Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y57E12B_3
(1218 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25149620|ref|NP_504756.2| putative protein, with a transmembr... 667 0.0
gi|17566020|ref|NP_504757.1| predicted CDS, putative secreted or... 105 2e-21
gi|39590304|emb|CAE66043.1| Hypothetical protein CBG11242 [Caeno... 65 4e-09
gi|45552307|ref|NP_995676.1| CG33300-PA [Drosophila melanogaster... 65 4e-09
gi|39590335|emb|CAE66074.1| Hypothetical protein CBG11288 [Caeno... 64 7e-09
gi|33300082|emb|CAE17706.1| Hypothetical protein C30H6.11 [Caeno... 64 9e-09
gi|24658342|ref|NP_647965.1| CG4835-PA [Drosophila melanogaster]... 64 9e-09
gi|24641644|ref|NP_727652.1| CG32644-PB [Drosophila melanogaster... 64 9e-09
gi|50556110|ref|XP_505463.1| hypothetical protein [Yarrowia lipo... 63 1e-08
gi|46229571|gb|EAK90389.1| cryptopsoridial mucin, large thr stre... 63 2e-08
gi|7494135|pir||T31113 mucin-like glycoprotein 900 - Cryptospori... 63 2e-08
gi|17221106|gb|AAK61480.1| glycoprotein gp2 [Equine herpesvirus 1] 62 2e-08
gi|17737563|ref|NP_524024.1| CG11720-PA [Drosophila melanogaster... 62 2e-08
gi|24663552|ref|NP_648610.1| CG14120-PA [Drosophila melanogaster... 61 6e-08
gi|17221114|gb|AAK61484.1| glycoprotein gp2 [Equine herpesvirus 1] 60 1e-07
gi|50306747|ref|XP_453348.1| unnamed protein product [Kluyveromy... 60 1e-07
gi|46228293|gb|EAK89192.1| very large probable mucin, 11700 aa l... 60 1e-07
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]... 60 1e-07
gi|27552774|gb|AAH42902.1| Muc10 protein [Mus musculus] 60 1e-07
gi|280630|pir||A60095 larval glue protein Lgp-1 precursor - frui... 60 1e-07
gi|17221112|gb|AAK61483.1| glycoprotein gp2 [Equine herpesvirus 1] 60 1e-07
gi|28574039|ref|NP_523475.2| CG3047-PA [Drosophila melanogaster]... 60 1e-07
gi|6678962|ref|NP_032670.1| mucin 10 [Mus musculus] >gnl|BL_ORD_... 60 1e-07
gi|995765|gb|AAA75589.1| mucin 59 2e-07
gi|50307991|ref|XP_453995.1| unnamed protein product [Kluyveromy... 59 2e-07
gi|134786|sp|P10667|MUA1_XENLA Integumentary mucin A.1 precursor... 59 2e-07
gi|17221098|gb|AAK61476.1| glycoprotein gp2 [Equine herpesvirus 1] 59 2e-07
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam... 59 3e-07
gi|17221108|gb|AAK61481.1| glycoprotein gp2 [Equine herpesvirus 1] 59 3e-07
gi|17221116|gb|AAK61485.1| glycoprotein gp2 [Equine herpesvirus 1] 59 3e-07
gi|7287821|gb|AAF44859.1| hypothetical protein [Drosophila melan... 59 3e-07
gi|39583863|emb|CAE63953.1| Hypothetical protein CBG08535 [Caeno... 59 3e-07
gi|31232507|ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambi... 59 3e-07
gi|45552373|ref|NP_995709.1| CG32972-PA [Drosophila melanogaster... 59 3e-07
gi|17221104|gb|AAK61479.1| glycoprotein gp2 [Equine herpesvirus 1] 59 3e-07
gi|38492189|gb|AAR22399.1| antigenic cell wall protein MP2 [Aspe... 58 4e-07
gi|42795202|gb|AAS45959.1| envelope glycoprotein [Equine herpesv... 58 4e-07
gi|11362263|pir||T46740 microfilarial sheath protein SHP3 [impor... 58 4e-07
gi|20128875|ref|NP_569927.1| CG14796-PA [Drosophila melanogaster... 58 5e-07
gi|7511432|pir||T21460 hypothetical protein ZK945.10 - Caenorhab... 58 5e-07
gi|17535137|ref|NP_496184.1| location Of Vulva defective LOV-1, ... 58 5e-07
gi|39583830|emb|CAE74903.1| Hypothetical protein CBG22772 [Caeno... 57 7e-07
gi|17221110|gb|AAK61482.1| glycoprotein gp2 [Equine herpesvirus 1] 57 7e-07
gi|7504248|pir||T22696 hypothetical protein F55B11.3 - Caenorhab... 57 7e-07
gi|48824054|ref|ZP_00285484.1| hypothetical protein Efae03002600... 57 9e-07
gi|6322611|ref|NP_012685.1| Delayed Anaerobic Gene; Dan4p [Sacch... 57 9e-07
gi|50313312|ref|YP_053115.1| membrane glycoprotein [Equine herpe... 57 9e-07
gi|39579121|emb|CAE56545.1| Hypothetical protein CBG24276 [Caeno... 57 1e-06
gi|17221102|gb|AAK61478.1| glycoprotein gp2 [Equine herpesvirus 1] 56 1e-06
gi|50545139|ref|XP_500107.1| hypothetical protein [Yarrowia lipo... 56 1e-06
gi|17384256|emb|CAC83675.1| mucin 5 [Homo sapiens] 56 2e-06
gi|1082604|pir||S53363 mucin 5AC (clone JER58) - human (fragment... 56 2e-06
gi|11278206|pir||T45463 membrane glycoprotein [imported] - equin... 56 2e-06
gi|5031925|ref|NP_005798.1| proteoglycan 4; megakaryocyte stimul... 56 2e-06
gi|39580035|emb|CAE71561.1| Hypothetical protein CBG18510 [Caeno... 55 3e-06
gi|11278205|pir||T45462 membrane glycoprotein [imported] - equin... 55 3e-06
gi|13559026|emb|CAC36090.1| bG174L6.2 (MSF: megakaryocyte stimul... 55 3e-06
gi|24639647|ref|NP_726915.1| CG32774-PA [Drosophila melanogaster... 55 4e-06
gi|111978|pir||S24169 mucin - rat 54 7e-06
