e-85
gi|45190901|ref|NP_985155.1| AER298Cp [Eremothecium gossypii] >g... 315 1e-84
gi|38111349|gb|EAA56942.1| hypothetical protein MG07297.4 [Magna... 313 5e-84
gi|24655127|ref|NP_725809.1| CG5489-PB [Drosophila melanogaster]... 313 5e-84
gi|19922550|ref|NP_611350.1| CG5489-PA [Drosophila melanogaster]... 313 5e-84
gi|9758937|dbj|BAB09318.1| ubiquitin activating enzyme E1-like p... 308 2e-82
gi|18422607|ref|NP_568652.1| autophagy 7 (APG7) [Arabidopsis tha... 308 2e-82
gi|46433104|gb|EAK92558.1| hypothetical protein CaO19.707 [Candi... 304 3e-81
gi|46433123|gb|EAK92576.1| hypothetical protein CaO19.8326 [Cand... 304 3e-81
gi|12652685|gb|AAH00091.1| APG7L protein [Homo sapiens] 302 8e-81
gi|46137421|ref|XP_390402.1| hypothetical protein FG10226.1 [Gib... 301 2e-80
gi|50427899|ref|XP_462562.1| unnamed protein product [Debaryomyc... 301 2e-80
gi|32412956|ref|XP_326958.1| hypothetical protein [Neurospora cr... 300 4e-80
gi|50289851|ref|XP_447357.1| unnamed protein product [Candida gl... 295 2e-78
gi|31229326|ref|XP_318212.1| ENSANGP00000001364 [Anopheles gambi... 293 5e-78
gi|50549137|ref|XP_502039.1| hypothetical protein [Yarrowia lipo... 286 5e-76
gi|49107751|ref|XP_411565.1| hypothetical protein AN7428.2 [Aspe... 249 8e-65
gi|34912646|ref|NP_917670.1| P0410E01.27 [Oryza sativa (japonica... 237 3e-61
gi|46226728|gb|EAK87707.1| APG7-like ubiquitin activating enzyme... 214 3e-54
gi|47229856|emb|CAG07052.1| unnamed protein product [Tetraodon n... 198 2e-49
gi|23508462|ref|NP_701131.1| hypothetical protein, conserved [Pl... 134 5e-30
gi|23482818|gb|EAA18689.1| ubiquitin activating enzyme E1-like p... 129 1e-28
gi|31229331|ref|XP_318213.1| ENSANGP00000023120 [Anopheles gambi... 112 2e-23
gi|47087029|ref|NP_998528.1| ubiquitin-like 1 (sentrin) activati... 59 2e-07
gi|15602560|ref|NP_245632.1| MoeB [Pasteurella multocida Pm70] >... 58 4e-07
gi|32453024|gb|AAA81160.2| Ectopic membrane ruffles in embryo pr... 58 5e-07
gi|15807260|ref|NP_295990.1| molybdopterin biosynthesis MoeB [De... 57 6e-07
gi|7709986|ref|NP_057891.1| ubiquitin-like 1 (sentrin) activatin... 57 8e-07
gi|15601376|ref|NP_233007.1| molybdopterin biosynthesis MoeB pro... 57 8e-07
gi|16128794|ref|NP_415347.1| molybdopterin biosynthesis; ATP-dep... 57 1e-06
gi|24112193|ref|NP_706703.1| molybdopterin biosynthesis [Shigell... 56 1e-06
gi|33595012|ref|NP_882655.1| adenylyltransferase [Bordetella par... 56 1e-06
gi|33599290|ref|NP_886850.1| adenylyltransferase [Bordetella bro... 56 1e-06
gi|46105472|ref|XP_380540.1| hypothetical protein FG00364.1 [Gib... 56 1e-06
gi|4885649|ref|NP_005490.1| SUMO-1 activating enzyme subunit 2 [... 56 1e-06
gi|4226054|gb|AAD12784.1| SUMO-1-activating enzyme E1 C subunit ... 56 1e-06
gi|11360042|pir||T46936 hypothetical protein DKFZp434H239.1 - hu... 56 1e-06
gi|16759762|ref|NP_455379.1| molybdopterin biosynthesis MoeB pro... 56 2e-06
gi|16764207|ref|NP_459822.1| molybdopterin biosynthesis [Salmone... 56 2e-06
gi|37676753|ref|NP_937149.1| molybdopterin biosynthesis protein ... 56 2e-06
gi|27366977|ref|NP_762504.1| Dinucleotide-utilizing enzymes [Vib... 56 2e-06
gi|33591809|ref|NP_879453.1| adenylyltransferase [Bordetella per... 56 2e-06
gi|49080378|ref|XP_403716.1| hypothetical protein UM06101.1 [Ust... 56 2e-06
gi|39593957|emb|CAE70067.1| Hypothetical protein CBG16503 [Caeno... 55 2e-06
gi|50304007|ref|XP_451953.1| unnamed protein product [Kluyveromy... 55 4e-06
gi|30681414|ref|NP_179742.2| SUMO activating enzyme 2 (SAE2) [Ar... 55 4e-06
gi|42570865|ref|NP_973506.1| SUMO activating enzyme 2 (SAE2) [Ar... 55 4e-06
gi|26246801|ref|NP_752841.1| Molybdopterin biosynthesis protein ... 54 5e-06
gi|11466160|ref|NP_047093.1| UBAE; L1439.7 [Leishmania major] >g... 54 5e-06
gi|50121761|ref|YP_050928.1| molybdopterin biosynthesis protein ... 54 5e-06
gi|17988223|ref|NP_540857.1| MOLYBDOPTERIN BIOSYNTHESIS MOEB PRO... 54 5e-06
gi|25028493|ref|NP_738547.1| putative molybdopterin biosynthesis... 54 7e-06
gi|42631751|ref|ZP_00157289.1| COG0476: Dinucleotide-utilizing e... 54 7e-06
gi|1256835|gb|AAA96530.1| moeB gene product 54 9e-06
gi|28901026|ref|NP_800681.1| molybdopterin biosynthesis MoeB pro... 54 9e-06
gi|32404342|ref|XP_322784.1| related to ubiquitin-activating enz... 54 9e-06
gi|34901130|ref|NP_911911.1| putative SUMO activating enzyme 2 [... 54 9e-06
gi|23467277|ref|ZP_00122860.1| COG0476: Dinucleotide-utilizing e... 53 1e-05
gi|19113852|ref|NP_592940.1| ubiquitin activating enzyme [Schizo... 53 1e-05
gi|27882626|gb|AAH43962.1| Uble1b protein [Xenopus laevis] 53 2e-05
gi|23500920|ref|NP_697047.1| molybdopterin biosynthesis protein ... 53 2e-05
gi|38109165|gb|EAA55076.1| hypothetical protein MG06733.4 [Magna... 53 2e-05
gi|39581464|emb|CAE67994.1| Hypothetical protein CBG13604 [Caeno... 53 2e-05
gi|46143823|ref|ZP_00133950.2| COG0476: Dinucleotide-utilizing e... 53 2e-05
gi|16273356|ref|NP_439601.1| molybdopterin biosynthesis protein ... 53 2e-05
gi|1814236|gb|AAB41850.1| ubiquitin-activating enzyme 52 2e-05
gi|17509467|ref|NP_493233.1| UBiquitin Activating enzme related ... 52 2e-05
gi|50309807|ref|XP_454917.1| unnamed protein product [Kluyveromy... 52 2e-05
gi|24371737|ref|NP_715779.1| molybdopterin biosynthesis MoeB pro... 52 2e-05
gi|31873115|emb|CAB54319.3| Hypothetical protein W02A11.4 [Caeno... 52 2e-05
gi|21324812|dbj|BAB99435.1| Dinucleotide-utilizing enzymes invol... 52 3e-05
gi|19553244|ref|NP_601246.1| dinucleotide-utilizing enzyme [Cory... 52 3e-05
gi|17554732|ref|NP_498534.1| UBiquitin Activating enzme related,... 52 3e-05
gi|47208966|emb|CAF89656.1| unnamed protein product [Tetraodon n... 52 3e-05
gi|49072102|ref|XP_400340.1| hypothetical protein UM02725.1 [Ust... 52 3e-05
gi|37525486|ref|NP_928830.1| molybdopterin biosynthesis protein ... 52 3e-05
gi|42629478|ref|ZP_00155024.1| COG0476: Dinucleotide-utilizing e... 52 3e-05
gi|15897242|ref|NP_341847.1| Thiamine biosynthesis protein relat... 51 4e-05
gi|24660640|ref|NP_524756.2| CG7528-PA [Drosophila melanogaster]... 51 4e-05
gi|6694274|gb|AAF25197.1| ubiquitin-like protein activating enzy... 51 4e-05
gi|16121767|ref|NP_405080.1| molybdopterin biosynthesis protein ... 51 6e-05
gi|49236774|ref|ZP_00330831.1| COG0476: Dinucleotide-utilizing e... 51 6e-05
gi|38075351|ref|XP_130596.2| RIKEN cDNA 1700020H17 [Mus musculus] 51 6e-05
gi|15963942|ref|NP_384295.1| PUTATIVE THIAMINE BIOSYNTHESIS TRAN... 51 6e-05
gi|22126553|ref|NP_669976.1| molybdopterin biosynthesis protein ... 51 6e-05
gi|47087337|ref|NP_998632.1| zgc:55528 [Danio rerio] >gnl|BL_ORD... 50 7e-05
gi|34865924|ref|XP_217252.2| similar to ubiquitin-activating enz... 50 7e-05
gi|20089153|ref|NP_615228.1| 4-methyl-5-(beta-hydroxyethyl)thiaz... 50 7e-05
gi|13474645|ref|NP_106214.1| molybdenum cofactor biosynthesis pr... 50 7e-05
gi|48103956|ref|XP_392909.1| similar to ENSANGP00000009925 [Apis... 50 7e-05
gi|50258451|gb|EAL21140.1| hypothetical protein CNBD5160 [Crypto... 50 7e-05
gi|20808826|ref|NP_623997.1| Dinucleotide-utilizing enzymes invo... 50 1e-04
gi|31210023|ref|XP_313978.1| ENSANGP00000009925 [Anopheles gambi... 50 1e-04
gi|48867463|ref|ZP_00320974.1| COG0476: Dinucleotide-utilizing e... 50 1e-04
gi|34540267|ref|NP_904746.1| thiF protein [Porphyromonas gingiva... 50 1e-04
gi|22652854|gb|AAN03851.1| SUMO activating enzyme 2 [Arabidopsis... 50 1e-04
gi|27468979|ref|NP_765616.1| molybdopterin biosynthesis protein ... 50 1e-04
gi|46123305|ref|XP_386206.1| hypothetical protein FG06030.1 [Gib... 50 1e-04
gi|6321903|ref|NP_011979.1| Protein that activates Urm1p before ... 50 1e-04