gi|49093974|ref|XP_408448.1| hypothetical protein AN4311.2 [Aspe... 54 7e-06
gi|19424152|ref|NP_598197.1| mucin 10 [Rattus norvegicus] >gnl|B... 54 7e-06
gi|31206185|ref|XP_312044.1| ENSANGP00000016899 [Anopheles gambi... 54 7e-06
gi|32264364|gb|AAP78680.1| MBCTL1 [Monosiga brevicollis] 54 1e-05
gi|4505285|ref|NP_002448.1| mucin 2 [Homo sapiens] >gnl|BL_ORD_I... 53 1e-05
gi|188864|gb|AAA59875.1| mucin 53 1e-05
gi|2135765|pir||A43932 mucin 2 precursor, intestinal - human (fr... 53 1e-05
gi|186396|gb|AAA59163.1| mucin 53 1e-05
gi|32405794|ref|XP_323510.1| hypothetical protein [Neurospora cr... 53 2e-05
gi|41147656|ref|XP_168583.4| similar to intestinal membrane muci... 53 2e-05
gi|17566006|ref|NP_505150.1| putative protein (5I806) [Caenorhab... 53 2e-05
gi|16944644|emb|CAD11404.1| hypothetical protein [Neurospora cra... 53 2e-05
gi|39590338|emb|CAE66077.1| Hypothetical protein CBG11292 [Caeno... 53 2e-05
gi|46227173|gb|EAK88123.1| hypothetical protein cgd5_1220 [Crypt... 53 2e-05
gi|17221100|gb|AAK61477.1| glycoprotein gp2 [Equine herpesvirus 1] 53 2e-05
gi|39592304|emb|CAE75525.1| Hypothetical protein CBG23547 [Caeno... 52 2e-05
gi|46443625|gb|EAL02905.1| hypothetical protein CaO19.1616 [Cand... 52 2e-05
gi|25152063|ref|NP_509435.2| putative protein, with 2 coiled coi... 52 3e-05
gi|46443495|gb|EAL02776.1| hypothetical protein CaO19.9183 [Cand... 52 3e-05
gi|24644030|ref|NP_649481.1| CG12586-PA [Drosophila melanogaster... 52 3e-05
gi|7499248|pir||T25697 hypothetical protein F16F9.2 - Caenorhabd... 52 3e-05
gi|38073487|ref|XP_355243.1| similar to This gene is isolated by... 52 3e-05
gi|45552029|ref|NP_787974.2| CG33196-PB [Drosophila melanogaster... 52 4e-05
gi|3068553|gb|AAC14361.1| glycoprotein Ib [Canis familiaris] 52 4e-05
gi|19571560|emb|CAD27470.1| SPAPB18E9.04c [Schizosaccharomyces p... 52 4e-05
gi|46440327|gb|EAK99634.1| hypothetical protein CaO19.9985 [Cand... 52 4e-05
gi|31231947|ref|XP_318620.1| ENSANGP00000020885 [Anopheles gambi... 52 4e-05
gi|39590902|emb|CAE58682.1| Hypothetical protein CBG01856 [Caeno... 52 4e-05
gi|32566278|ref|NP_500256.2| predicted CDS, putative membrane pr... 52 4e-05
gi|46440238|gb|EAK99546.1| hypothetical protein CaO19.2449 [Cand... 52 4e-05
gi|38108069|gb|EAA54157.1| hypothetical protein MG02142.4 [Magna... 51 5e-05
gi|7512018|pir||T13710 protein-tyrosine kinase (EC 2.7.1.112) - ... 51 5e-05
gi|27881486|ref|NP_775078.1| zonadhesin isoform 1 [Homo sapiens]... 51 5e-05
gi|15721995|gb|AAL04410.1| zonadhesin splice variant 1 [Homo sap... 51 5e-05
gi|27881490|ref|NP_775080.1| zonadhesin isoform 4 [Homo sapiens]... 51 5e-05
gi|27881492|ref|NP_775081.1| zonadhesin isoform 5 [Homo sapiens]... 51 5e-05
gi|16554449|ref|NP_003377.1| zonadhesin isoform 3 [Homo sapiens]... 51 5e-05
gi|15721999|gb|AAL04414.1| zonadhesin splice variant 4 [Homo sap... 51 5e-05
gi|27924006|sp|Q9Y493|ZAN_HUMAN Zonadhesin precursor >gnl|BL_ORD... 51 5e-05
gi|15721997|gb|AAL04412.1| zonadhesin splice variant 5 [Homo sap... 51 5e-05
gi|24657801|ref|NP_523928.1| CG7525-PA [Drosophila melanogaster]... 51 5e-05
gi|27881494|ref|NP_775082.1| zonadhesin isoform 6 [Homo sapiens]... 51 5e-05
gi|15721998|gb|AAL04413.1| zonadhesin splice variant 6 [Homo sap... 51 5e-05
gi|7209719|dbj|BAA92310.1| This gene is isolated by means of dif... 51 5e-05
gi|31222803|ref|XP_317226.1| ENSANGP00000022604 [Anopheles gambi... 51 5e-05
gi|15722000|gb|AAL04415.1| zonadhesin splice variant 2 [Homo sap... 51 5e-05
gi|27881488|ref|NP_775079.1| zonadhesin isoform 2 [Homo sapiens]... 51 5e-05
gi|38083062|ref|XP_289814.2| similar to Zonadhesin [Mus musculus] 51 5e-05
gi|24641970|ref|NP_727774.1| CG32602-PA [Drosophila melanogaster... 51 6e-05
gi|19526645|gb|AAL89737.1| intestinal membrane mucin MUC17 [Homo... 51 6e-05
gi|31222811|ref|XP_317227.1| ENSANGP00000025200 [Anopheles gambi... 51 6e-05
gi|50591074|ref|ZP_00332403.1| COG4932: Predicted outer membrane... 51 6e-05
gi|2134574|pir||I51920 mucin - rhesus macaque (fragment) >gnl|BL... 50 8e-05
gi|50306211|ref|XP_453068.1| unnamed protein product [Kluyveromy... 50 8e-05
gi|14041184|emb|CAC38758.1| mucus-like protein [Geodia cydonium] 50 8e-05
gi|48870343|ref|ZP_00323067.1| COG4932: Predicted outer membrane... 50 8e-05
gi|13489279|ref|NP_042028.1| GP protein [Marburg virus] >gnl|BL_... 50 8e-05
gi|39580008|emb|CAE56813.1| Hypothetical protein CBG24626 [Caeno... 50 8e-05
gi|1403333|emb|CAA52910.1| mucin [Homo sapiens] 50 8e-05
gi|22788859|ref|NP_690573.1| hypothetical protein HZV_154 [Helio... 50 1e-04
gi|46435796|gb|EAK95170.1| hypothetical protein CaO19.4072 [Cand... 50 1e-04