gi|15597299|ref|NP_250793.1| probable molybdopterin biosynthesis... 49 2e-04
gi|49086850|gb|AAT51387.1| PA2103 [synthetic construct] 49 2e-04
gi|34903204|ref|NP_912949.1| unnamed protein product [Oryza sati... 49 2e-04
gi|38257360|sp|O65041|ECR1_ARATH RUB-activating enzyme (Ubiquiti... 49 2e-04
gi|18419850|ref|NP_568370.1| ubiquitin activating enzyme, putati... 49 2e-04
gi|11498142|ref|NP_069367.1| molybdenum cofactor biosynthesis pr... 49 2e-04
gi|21402769|ref|NP_658754.1| ThiF_family, ThiF family [Bacillus ... 49 2e-04
gi|47219528|emb|CAG09882.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|49481370|ref|YP_038770.1| molybdopterin biosynthesis protein ... 49 2e-04
gi|45190851|ref|NP_985105.1| AER248Wp [Eremothecium gossypii] >g... 49 2e-04
gi|29346058|ref|NP_809561.1| molybdopterin biosynthesis protein ... 49 2e-04
gi|3955201|gb|AAC83136.1| MoeB [Staphylococcus carnosus] 49 3e-04
gi|49478275|ref|YP_037647.1| molybdopterin biosynthesis protein ... 49 3e-04
gi|45198656|ref|NP_985685.1| AFR138Wp [Eremothecium gossypii] >g... 49 3e-04
gi|50842002|ref|YP_055229.1| putative molybdopterin biosynthesis... 49 3e-04
gi|7508791|pir||T26072 hypothetical protein W02A11.4b - Caenorha... 49 3e-04
gi|32422575|ref|XP_331731.1| hypothetical protein [Neurospora cr... 49 3e-04
gi|50795135|ref|XP_423750.1| PREDICTED: similar to ubiquitin-act... 48 4e-04
gi|42779880|ref|NP_977127.1| hesA/moeB/thiF family protein [Baci... 48 4e-04
gi|16078491|ref|NP_389310.1| molybdopterin biosynthesis protein ... 48 4e-04
gi|6934296|gb|AAF31704.1| Smt3 activating enzyme 2 [Drosophila m... 48 4e-04
gi|46132796|ref|ZP_00171500.2| COG0476: Dinucleotide-utilizing e... 48 5e-04
gi|32477346|ref|NP_870340.1| molybdopterin biosynthesis protein ... 48 5e-04
gi|23335284|ref|ZP_00120521.1| COG0476: Dinucleotide-utilizing e... 48 5e-04
gi|47569967|ref|ZP_00240631.1| HesA/MoeB/ThiF family protein, pu... 48 5e-04
gi|38232676|ref|NP_938443.1| Putative adenylyltransferase [Coryn... 47 6e-04
gi|31211531|ref|XP_314735.1| ENSANGP00000013083 [Anopheles gambi... 47 6e-04
gi|40889582|pdb|1R4M|B Chain B, Appbp1-Uba3-Nedd8, An E1-Ubiquit... 47 6e-04
gi|48770356|ref|ZP_00274699.1| COG0476: Dinucleotide-utilizing e... 47 6e-04
gi|38045942|ref|NP_003959.3| ubiquitin-activating enzyme E1C iso... 47 6e-04
gi|7018418|emb|CAB55996.2| hypothetical protein [Homo sapiens] >... 47 6e-04
gi|50401616|sp|Q8TBC4|UB1C_HUMAN Ubiquitin-activating enzyme E1C... 47 6e-04
gi|29726682|pdb|1NGV|B Chain B, Insights Into The Ubiquitin Tran... 47 6e-04
gi|38045944|ref|NP_937838.1| ubiquitin-activating enzyme E1C iso... 47 6e-04
gi|15610342|ref|NP_217722.1| moeZ [Mycobacterium tuberculosis H3... 47 6e-04
gi|50555145|ref|XP_504981.1| hypothetical protein [Yarrowia lipo... 47 6e-04
gi|7512830|pir||T17306 hypothetical protein DKFZp566J164.1 - hum... 47 6e-04
gi|46913628|emb|CAG20414.1| Putative molybdopterin biosynthesis ... 47 6e-04
gi|31794383|ref|NP_856876.1| PROBABLE MOLYBDENUM COFACTOR BIOSYN... 47 6e-04
gi|48101816|ref|XP_392715.1| similar to ENSANGP00000013083 [Apis... 47 6e-04
gi|17105358|ref|NP_476553.1| ubiquitin-activating enzyme E1C [Ra... 47 8e-04
gi|50401565|sp|Q8C878|UB1C_MOUSE Ubiquitin-activating enzyme E1c... 47 8e-04
gi|6325323|ref|NP_015391.1| Protein that acts together with Ula1... 47 8e-04
gi|12852280|dbj|BAB29346.1| unnamed protein product [Mus musculus] 47 8e-04
gi|42782632|ref|NP_979879.1| molybdopterin biosynthesis protein ... 47 8e-04
gi|6755921|ref|NP_035796.1| ubiquitin-activating enzyme E1C; ubi... 47 8e-04
gi|47564665|ref|ZP_00235709.1| moeB [Bacillus cereus G9241] >gnl... 47 8e-04
gi|48841278|ref|ZP_00298204.1| COG0476: Dinucleotide-utilizing e... 47 8e-04
gi|19112737|ref|NP_595945.1| ubiquitin-activating enzyme e1-like... 47 8e-04
gi|41689605|ref|ZP_00146138.1| COG0476: Dinucleotide-utilizing e... 47 8e-04
gi|42557747|emb|CAF28721.1| putative molybdopterin biosynthesis ... 47 0.001
gi|9944982|gb|AAG03060.1| Ube1l [Mus musculus] 47 0.001
gi|27704992|ref|XP_230874.1| similar to Molybdenum cofactor synt... 47 0.001
gi|26354356|dbj|BAC40806.1| unnamed protein product [Mus musculus] 47 0.001
gi|9944980|gb|AAG03059.1| Ube1l [Mus musculus] 47 0.001
gi|7657339|ref|NP_055299.1| molybdenum cofactor synthesis 3; mol... 47 0.001
gi|46113717|ref|ZP_00200876.1| COG0476: Dinucleotide-utilizing e... 47 0.001
gi|47572584|ref|ZP_00242627.1| COG0476: Dinucleotide-utilizing e... 47 0.001
gi|30794156|ref|NP_076227.1| ubiquitin-activating enzyme E1-like... 47 0.001
gi|41056017|ref|NP_956421.1| similar to molybdenum cofactor synt... 46 0.001
gi|30022796|ref|NP_834427.1| Molybdopterin biosynthesis MoeB pro... 46 0.001
gi|33152778|ref|NP_874131.1| molybdopterin biosynthesis protein ... 46 0.001
gi|49068654|ref|XP_398616.1| hypothetical protein UM01001.1 [Ust... 46 0.001
gi|21322972|dbj|BAB97601.1| Dinucleotide-utilizing enzymes invol... 46 0.001
gi|47568927|ref|ZP_00239619.1| thiamine biosynthesis protein [Ba... 46 0.001
gi|21401489|ref|NP_657474.1| ThiF_family, ThiF family [Bacillus ... 46 0.001
gi|48831751|ref|ZP_00288804.1| COG0476: Dinucleotide-utilizing e... 46 0.001
gi|19551459|ref|NP_599461.1| dinucleotide-utilizing enzyme [Cory... 46 0.001
gi|50308169|ref|XP_454085.1| unnamed protein product [Kluyveromy... 46 0.001
gi|49089598|ref|XP_406464.1| hypothetical protein AN2327.2 [Aspe... 46 0.002
gi|48855693|ref|ZP_00309851.1| COG0476: Dinucleotide-utilizing e... 46 0.002
gi|50550009|ref|XP_502477.1| hypothetical protein [Yarrowia lipo... 46 0.002
gi|21673526|ref|NP_661591.1| thiamine biosynthesis protein ThiF ... 46 0.002
gi|50426345|ref|XP_461769.1| unnamed protein product [Debaryomyc... 46 0.002
gi|24582879|ref|NP_609240.2| CG13090-PA [Drosophila melanogaster... 46 0.002
gi|19527857|gb|AAL90043.1| AT10573p [Drosophila melanogaster] 46 0.002
gi|15606532|ref|NP_213912.1| molybdopterin biosynthesis protein ... 46 0.002
gi|46432549|gb|EAK92026.1| hypothetical protein CaO19.4209 [Cand... 46 0.002
gi|34870120|ref|XP_212706.2| similar to ubiquitin-activating enz... 45 0.002
gi|30250280|ref|NP_842350.1| Dinucleotide-utilizing enzymes invo... 45 0.002
gi|23102659|ref|ZP_00089161.1| COG0476: Dinucleotide-utilizing e... 45 0.002
gi|49090046|ref|XP_406587.1| hypothetical protein AN2450.2 [Aspe... 45 0.002
gi|50085497|ref|YP_047007.1| molybdopterin biosynthesis protein ... 45 0.002
gi|47229774|emb|CAG06970.1| unnamed protein product [Tetraodon n... 45 0.002
gi|47229262|emb|CAG04014.1| unnamed protein product [Tetraodon n... 45 0.002
gi|48834858|ref|ZP_00291862.1| COG0476: Dinucleotide-utilizing e... 45 0.002
gi|17509465|ref|NP_493232.1| UBiquitin Activating enzme related ... 45 0.003
gi|20129973|ref|NP_610913.1| CG13343-PA [Drosophila melanogaster... 45 0.003
gi|32267087|ref|NP_861119.1| thiamine biosynthesis protein ThiF ... 45 0.003
gi|29375896|ref|NP_815050.1| HesA/MoeB/ThiF family protein [Ente... 45 0.004
gi|50259146|gb|EAL21823.1| hypothetical protein CNBC5240 [Crypto... 45 0.004
gi|47938002|gb|AAH71459.1| Similar to molybdenum cofactor synthe... 45 0.004
gi|41718257|ref|ZP_00147308.1| COG0476: Dinucleotide-utilizing e... 45 0.004
gi|11498163|ref|NP_069389.1| thiamine biosynthesis protein (thiF... 45 0.004
gi|28378212|ref|NP_785104.1| molybdopterin biosynthesis protein ... 45 0.004
gi|34763553|ref|ZP_00144490.1| ThiF protein [Fusobacterium nucle... 45 0.004
gi|47565150|ref|ZP_00236193.1| molybdopterin biosynthesis MoeB p... 44 0.005
gi|46121299|ref|XP_385204.1| hypothetical protein FG05028.1 [Gib... 44 0.005