gi|19921106|ref|NP_609433.1| CG17104-PA [Drosophila melanogaster... 50 1e-04
gi|22026893|ref|NP_611285.2| CG5765-PA [Drosophila melanogaster]... 50 1e-04
gi|39590900|emb|CAE58680.1| Hypothetical protein CBG01854 [Caeno... 50 1e-04
gi|24641972|ref|NP_727775.1| CG32602-PB [Drosophila melanogaster... 50 1e-04
gi|31559809|ref|NP_853522.1| polycystic kidney disease 1 like 3;... 50 1e-04
gi|50547915|ref|XP_501427.1| hypothetical protein [Yarrowia lipo... 50 1e-04
gi|13492037|gb|AAK28052.1| Zonadhesin >gnl|BL_ORD_ID|1548452 gi|... 50 1e-04
gi|24571157|gb|AAN62894.1| cell wall protein; Sed1p [Saccharomyc... 50 1e-04
gi|585527|sp|Q05049|MUC1_XENLA Integumentary mucin C.1 (FIM-C.1)... 50 1e-04
gi|24571166|gb|AAN62897.1| cell wall protein; Sed1p [Saccharomyc... 50 1e-04
gi|46435639|gb|EAK95016.1| hypothetical protein CaO19.11553 [Can... 49 2e-04
gi|50747896|ref|XP_421035.1| PREDICTED: similar to Mucin 2 precu... 49 2e-04
gi|17221136|gb|AAK58435.1| glycoprotein gp2 [Equine herpesvirus 4] 49 2e-04
gi|2853301|gb|AAC02272.1| mucin [Homo sapiens] 49 2e-04
gi|6466801|gb|AAF13032.1| intestinal mucin 3 [Homo sapiens] 49 2e-04
gi|31222787|ref|XP_317225.1| ENSANGP00000012001 [Anopheles gambi... 49 2e-04
gi|7495878|pir||T29634 hypothetical protein C12D12.1 - Caenorhab... 49 2e-04
gi|17221126|gb|AAK61490.1| glycoprotein gp2 [Equine herpesvirus 4] 49 2e-04
gi|46441846|gb|EAL01140.1| hypothetical protein CaO19.301 [Candi... 49 2e-04
gi|49111144|ref|XP_411791.1| hypothetical protein AN7654.2 [Aspe... 49 2e-04
gi|42659788|ref|XP_039877.8| mucin 5, subtype B, tracheobronchia... 49 2e-04
gi|49124753|ref|XP_412621.1| hypothetical protein AN8484.2 [Aspe... 49 2e-04
gi|38146297|gb|AAR11511.1| promastigote surface antigen GP46 [Le... 49 2e-04
gi|17563696|ref|NP_506388.1| tenascin (5O183) [Caenorhabditis el... 49 2e-04
gi|19527573|gb|AAL89901.1| RE37683p [Drosophila melanogaster] 49 2e-04
gi|45188073|ref|NP_984296.1| ADR200Cp [Eremothecium gossypii] >g... 49 2e-04
gi|23821885|sp|Q9HC84|MU5B_HUMAN Mucin 5B precursor (Mucin 5 sub... 49 3e-04
gi|41148032|ref|XP_374501.1| similar to intestinal mucin 3 [Homo... 49 3e-04
gi|6164595|gb|AAF04457.1| lacunin [Manduca sexta] 49 3e-04
gi|41147654|ref|XP_168578.4| mucin 3B [Homo sapiens] 49 3e-04
gi|46090783|dbj|BAD13529.1| collagen-binding adhesin [Streptococ... 49 3e-04
gi|29374744|ref|NP_813896.1| cell wall surface anchor family pro... 49 3e-04
gi|11360308|pir||T45025 mucin MUC5B, tracheobronchial [imported]... 49 3e-04
gi|11968243|ref|NP_072030.1| cell wall anchoring protein [Entero... 49 3e-04
gi|3135306|gb|AAC78790.1| zonadhesin [Homo sapiens] 49 3e-04
gi|50304613|ref|XP_452262.1| unnamed protein product [Kluyveromy... 49 3e-04
gi|21693269|gb|AAM75216.1| EF0010 [Enterococcus faecalis] 48 4e-04
gi|39589211|emb|CAE57944.1| Hypothetical protein CBG00999 [Caeno... 48 4e-04
gi|29375118|ref|NP_814271.1| cell wall surface anchor family pro... 48 4e-04
gi|46444373|gb|EAL03648.1| hypothetical protein CaO19.9067 [Cand... 48 4e-04
gi|50549489|ref|XP_502215.1| hypothetical protein [Yarrowia lipo... 48 4e-04
gi|17221124|gb|AAK61489.1| glycoprotein gp2 [Equine herpesvirus 4] 48 4e-04
gi|49120840|ref|XP_412378.1| hypothetical protein AN8241.2 [Aspe... 48 4e-04
gi|547938|sp|Q02496|MUC1_MOUSE Mucin 1 precursor (Polymorphic ep... 48 4e-04
gi|39581621|emb|CAE58406.1| Hypothetical protein CBG01536 [Caeno... 48 5e-04
gi|50417619|ref|XP_457707.1| unnamed protein product [Debaryomyc... 48 5e-04
gi|23484531|gb|EAA19833.1| hypothetical protein [Plasmodium yoel... 48 5e-04
gi|7513165|pir||PC4397 mucin 3 T10 - human (fragment) >gnl|BL_OR... 48 5e-04
gi|39590426|emb|CAE66165.1| Hypothetical protein CBG11402 [Caeno... 48 5e-04
gi|17538770|ref|NP_502375.1| predicted CDS, receptor for egg jel... 47 7e-04
gi|10863207|gb|AAG23932.1| collagen adhesin precursor [Enterococ... 47 7e-04
gi|13277318|emb|CAC34385.1| putative cellulosomal anchoring prot... 47 7e-04
gi|17534551|ref|NP_494923.1| putative protein (2F299) [Caenorhab... 47 7e-04
gi|2135768|pir||S35047 mucin JUL7 - human >gnl|BL_ORD_ID|172741 ... 47 7e-04
gi|50542920|ref|XP_499626.1| hypothetical protein [Yarrowia lipo... 47 7e-04
gi|39580036|emb|CAE71562.1| Hypothetical protein CBG18512 [Caeno... 47 7e-04
gi|6322209|ref|NP_012284.1| GPI-anchored cell surface glycoprote... 47 7e-04
gi|24585910|ref|NP_610188.1| CG14470-PA [Drosophila melanogaster... 47 7e-04
gi|22970204|ref|ZP_00017330.1| hypothetical protein [Chloroflexu... 47 0.001
gi|107112|pir||A37232 mucin, tracheal (AMN-22) - human (fragment... 47 0.001
gi|34880471|ref|XP_213903.2| similar to This gene is isolated by... 47 0.001
gi|7305293|ref|NP_038633.1| mucin 1, transmembrane [Mus musculus... 47 0.001
gi|9963982|gb|AAG09787.1| repressed by TUP1 protein 1; Rbt1p [Ca... 47 0.001
gi|39581385|emb|CAE69282.1| Hypothetical protein CBG15336 [Caeno... 47 0.001
gi|1582765|prf||2119294A YFW1 gene 47 0.001
gi|50548855|ref|XP_501897.1| hypothetical protein [Yarrowia lipo... 47 0.001
gi|39593504|emb|CAE61796.1| Hypothetical protein CBG05759 [Caeno... 47 0.001
gi|46434432|gb|EAK93842.1| hypothetical protein CaO19.8907 [Cand... 47 0.001
gi|46434465|gb|EAK93874.1| hypothetical protein CaO19.1327 [Cand... 47 0.001
gi|24646232|ref|NP_650174.1| CG4066-PA [Drosophila melanogaster]... 47 0.001
gi|2507049|sp|P46593|HWP1_CANAL Hyphal wall protein 1 (Cell elon... 47 0.001
gi|46434426|gb|EAK93836.1| hypothetical protein CaO19.8901 [Cand... 47 0.001
gi|2275336|gb|AAB64014.1| differentially expressed in relation t... 47 0.001
gi|18025490|gb|AAK95434.1| gp350 [cercopithicine herpesvirus 15] 47 0.001
gi|47077384|dbj|BAD18580.1| unnamed protein product [Homo sapiens] 47 0.001
gi|24641527|ref|NP_572797.1| CG11245-PA [Drosophila melanogaster... 47 0.001
gi|48130453|ref|XP_393317.1| similar to ENSANGP00000006359 [Apis... 47 0.001
gi|7595974|gb|AAF64523.1| cervical mucin MUC5B [Homo sapiens] 47 0.001
gi|39594200|emb|CAE70310.1| Hypothetical protein CBG16832 [Caeno... 47 0.001
gi|11359723|pir||T46707 proteophosphoglycan, membrane-associated... 47 0.001
gi|42520576|ref|NP_966491.1| hypothetical protein WD0733 [Wolbac... 46 0.002
gi|46127759|ref|XP_388433.1| hypothetical protein FG08257.1 [Gib... 46 0.002
gi|2853299|gb|AAC02271.1| mucin [Homo sapiens] 46 0.002
gi|13529407|gb|AAH05441.1| Mucin 1, transmembrane [Mus musculus] 46 0.002
gi|25406831|pir||E86185 hypothetical protein [imported] - Arabid... 46 0.002
gi|24582793|ref|NP_723377.1| CG31901-PA [Drosophila melanogaster... 46 0.002
gi|46397621|sp|P98088|MU5A_HUMAN Mucin 5AC (Mucin 5 subtype AC, ... 46 0.002
gi|34328647|gb|AAO83650.1| putative protein Roco5 [Dictyostelium... 46 0.002
gi|28828844|gb|AAO51439.1| similar to Homo sapiens (Human). Muci... 46 0.002
gi|17221120|gb|AAK61487.1| glycoprotein gp2 [Equine herpesvirus 4] 46 0.002
gi|17221122|gb|AAK61488.1| glycoprotein gp2 [Equine herpesvirus 4] 46 0.002
gi|684940|gb|AAB54078.1| unknown 46 0.002
gi|49106150|ref|XP_411399.1| hypothetical protein AN7262.2 [Aspe... 46 0.002
gi|2081630|gb|AAB54079.1| unknown [Dictyostelium discoideum] 46 0.002
gi|7446926|pir||S72384 hypothetical protein 8 precursor - Entero... 46 0.002
gi|17384258|emb|CAC83676.1| mucin 5 [Homo sapiens] 46 0.002
gi|24651944|ref|NP_610437.1| CG8181-PA [Drosophila melanogaster]... 46 0.002
gi|32566191|ref|NP_503091.2| c-type lectin family member (4S295)... 46 0.002
gi|7493929|pir||JW0067 chitinase (EC 3.2.1.14) A - Emericella ni... 46 0.002
gi|23613038|ref|NP_703360.1| interspersed repeat antigen, putati... 46 0.002
gi|7513164|pir||PC4395 mucin 3 - human (fragment) >gnl|BL_ORD_ID... 46 0.002
gi|24571163|gb|AAN62896.1| cell wall protein; Sed1p [Saccharomyc... 46 0.002
gi|17570615|ref|NP_508857.1| putative protein (XF654) [Caenorhab... 46 0.002
gi|24637972|gb|AAN63949.1| peritrophic matrix insect intestinal ... 46 0.002
gi|17560816|ref|NP_506530.1| predicted CDS, sushi domain/SCR dom... 46 0.002
gi|9629583|ref|NP_044888.1| glycoprotein 150 [murid herpesvirus ... 46 0.002
gi|50305509|ref|XP_452714.1| unnamed protein product [Kluyveromy... 46 0.002
gi|7510771|pir||T29919 hypothetical protein ZC449.5 - Caenorhabd... 46 0.002
gi|46123493|ref|XP_386300.1| hypothetical protein FG06124.1 [Gib... 46 0.002
gi|6324372|ref|NP_014442.1| Anchorage subunit of a-agglutinin of... 46 0.002
gi|39585659|emb|CAE59861.1| Hypothetical protein CBG03336 [Caeno... 46 0.002
gi|12005631|gb|AAG44545.1| mucin cell adhesion molecule MucCam [... 45 0.003
gi|45269279|gb|AAS56019.1| YDR077W [Saccharomyces cerevisiae] 45 0.003
gi|6320282|ref|NP_010362.1| Isolated as a suppressor of an erd2 ... 45 0.003
gi|9629801|ref|NP_045288.1| 71 [Equine herpesvirus 4] >gnl|BL_OR... 45 0.003
gi|18447198|gb|AAL68190.1| GH09355p [Drosophila melanogaster] 45 0.003
gi|1019435|gb|AAC46906.1| mucin-like protein 45 0.003
gi|6321759|ref|NP_011835.1| cell wall integrity and stress respo... 45 0.003
gi|31197257|ref|XP_307576.1| ENSANGP00000023198 [Anopheles gambi... 45 0.003
gi|32564127|ref|NP_494738.2| GPS domain containing protein (2E48... 45 0.003
gi|37048692|gb|AAQ84882.1| methuselah-like protein MTH-2 [Caenor... 45 0.003
gi|48841425|emb|CAG15047.1| hyphal wall protein [Candida dublini... 45 0.003