gi|6855414|emb|CAB71237.1| ubiquitin activating enzyme [Leishman... 44 0.005
gi|25026739|ref|NP_736793.1| putative molybdopterin biosynthesis... 44 0.005
gi|39995760|ref|NP_951711.1| thiF family protein [Geobacter sulf... 44 0.005
gi|30018909|ref|NP_830540.1| Molybdopterin biosynthesis MoeB pro... 44 0.007
gi|50257350|gb|EAL20059.1| hypothetical protein CNBF3850 [Crypto... 44 0.007
gi|38108820|gb|EAA54778.1| hypothetical protein MG05569.4 [Magna... 44 0.009
gi|33862125|ref|NP_893686.1| molybdopterin biosynthesis protein ... 44 0.009
gi|50289755|ref|XP_447309.1| unnamed protein product [Candida gl... 44 0.009
gi|28558897|ref|NP_788157.1| RC170 [Ruegeria sp. PR1b] >gnl|BL_O... 44 0.009
gi|46439252|gb|EAK98572.1| hypothetical protein CaO19.12540 [Can... 44 0.009
gi|42783912|ref|NP_981159.1| molybdopterin biosynthesis protein ... 43 0.012
gi|49480277|ref|YP_034988.1| hesA/moeB/thiF family protein [Baci... 43 0.012
gi|6678483|ref|NP_033483.1| ubiquitin-activating enzyme E1, Chr ... 43 0.012
gi|27375876|ref|NP_767405.1| molybdopterin biosynthesis protein ... 43 0.012
gi|48861682|ref|ZP_00315582.1| COG0476: Dinucleotide-utilizing e... 43 0.012
gi|34557393|ref|NP_907208.1| MOLYBDOPTERIN BIOSYNTHESIS PROTEIN ... 43 0.012
gi|46136347|ref|XP_389865.1| hypothetical protein FG09689.1 [Gib... 43 0.016
gi|31241837|ref|XP_321349.1| ENSANGP00000008492 [Anopheles gambi... 43 0.016
gi|18312380|ref|NP_559047.1| thiF/moeB/hesA family protein [Pyro... 43 0.016
gi|34499713|ref|NP_903928.1| molybdopterin biosynthesis MoeB pro... 43 0.016
gi|49475053|ref|YP_033094.1| Molybdopterin biosynthesis moeB pro... 43 0.016
gi|50660440|gb|AAT80908.1| ubiquitin activating enzyme E1 [Lemna... 42 0.020
gi|21398696|ref|NP_654681.1| ThiF_family, ThiF family [Bacillus ... 42 0.020
gi|30260881|ref|NP_843258.1| hesA/moeB/thiF family protein [Baci... 42 0.020
gi|6755923|ref|NP_035797.1| ubiquitin-activating enzyme E1, Chr ... 42 0.020
gi|6002801|gb|AAF00149.1| ubiquitin-activating enzyme E1 [Mus mu... 42 0.020
gi|26326011|dbj|BAC26749.1| unnamed protein product [Mus musculus] 42 0.020
gi|21283923|ref|NP_647011.1| molybdopterin biosynthesis protein ... 42 0.020
gi|21223547|ref|NP_629326.1| putative sulfurylase [Streptomyces ... 42 0.020
gi|15922598|ref|NP_378267.1| 287aa long hypothetical hesA protei... 42 0.026
gi|34933178|ref|XP_234520.2| similar to ubiquitin-protein ligase... 42 0.026
gi|40352729|gb|AAH64684.1| Unknown (protein for MGC:68851) [Xeno... 42 0.026
gi|11874759|dbj|BAB19357.1| ubiquitin activating enzyme [Xenopus... 42 0.026
gi|28958137|gb|AAH47256.1| Ube1-prov protein [Xenopus laevis] 42 0.026
gi|49487057|ref|YP_044278.1| putative molybdopterin synthase sul... 42 0.026
gi|4511992|gb|AAD21552.1| molybdopterin biosynthesis protein [Zy... 42 0.026
gi|46437754|gb|EAK97095.1| hypothetical protein CaO19.7438 [Cand... 42 0.026
gi|32406220|ref|XP_323723.1| hypothetical protein [Neurospora cr... 42 0.026
gi|22971167|ref|ZP_00018152.1| hypothetical protein [Chloroflexu... 42 0.035
gi|46227927|gb|EAK88847.1| putative molybdopterin synthase sulph... 42 0.035
gi|32408873|ref|XP_324916.1| hypothetical protein [Neurospora cr... 42 0.035
gi|50548981|ref|XP_501961.1| hypothetical protein [Yarrowia lipo... 42 0.035
gi|50286105|ref|XP_445481.1| unnamed protein product [Candida gl... 42 0.035
gi|23509052|ref|NP_701720.1| ubiquitin activating enzyme, putati... 41 0.045
gi|46228816|gb|EAK89686.1| Uba3p like ubiquitin activating enzym... 41 0.045
gi|50427135|ref|XP_462179.1| unnamed protein product [Debaryomyc... 41 0.045
gi|7508790|pir||T26071 hypothetical protein W02A11.4a - Caenorha... 41 0.045
gi|7503278|pir||T32638 hypothetical protein F42G8.6 - Caenorhabd... 41 0.045
gi|17540406|ref|NP_501359.1| molybdenum cofactor synthesis 3 (44... 41 0.045