gi|24662885|ref|NP_648504.1| CG6004-PB [Drosophila melanogaster]... 45 0.003
gi|24650473|ref|NP_651520.1| CG6296-PA [Drosophila melanogaster]... 45 0.003
gi|50302291|ref|XP_451080.1| unnamed protein product [Kluyveromy... 45 0.003
gi|7500238|pir||T34248 hypothetical protein F31D5.4 - Caenorhabd... 45 0.003
gi|27805612|sp|Q62635|MUC2_RAT Mucin 2 precursor (Intestinal muc... 45 0.003
gi|548937|sp|Q06852|SLP1_CLOTM CELL SURFACE GLYCOPROTEIN 1 PRECU... 45 0.003
gi|32563699|ref|NP_871809.1| carboxypeptidase activation peptide... 45 0.003
gi|48858286|ref|ZP_00312245.1| hypothetical protein Chte02002468... 45 0.003
gi|45190584|ref|NP_984838.1| AEL023Cp [Eremothecium gossypii] >g... 45 0.003
gi|24661848|ref|NP_648349.1| CG16707-PC [Drosophila melanogaster... 45 0.003
gi|20385612|gb|AAM21357.1| mucin-like protein 1 [Ctenocephalides... 45 0.003
gi|39590522|emb|CAE66262.1| Hypothetical protein CBG11506 [Caeno... 45 0.003
gi|2224921|gb|AAC47557.1| insect intestinal mucin IIM22 [Trichop... 45 0.003
gi|2224919|gb|AAC47556.1| insect intestinal mucin IIM14 [Trichop... 45 0.003
gi|34500584|gb|AAQ73824.1| intestinal mucin MUC3A precursor [Hom... 45 0.003
gi|29377839|ref|NP_816967.1| cell wall surface anchor signal pro... 45 0.003
gi|46228644|gb|EAK89514.1| secreted protein with cysteine rich r... 45 0.003
gi|24571155|gb|AAN62893.1| cell wall protein; Sed1p [Saccharomyc... 45 0.003
gi|29826652|ref|NP_821286.1| hypothetical protein SAV112 [Strept... 45 0.005
gi|49091634|ref|XP_407278.1| hypothetical protein AN3141.2 [Aspe... 45 0.005
gi|39593170|emb|CAE64639.1| Hypothetical protein CBG09401 [Caeno... 45 0.005
gi|33310026|gb|AAQ03243.1| putative cell wall protein FLO11p [Ca... 45 0.005
gi|17508901|ref|NP_490780.1| carboxypeptidase activation peptide... 45 0.005
gi|7494070|pir||S20074 promastigote surface antigen P2 (clone 4.... 45 0.005
gi|37962892|gb|AAR05800.1| ICHIT [Anopheles gambiae] 45 0.005
gi|48095295|ref|XP_394403.1| similar to ENSANGP00000017739 [Apis... 45 0.005
gi|7489925|pir||T31108 cyst germination specific acidic repeat p... 45 0.005
gi|39595827|emb|CAE67330.1| Hypothetical protein CBG12792 [Caeno... 45 0.005
gi|17550658|ref|NP_510436.1| putative protein (XP289) [Caenorhab... 45 0.005
gi|46139243|ref|XP_391312.1| hypothetical protein FG11136.1 [Gib... 45 0.005
gi|39585192|emb|CAE57435.1| Hypothetical protein CBG00396 [Caeno... 45 0.005
gi|39585194|emb|CAE57437.1| Hypothetical protein CBG00399 [Caeno... 45 0.005
gi|19070694|gb|AAL83960.1| cell surface protein A [Streptococcus... 44 0.006
gi|46432914|gb|EAK92376.1| hypothetical protein CaO19.3380 [Cand... 44 0.006
gi|28572036|ref|NP_788752.1| CG33103-PA [Drosophila melanogaster... 44 0.006
gi|2133239|pir||JC4566 chitinase (EC 3.2.1.14) 2 precursor - Coc... 44 0.006
gi|543415|pir||PC2022 mucin like protein Muc2 precursor - rat (f... 44 0.006
gi|1705806|sp|P54197|CHI2_COCIM Endochitinase 2 precursor >gnl|B... 44 0.006
gi|2853295|gb|AAC02269.1| intestinal mucin [Homo sapiens] 44 0.006
gi|34148419|gb|AAQ62717.1| G protein [Human metapneumovirus] 44 0.006
gi|28572038|ref|NP_788751.1| CG33103-PB [Drosophila melanogaster... 44 0.006
gi|6754038|ref|NP_034456.1| glycoprotein 1b, alpha polypeptide [... 44 0.006
gi|34869251|ref|XP_221384.2| similar to Heterodimeric complex co... 44 0.006
gi|17550358|ref|NP_508603.1| putative protein, with at least 2 t... 44 0.006
gi|23956252|ref|NP_536705.1| mucin 4 [Mus musculus] >gnl|BL_ORD_... 44 0.006
gi|50549699|ref|XP_502320.1| hypothetical protein [Yarrowia lipo... 44 0.006
gi|3617766|emb|CAA09389.1| ICHIT protein [Anopheles gambiae] 44 0.006
gi|17384254|emb|CAC83674.1| mucin 5 [Homo sapiens] 44 0.008
gi|17542476|ref|NP_499893.1| putative nuclear protein (4B23) [Ca... 44 0.008
gi|31208407|ref|XP_313170.1| ENSANGP00000024051 [Anopheles gambi... 44 0.008
gi|11559520|gb|AAG37995.1| extracellular matrix protein papilin ... 44 0.008
gi|7511304|pir||T34513 hypothetical protein ZK783.1 - Caenorhabd... 44 0.008
gi|31204945|ref|XP_311421.1| ENSANGP00000018591 [Anopheles gambi... 44 0.008
gi|172526|gb|AAA35015.1| S1 protein 44 0.008
gi|19113482|ref|NP_596690.1| hypothetical serine-rich secreted p... 44 0.008
gi|50549557|ref|XP_502249.1| hypothetical protein [Yarrowia lipo... 44 0.008
gi|46106168|ref|XP_380587.1| hypothetical protein FG00411.1 [Gib... 44 0.008
gi|32414699|ref|XP_327829.1| hypothetical protein [Neurospora cr... 44 0.008
gi|29423262|gb|AAO84907.1| extracellular matrix protein papilin ... 44 0.008
gi|1085433|pir||S55316 mucin (clone PGM-2B) - pig >gnl|BL_ORD_ID... 44 0.008