gi|47085781|ref|NP_998227.1| zgc:66143 [Danio rerio] >gnl|BL_ORD... 41 0.045
gi|23510338|ref|NP_003325.2| ubiquitin-activating enzyme E1; A1S... 41 0.045
gi|35830|emb|CAA40296.1| ubiquitin activating enzyme E1 [Homo sa... 41 0.045
gi|30584341|gb|AAP36419.1| Homo sapiens ubiquitin-activating enz... 41 0.045
gi|24485|emb|CAA37078.1| unnamed protein product [Homo sapiens] 41 0.045
gi|49484491|ref|YP_041715.1| putative molybdopterin synthase sul... 41 0.045
gi|50304433|ref|XP_452166.1| unnamed protein product [Kluyveromy... 41 0.059
gi|9790247|ref|NP_062722.1| ubiquitin-like 1 (sentrin) activatin... 41 0.059
gi|6136092|sp|Q29504|UBA1_RABIT Ubiquitin-activating enzyme E1 >... 41 0.059
gi|45187540|ref|NP_983763.1| ADL333Cp [Eremothecium gossypii] >g... 41 0.059
gi|46363196|ref|ZP_00225971.1| COG0476: Dinucleotide-utilizing e... 40 0.077
gi|28573937|ref|NP_477310.2| CG1782-PA [Drosophila melanogaster]... 40 0.077
gi|30584353|gb|AAP36425.1| Homo sapiens ubiquitin-activating enz... 40 0.077
gi|34556778|ref|NP_906593.1| THIF, MOEB, HESA FAMILIY PROTEIN [W... 40 0.077
gi|2706522|emb|CAA75816.1| ubiquitin activating enzyme [Drosophi... 40 0.077
gi|7416829|dbj|BAA94076.1| ubiquitin-activating enzyme E1 [Caras... 40 0.077
gi|50405021|ref|YP_054113.1| Molybdopterin synthase sulfurylase,... 40 0.077
gi|731039|sp|P41226|UBAL_HUMAN Ubiquitin-activating enzyme E1 ho... 40 0.077
gi|477152|pir||A48195 ubiquitin-protein ligase E1 homolog - human 40 0.077
gi|23481238|gb|EAA17574.1| related to ubiquitin-activating enzym... 40 0.077
gi|15925266|ref|NP_372800.1| molybdopterin biosynthesis protein ... 40 0.077
gi|38045948|ref|NP_003326.2| ubiquitin-activating enzyme E1-like... 40 0.077
gi|5070639|gb|AAD39225.1| MoeB-like protein [Pseudomonas stutzer... 40 0.077
gi|48853097|ref|ZP_00307278.1| COG0476: Dinucleotide-utilizing e... 40 0.10
gi|19113411|ref|NP_596619.1| poly(a)+ rna transport protein Ptr3... 40 0.10
gi|21227635|ref|NP_633557.1| Molybdopterin biosynthesis MoeB pro... 40 0.10
gi|50657642|gb|AAT79627.1| molybdopterin biosynthesis protein [G... 40 0.10
gi|25293654|pir||T50344 poly(A)+ RNA transport protein Ptr3p [im... 40 0.10
gi|12643656|sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 ... 40 0.10
gi|47228615|emb|CAG07347.1| unnamed protein product [Tetraodon n... 40 0.13
gi|38505878|ref|NP_942496.1| sll6053 [Synechocystis sp. PCC 6803... 40 0.13
gi|38142361|dbj|BAD00984.1| ubiquitin activating enzyme 2 [Nicot... 39 0.17
gi|48833438|ref|ZP_00290457.1| COG0476: Dinucleotide-utilizing e... 39 0.22
gi|28210584|ref|NP_781528.1| dinucleotide-utilizing enzyme [Clos... 39 0.22
gi|29829624|ref|NP_824258.1| putative ThiF-family protein [Strep... 39 0.22
gi|23474877|ref|ZP_00130168.1| COG0476: Dinucleotide-utilizing e... 39 0.22
gi|49475959|ref|YP_034000.1| mccB protein [Bartonella henselae s... 39 0.22
gi|50425035|ref|XP_461109.1| unnamed protein product [Debaryomyc... 39 0.22
gi|11465801|ref|NP_053945.1| molybdopterin biosynthesis protein ... 39 0.29
gi|33863986|ref|NP_895546.1| molybdopterin biosynthesis protein ... 39 0.29
gi|46580497|ref|YP_011305.1| thiF family protein [Desulfovibrio ... 39 0.29
gi|682765|emb|CAA40809.1| mccB [Escherichia coli] 38 0.38
gi|30314889|emb|CAD32228.1| MccB protein [Escherichia coli] 38 0.38
gi|38109967|gb|EAA55758.1| hypothetical protein MG01409.4 [Magna... 38 0.38
gi|17539268|ref|NP_501800.1| UBA (human ubiquitin) related, UBiq... 38 0.38
gi|34876722|ref|XP_223308.2| similar to RIKEN cDNA 5730469D23 [R... 38 0.50
gi|38142359|dbj|BAD00983.1| ubiquitin activating enzyme 1 [Nicot... 38 0.50
gi|7437977|pir||T03964 probable ubiquitin-protein ligase (EC 6.3... 38 0.50
gi|48095390|ref|XP_394434.1| similar to CG1782-PA [Apis mellifera] 38 0.50
gi|38101087|gb|EAA48108.1| hypothetical protein MG09645.4 [Magna... 38 0.50
gi|23023749|ref|ZP_00062980.1| COG0476: Dinucleotide-utilizing e... 38 0.50
gi|18310584|ref|NP_562518.1| probable molybdopterin biosynthesis... 38 0.50
gi|18976375|ref|NP_577732.1| moeB-like protein [Pyrococcus furio... 38 0.50
gi|16800110|ref|NP_470378.1| similar to molybdopterin biosynthes... 37 0.65
gi|50260821|gb|EAL23471.1| hypothetical protein CNBA1200 [Crypto... 37 0.65
gi|33241173|ref|NP_876115.1| Dinucleotide-utilizing enzyme [Proc... 37 0.65
gi|29246853|gb|EAA38434.1| GLP_191_9167_5889 [Giardia lamblia AT... 37 0.65
gi|15618039|ref|NP_224323.1| Signal Recognition Particle GTPase ... 37 0.85
gi|15835651|ref|NP_300175.1| signal recognition particle GTPase ... 37 0.85
gi|45198951|ref|NP_985980.1| AFR433Cp [Eremothecium gossypii] >g... 37 0.85
gi|27378029|ref|NP_769558.1| glycerate dehydrogenase [Bradyrhizo... 37 0.85
gi|4715|emb|CAA39056.1| ubiquitin-activating enzyme [Saccharomyc... 37 0.85
gi|39587480|emb|CAE58418.1| Hypothetical protein CBG01549 [Caeno... 37 0.85
gi|47229855|emb|CAG07051.1| unnamed protein product [Tetraodon n... 37 1.1
gi|48860142|ref|ZP_00314068.1| COG0476: Dinucleotide-utilizing e... 37 1.1
gi|15640095|ref|NP_229722.1| thiF protein [Vibrio cholerae O1 bi... 37 1.1
gi|29251145|gb|EAA42629.1| GLP_487_80021_78408 [Giardia lamblia ... 37 1.1
gi|19074053|ref|NP_584659.1| similarity to HYPOTHETICAL PROTEIN ... 37 1.1
gi|48095058|ref|XP_394348.1| similar to ENSANGP00000023276 [Apis... 37 1.1
gi|19114002|ref|NP_593090.1| similar to yeast molybdopterin synt... 37 1.1
gi|401238|sp|P31252|UBA3_WHEAT Ubiquitin-activating enzyme E1 3 ... 36 1.5
gi|27370032|ref|NP_766300.1| RIKEN cDNA 5730469D23 [Mus musculus... 36 1.5
gi|136632|sp|P20973|UBA1_WHEAT Ubiquitin-activating enzyme E1 1 ... 36 1.5
gi|47216862|emb|CAG11669.1| unnamed protein product [Tetraodon n... 36 1.5
gi|30468129|ref|NP_849016.1| molybdopterin biosynthesis protein ... 36 1.9
gi|46907281|ref|YP_013670.1| molybdopterin biosynthesis protein ... 36 1.9
gi|6322639|ref|NP_012712.1| Ubiquitin activating enzyme, involve... 36 1.9
gi|23113556|ref|ZP_00098922.1| COG0476: Dinucleotide-utilizing e... 36 1.9
gi|47092941|ref|ZP_00230722.1| molybdopterin biosynthesis protei... 36 1.9
gi|45512170|ref|ZP_00163737.1| COG0476: Dinucleotide-utilizing e... 36 1.9
gi|25313617|pir||T52532 molybdopterin synthase sulfurylase moeB ... 36 1.9
gi|29249252|gb|EAA40768.1| GLP_608_56918_56094 [Giardia lamblia ... 35 2.5
gi|401237|sp|P31251|UBA2_WHEAT Ubiquitin-activating enzyme E1 2 ... 35 2.5
gi|48477593|ref|YP_023299.1| molybdopterin biosynthesis MoeB pro... 35 2.5
gi|18977398|ref|NP_578755.1| malate oxidoreductase (malic enzyme... 35 3.2
gi|50552402|ref|XP_503611.1| hypothetical protein [Yarrowia lipo... 35 3.2
gi|46435449|gb|EAK94830.1| hypothetical protein CaO19.2324 [Cand... 35 3.2
gi|15794597|ref|NP_284419.1| conserved hypothetical protein [Nei... 35 3.2
gi|15613818|ref|NP_242121.1| BH1255~unknown conserved protein [B... 35 3.2
gi|6606268|gb|AAF19149.1| V6 [Aegilops ventricosa] 35 3.2
gi|17545493|ref|NP_518895.1| PROBABLE TRANSMEMBRANE PROTEIN [Ral... 35 4.2
gi|23118409|ref|ZP_00101960.1| COG0476: Dinucleotide-utilizing e... 35 4.2
gi|23469007|ref|ZP_00124342.1| COG0476: Dinucleotide-utilizing e... 35 4.2
gi|48854869|ref|ZP_00309030.1| COG2148: Sugar transferases invol... 35 4.2
gi|19114114|ref|NP_593202.1| protein with Moeb/ThiF domain and w... 35 4.2
gi|50291611|ref|XP_448238.1| unnamed protein product [Candida gl... 35 4.2
gi|32265835|ref|NP_859867.1| conserved hypothetical protein [Hel... 35 4.2
gi|38258132|sp|Q8FN90|NADD_COREF Probable nicotinate-nucleotide ... 34 5.5
gi|15677354|ref|NP_274509.1| HesA/MoeB/ThiF family protein [Neis... 34 5.5