gi|29423264|gb|AAO84908.1| extracellular matrix protein papilin ... 44 0.008
gi|37962894|gb|AAR05801.1| ICHIT [Anopheles gambiae] 44 0.008
gi|9367038|gb|AAF87093.1| secreted antigen SagBb [Enterococcus h... 44 0.008
gi|46111133|ref|XP_382624.1| hypothetical protein FG02448.1 [Gib... 44 0.008
gi|758803|gb|AAB70878.1| peritrophin-95 precursor [Lucilia cuprina] 44 0.010
gi|50306081|ref|XP_453002.1| unnamed protein product [Kluyveromy... 44 0.010
gi|39596372|emb|CAE70010.1| Hypothetical protein CBG16424 [Caeno... 44 0.010
gi|34559870|gb|AAQ75559.1| Sr-CI [Drosophila melanogaster] 44 0.010
gi|18858041|ref|NP_572269.1| CG15765-PA [Drosophila melanogaster... 44 0.010
gi|37962900|gb|AAR05804.1| ICHIT [Anopheles gambiae] 44 0.010
gi|50591904|ref|ZP_00333205.1| hypothetical protein Ssui80100002... 44 0.010
gi|32440607|emb|CAA21616.2| Hypothetical protein Y43F8C.16 [Caen... 44 0.010
gi|22970264|ref|ZP_00017376.1| hypothetical protein [Chloroflexu... 44 0.010
gi|28830022|gb|AAO52512.1| similar to Streptococcus pneumoniae. ... 44 0.010
gi|984808|gb|AAA92532.1| peritrophin-95 precursor 44 0.010
gi|34861349|ref|XP_219679.2| similar to RIKEN cDNA 1810055G02 [R... 44 0.010
gi|39595323|emb|CAE60360.1| Hypothetical protein CBG03957 [Caeno... 44 0.010
gi|42733849|gb|AAS38767.1| similar to Leishmania major. Ppg3 [Di... 44 0.010
gi|39593847|emb|CAE62140.1| Hypothetical protein CBG06185 [Caeno... 43 0.013
gi|32563835|ref|NP_497044.2| perlecan, basement membrane heparan... 43 0.013
gi|1314324|gb|AAC59877.1| mucin-like; down-regulated by thyroid ... 43 0.013
gi|2853297|gb|AAC02270.1| intestinal mucin [Homo sapiens] 43 0.013
gi|24571169|gb|AAN62898.1| cell wall protein; Sed1p [Saccharomyc... 43 0.013
gi|30179887|sp|Q06561|UN52_CAEEL Basement membrane proteoglycan ... 43 0.013
gi|49094796|ref|XP_408859.1| hypothetical protein AN4722.2 [Aspe... 43 0.013
gi|17221118|gb|AAK61486.1| glycoprotein gp2 [Equine herpesvirus 4] 43 0.013
gi|34867741|ref|XP_235593.2| similar to submaxillary apomucin [R... 43 0.013
gi|22788712|ref|NP_690420.1| histone h3, h4 [Heliothis zea virus... 43 0.013
gi|28865871|emb|CAD54413.1| secreted gel-forming mucin [Mus musc... 43 0.013
gi|50548313|ref|XP_501626.1| hypothetical protein [Yarrowia lipo... 43 0.013
gi|20301990|ref|NP_620203.1| podocalyxin-like [Rattus norvegicus... 43 0.013
gi|17564964|ref|NP_507993.1| papilin (5V147) [Caenorhabditis ele... 43 0.013
gi|2459878|gb|AAC40459.1| glycoprotein precursor [Marburg virus] 43 0.013
gi|39579415|emb|CAE56721.1| Hypothetical protein CBG24508 [Caeno... 43 0.013
gi|1280434|gb|AAC47118.1| hemomucin 43 0.013
gi|48474505|sp|Q8TFG9|YL61_SCHPO Hypothetical serine/threonine-r... 43 0.017
gi|50547897|ref|XP_501418.1| hypothetical protein [Yarrowia lipo... 43 0.017
gi|24571149|gb|AAN62891.1| cell wall protein; Sed1p [Saccharomyc... 43 0.017
gi|29375675|ref|NP_814829.1| collagen adhesin protein [Enterococ... 43 0.017
gi|38111359|gb|EAA56951.1| hypothetical protein MG07306.4 [Magna... 43 0.017
gi|1079170|pir||S50125 larval glue protein Lgp3 precursor - frui... 43 0.017
gi|24571160|gb|AAN62895.1| cell wall protein; Sed1p [Saccharomyc... 43 0.017
gi|231543|sp|P29760|AMYI_SACDI Glucoamylase S2 precursor (Glucan... 43 0.017
gi|19571553|emb|CAD27464.1| SPAPB15E9.01c [Schizosaccharomyces p... 43 0.017
gi|46137137|ref|XP_390260.1| hypothetical protein FG10084.1 [Gib... 43 0.017
gi|111979|pir||A39321 mucin - rat (fragment) >gnl|BL_ORD_ID|6277... 43 0.017
gi|31203355|ref|XP_310626.1| ENSANGP00000020758 [Anopheles gambi... 43 0.017
gi|39592372|emb|CAE63449.1| Hypothetical protein CBG07908 [Caeno... 43 0.017
gi|28828802|gb|AAO51397.1| similar to Delayed Anaerobic Gene; Da... 43 0.017
gi|39582656|emb|CAE73760.1| Hypothetical protein CBG21295 [Caeno... 43 0.017
gi|50549811|ref|XP_502377.1| hypothetical protein [Yarrowia lipo... 43 0.017
gi|39581663|emb|CAE57171.1| Hypothetical protein CBG00005 [Caeno... 42 0.022
gi|2130539|gb|AAC51342.1| mucin MUC5B [Homo sapiens] 42 0.022
gi|28829317|gb|AAO51859.1| similar to Homo sapiens (Human). Muci... 42 0.022
gi|46137839|ref|XP_390611.1| hypothetical protein FG10435.1 [Gib... 42 0.022
gi|2499181|sp|Q28983|ZAN_PIG Zonadhesin precursor >gnl|BL_ORD_ID... 42 0.022
gi|2196910|gb|AAB61262.1| polythreonine protein [Cryptosporidium... 42 0.022
gi|39594394|emb|CAE71972.1| Hypothetical protein CBG19045 [Caeno... 42 0.022
gi|7494069|pir||S20075 promastigote surface antigen P2 (clone 2.... 42 0.022
gi|7507975|pir||T34369 hypothetical protein T19D12.1 - Caenorhab... 42 0.022
gi|17536319|ref|NP_495357.1| putative protein family member (2G9... 42 0.022