gi|48833132|ref|ZP_00290155.1| COG0493: NADPH-dependent glutamat... 34 5.5
gi|25028813|ref|NP_738867.1| putative nicotinate mononucleotide ... 34 5.5
gi|47565014|ref|ZP_00236057.1| malate dehydrogenase, decarboxyla... 34 5.5
gi|285621|dbj|BAA02404.1| undefined open reading frame [Geobacil... 34 5.5
gi|34855215|ref|XP_218333.2| similar to ubiquitin-like 1 (sentri... 34 5.5
gi|30022679|ref|NP_834310.1| NAD-dependent malic enzyme [Bacillu... 34 5.5
gi|18402264|ref|NP_565693.1| ubiquitin activating enzyme 1 (UBA1... 34 7.2
gi|19699087|gb|AAL90910.1| At2g30110/T27E13.15 [Arabidopsis thal... 34 7.2
gi|30020757|ref|NP_832388.1| Molybdopterin biosynthesis MoeB pro... 34 7.2
gi|16803089|ref|NP_464574.1| similar to molybdopterin biosynthes... 34 7.2
gi|30264674|ref|NP_847051.1| malate dehydrogenase, putative [Bac... 34 7.2
gi|11990422|dbj|BAB19785.1| MOP-4 [Homo sapiens] 34 7.2
gi|30268263|emb|CAD89959.1| hypothetical protein [Homo sapiens] 34 7.2
gi|40255039|ref|NP_060697.3| hypothetical protein FLJ10808 [Homo... 34 7.2
gi|23099631|ref|NP_693097.1| malate dehydrogenase [Oceanobacillu... 34 7.2
gi|45358797|ref|NP_988354.1| conserved hypothetical membrane rel... 34 7.2
gi|29348059|ref|NP_811562.1| ThiF family protein, ubiquitin-acti... 34 7.2
gi|21402646|ref|NP_658631.1| malic, Malic enzyme [Bacillus anthr... 34 7.2
gi|48782173|ref|ZP_00278725.1| COG1250: 3-hydroxyacyl-CoA dehydr... 33 9.4
gi|32413487|ref|XP_327223.1| predicted protein [Neurospora crass... 33 9.4
gi|28378718|ref|NP_785610.1| 1-phosphofructokinase [Lactobacillu... 33 9.4
gi|28209994|ref|NP_780938.1| putative cell wall-associated hydro... 33 9.4
gi|40806907|gb|AAR92213.1| polyketide synthase [Gibberella monil... 33 9.4
gi|47216118|emb|CAG11186.1| unnamed protein product [Tetraodon n... 33 9.4
gi|7486142|pir||T04294 hypothetical protein F25I24.200 - Arabido... 33 9.4
gi|48767665|ref|ZP_00272019.1| COG1179: Dinucleotide-utilizing e... 33 9.4
gi|46437405|gb|EAK96752.1| hypothetical protein CaO19.2835 [Cand... 33 9.4
>gi|17541546|ref|NP_502064.1| autophagy (72.4 kD) (4L844)
[Caenorhabditis elegans]
gi|7506121|pir||T23829 hypothetical protein M7.5 - Caenorhabditis
elegans
gi|3878681|emb|CAA92753.1| Hypothetical protein M7.5 [Caenorhabditis
elegans]
gi|3881168|emb|CAA21650.1| Hypothetical protein M7.5 [Caenorhabditis
elegans]
Length = 647
Score = 690 bits (1780), Expect = 0.0
Identities = 347/367 (94%), Positives = 347/367 (94%)
Frame = -3
Query: 1137 AVGWERNANDKLQPISVDLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLI 958
AVGWERNANDKLQPISVDLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLI
Sbjct: 270 AVGWERNANDKLQPISVDLSKEFDPKILMERSVDLNLSLIKWRLHPDIQLERYSQLKVLI 329
Query: 957 LGAGTLGCNIARCLIGWGVRHISFLDNSTVSYNNPVRQSLSEFEDARLGRGKAETAQAAI 778
LGAGTLGCNIARCLIGWGVRHISFLDNSTVSYNNPVRQSLSEFEDARLGRGKAETAQAAI
Sbjct: 330 LGAGTLGCNIARCLIGWGVRHISFLDNSTVSYNNPVRQSLSEFEDARLGRGKAETAQAAI 389
Query: 777 QRIFPSIQATAHRLTVPMPGHSIDEKDVPELEKDIAKLEQLVKDHDVVFLALDSREARWL 598
QRIFPSIQATAHRLTVPMPGHSIDEKDVPELEKDIAKLEQLVKDHDVVFLALDSREARWL
Sbjct: 390 QRIFPSIQATAHRLTVPMPGHSIDEKDVPELEKDIAKLEQLVKDHDVVFLALDSREARWL 449
Query: 597 PTVLASRHKKIAISVAIGFDTYVIIRHGIGXXXXXXXXXXXXXXXXXXXXSCYFCSDVTA 418
PTVLASRHKKIAISVAIGFDTYVIIRHGIG SCYFCSDVTA
Sbjct: 450 PTVLASRHKKIAISVAIGFDTYVIIRHGIGSRSESVSDVSSSDSVPYSQLSCYFCSDVTA 509
Query: 417 PGNSTFDRTLDQQCTVARPGTSMIASGIAVELLSSVLQYPDPLKTPASHDDNTTVLGAAP 238
PGNSTFDRTLDQQCTVARPGTSMIASGIAVELLSSVLQYPDPLKTPASHDDNTTVLGAAP
Sbjct: 510 PGNSTFDRTLDQQCTVARPGTSMIASGIAVELLSSVLQYPDPLKTPASHDDNTTVLGAAP 569
Query: 237 HQIRGFLGRFQQILPSVKRFDQCVACGDAIAAQFQQNGWKFVRDVMNSPGRLEEVTGLDE 58
HQIRGFLGRFQQILPSVKRFDQCVACGDAIAAQFQQNGWKFVRDVMNSPGRLEEVTGLDE
Sbjct: 570 HQIRGFLGRFQQILPSVKRFDQCVACGDAIAAQFQQNGWKFVRDVMNSPGRLEEVTGLDE 629
Query: 57 LQNSVNA 37
LQNSVNA
Sbjct: 630 LQNSVNA 636