gi|48122345|ref|XP_396511.1| similar to DNA-binding protein D-ET... 42 0.022
gi|24640934|ref|NP_572598.1| CG2989-PA [Drosophila melanogaster]... 42 0.022
gi|31217881|ref|XP_316525.1| ENSANGP00000013526 [Anopheles gambi... 42 0.022
gi|6760650|gb|AAC14227.2| mucin-like protein [Trypanosoma cruzi] 42 0.029
gi|37694896|gb|AAR00218.1| glycoprotein G [Respiratory syncytial... 42 0.029
gi|135532|sp|P23253|TCNA_TRYCR Sialidase (Neuraminidase) (NA) (M... 42 0.029
gi|46120338|ref|XP_384992.1| hypothetical protein FG04816.1 [Gib... 42 0.029
gi|5815436|gb|AAD52672.1| 98kDa HDM allergen [Dermatophagoides f... 42 0.029
gi|34334623|gb|AAQ64798.1| Sr-CI [Drosophila simulans] >gnl|BL_O... 42 0.029
gi|29835191|gb|AAH51076.1| BC051076 protein [Mus musculus] 42 0.029
gi|46228470|gb|EAK89340.1| uncharacterized protein with threonin... 42 0.029
gi|28972878|dbj|BAC65855.1| mKIAA1930 protein [Mus musculus] 42 0.029
gi|38080239|ref|XP_144407.3| similar to BC051076 protein [Mus mu... 42 0.029
gi|37962902|gb|AAR05805.1| ICHIT [Anopheles gambiae] 42 0.029
gi|37962904|gb|AAR05806.1| ICHIT [Anopheles gambiae] 42 0.029
gi|33328815|gb|AAQ09814.1| CG4363 [Drosophila yakuba] 42 0.029
gi|28828569|gb|AAO51173.1| similar to Dictyostelium discoideum (... 42 0.029
gi|34555857|emb|CAB02487.3| Hypothetical protein F15D4.4 [Caenor... 42 0.029
gi|39585368|emb|CAE61690.1| Hypothetical protein CBG05636 [Caeno... 42 0.029
gi|31238311|ref|XP_319745.1| ENSANGP00000006359 [Anopheles gambi... 42 0.029
gi|20453840|gb|AAM22152.1| unknown [porcine lymphotropic herpesv... 42 0.029
gi|17221134|gb|AAK58434.1| glycoprotein gp2 [Equine herpesvirus 4] 42 0.029
gi|20987831|gb|AAH30451.1| 2310066E14Rik protein [Mus musculus] 42 0.029
gi|37962898|gb|AAR05803.1| ICHIT [Anopheles gambiae] 42 0.038
gi|542705|pir||A44146 syndecan-3 - chicken (fragment) 42 0.038
gi|45382403|ref|NP_990714.1| syndecan-3 proteoglycan [Gallus gal... 42 0.038
gi|38090281|ref|XP_357986.1| similar to mucin 16 [Mus musculus] 42 0.038
gi|6320628|ref|NP_010708.1| Serine/threonine rich cell surface p... 42 0.038
gi|1170299|sp|P41809|HKR1_YEAST Hansenula MRAKII killer toxin-re... 42 0.038
gi|17552746|ref|NP_497912.1| chitin binding Peritrophin-A precur... 42 0.038
gi|46113561|ref|ZP_00183067.2| COG0744: Membrane carboxypeptidas... 42 0.038
gi|17221132|gb|AAK58433.1| glycoprotein gp2 [Equine herpesvirus 4] 42 0.038
gi|9695347|gb|AAF97432.1| VsaC1 [Mycoplasma pulmonis] 42 0.038
gi|17367423|sp|Q9WTQ2|PODX_RAT Podocalyxin precursor >gnl|BL_ORD... 42 0.038
gi|18543303|ref|NP_570034.1| CG14419-PA [Drosophila melanogaster... 42 0.038
gi|48098141|ref|XP_393988.1| similar to ENSANGP00000003674 [Apis... 42 0.038
gi|2136504|pir||I47141 gastric mucin (clone PGM-2A) - pig (fragm... 42 0.038
gi|1155358|gb|AAA97877.1| microfilarial sheath protein SHP3 prec... 42 0.038
gi|45198709|ref|NP_985738.1| AFR191Cp [Eremothecium gossypii] >g... 42 0.038
gi|39593626|emb|CAE61918.1| Hypothetical protein CBG05914 [Caeno... 42 0.038
gi|17533605|ref|NP_495511.1| thyroid peroxidase precursor (2H539... 41 0.050
gi|37962896|gb|AAR05802.1| ICHIT [Anopheles gambiae] 41 0.050
gi|46432987|gb|EAK92446.1| hypothetical protein CaO19.8926 [Cand... 41 0.050
gi|50754169|ref|XP_414269.1| PREDICTED: similar to alpha dystrog... 41 0.050
gi|37694898|gb|AAR00219.1| glycoprotein G [Respiratory syncytial... 41 0.050
gi|41057552|ref|NP_958025.1| ORF116 hypothetical protein [Bovine... 41 0.050
gi|49091260|ref|XP_407091.1| hypothetical protein AN2954.2 [Aspe... 41 0.050
gi|46852140|ref|YP_012612.1| attachment glycoprotein G [Human me... 41 0.050
gi|39580034|emb|CAE71560.1| Hypothetical protein CBG18509 [Caeno... 41 0.050
gi|663232|emb|CAA88141.1| orf [Saccharomyces cerevisiae] 41 0.050
gi|27469167|ref|NP_765804.1| streptococcal hemagglutinin protein... 41 0.050
gi|46226738|gb|EAK87717.1| uncharacterized secreted protein with... 41 0.050
gi|19115506|ref|NP_594594.1| putative vesicle associated membarn... 41 0.050
gi|31207057|ref|XP_312495.1| ENSANGP00000022047 [Anopheles gambi... 41 0.050
gi|9965400|gb|AAG10075.1| membrane virion glycoprotein 150 [muri... 41 0.050
gi|6322237|ref|NP_012311.1| Hypothetical ORF; Yjl225cp [Saccharo... 41 0.050
gi|6322017|ref|NP_012092.1| Hypothetical ORF; Yil177cp [Saccharo... 41 0.050
gi|22788790|ref|NP_690502.1| von Willebrand factor [Heliothis ze... 41 0.050
gi|38107576|gb|EAA53727.1| hypothetical protein MG09477.4 [Magna... 41 0.050
gi|21240668|gb|AAM44379.1| hypothetical protein [Dictyostelium d... 41 0.050
gi|45198426|ref|NP_985455.1| AFL095Wp [Eremothecium gossypii] >g... 41 0.050
gi|1582641|prf||2119210A mucin 41 0.050
gi|50543616|ref|XP_499974.1| hypothetical protein [Yarrowia lipo... 41 0.050
gi|17541474|ref|NP_502253.1| no mechanoreceptor potential A like... 41 0.050
gi|39581472|emb|CAE68002.1| Hypothetical protein CBG13612 [Caeno... 41 0.050
gi|2135766|pir||S53362 mucin 5AC (clone JER47) - human (fragment) 41 0.050
gi|32127786|dbj|BAC78176.1| homologue to Drosophila photorecepto... 41 0.065
gi|34809534|gb|AAQ82688.1| Epa4p [Candida glabrata] 41 0.065
gi|39582817|emb|CAE74280.1| Hypothetical protein CBG21976 [Caeno... 41 0.065
gi|46113299|ref|XP_383102.1| hypothetical protein FG02926.1 [Gib... 41 0.065
gi|39581619|emb|CAE58404.1| Hypothetical protein CBG01534 [Caeno... 41 0.065
gi|40456209|gb|AAR86181.1| attachment protein [Human respiratory... 41 0.065
gi|100753|pir||S13383 hydroxyproline-rich glycoprotein - sorghum... 41 0.065
gi|50752393|ref|XP_422770.1| PREDICTED: similar to lysosomal-ass... 41 0.065
gi|37538639|ref|XP_168585.3| similar to mucin 11 [Homo sapiens] ... 41 0.065
gi|11359724|pir||T46726 secreted acid phosphatase 2 precursor [i... 41 0.065
gi|24648119|ref|NP_650778.1| CG6026-PA [Drosophila melanogaster]... 41 0.065
gi|134469|sp|P13728|SGS3_DROYA Salivary glue protein SGS-3 precu... 41 0.065
gi|34334435|gb|AAQ64704.1| Hmu [Drosophila simulans] >gnl|BL_ORD... 41 0.065
gi|34334445|gb|AAQ64709.1| Hmu [Drosophila simulans] 41 0.065
gi|563375|emb|CAA84031.1| mucin [Homo sapiens] 41 0.065
gi|34500586|gb|AAQ73825.1| intestinal mucin MUC3B precursor [Hom... 41 0.065
gi|28829669|gb|AAO52185.1| similar to hypothetical protein [Schi... 40 0.085
gi|38092041|ref|XP_137868.3| similar to proline-rich peptides 63... 40 0.085
gi|627547|pir||A33532 mucin SMUC-40 - human (fragment) >gnl|BL_O... 40 0.085
gi|46445432|gb|EAL04701.1| hypothetical protein CaO19.12372 [Can... 40 0.085
gi|27673011|ref|XP_220573.1| similar to platelet glycoprotein Ib... 40 0.085
gi|23508359|ref|NP_701028.1| hypothetical protein [Plasmodium fa... 40 0.085
gi|1362621|pir||A57096 nudel protein precursor - fruit fly (Dros... 40 0.085
gi|50427481|ref|XP_462353.1| unnamed protein product [Debaryomyc... 40 0.085
gi|44889875|gb|AAS48465.1| attachment glycoprotein [Human metapn... 40 0.085
gi|44889877|gb|AAS48466.1| attachment glycoprotein [Human metapn... 40 0.085
gi|23956226|ref|NP_083077.1| mucin 5, subtype B, tracheobronchia... 40 0.085
gi|46128973|ref|XP_388964.1| hypothetical protein FG08788.1 [Gib... 40 0.085
gi|33300116|emb|CAE17784.1| Hypothetical protein F33E2.7 [Caenor... 40 0.085
gi|31205057|ref|XP_311477.1| ENSANGP00000024130 [Anopheles gambi... 40 0.085
gi|543068|pir||A48292 mucin, tracheobronchial - dog >gnl|BL_ORD_... 40 0.085
gi|39578750|emb|CAE57157.1| Hypothetical protein CBG25091 [Caeno... 40 0.085
gi|40788894|dbj|BAA11487.2| KIAA0170 [Homo sapiens] 40 0.085
gi|13646986|dbj|BAB41080.1| DNA-binding protein DF1 [Pisum sativum] 40 0.085
gi|22024236|ref|NP_611638.2| CG11073-PA [Drosophila melanogaster... 40 0.085
gi|11990203|emb|CAC19572.1| MUC3B mucin [Homo sapiens] 40 0.085
gi|34765003|gb|AAQ82434.1| mucin glycoprotein [Homo sapiens] 40 0.085
gi|50426077|ref|XP_461635.1| unnamed protein product [Debaryomyc... 40 0.085
gi|422832|pir||B46629 mucin 6, gastric (3-repeat clone) - human ... 40 0.11
gi|40788268|dbj|BAA32313.2| KIAA0468 protein [Homo sapiens] 40 0.11
gi|28974510|gb|AAO61685.1| chitinase [Aspergillus fumigatus] 40 0.11
gi|42655886|ref|XP_375712.1| syndecan 3 [Homo sapiens] >gnl|BL_O... 40 0.11
gi|13603729|gb|AAK31912.1| G protein [Human respiratory syncytia... 40 0.11
gi|9929916|dbj|BAB12116.1| intestinal mucin [Homo sapiens] 40 0.11
gi|38086308|ref|XP_141802.3| similar to G-protein coupled recept... 40 0.11
gi|27370871|gb|AAH41236.1| XNopp180 protein [Xenopus laevis] 40 0.11
gi|13649455|gb|AAK37424.1| G glycoprotein [Human respiratory syn... 40 0.11
gi|38110510|gb|EAA56217.1| hypothetical protein MG01868.4 [Magna... 40 0.11
gi|37790522|gb|AAR03412.1| attachment protein [Human respiratory... 40 0.11
gi|6636153|gb|AAF20081.1| G protein [Human respiratory syncytial... 40 0.11
gi|28872825|emb|CAD54415.1| secreted gel-forming mucin [Mus musc... 40 0.11
gi|13810649|gb|AAK39969.1| syndecan 3 [Homo sapiens] 40 0.11
gi|39597748|emb|CAE68440.1| Hypothetical protein CBG14225 [Caeno... 40 0.11
gi|6636161|gb|AAF20085.1| G protein [Human respiratory syncytial... 40 0.11
gi|17568719|ref|NP_508292.1| putative protein family member (XC1... 40 0.11
gi|8886520|gb|AAF80491.1| surface antigen P2 [Leishmania tropica] 40 0.11
gi|19075531|ref|NP_588031.1| hypothetical protein with large rep... 40 0.11
gi|15559239|gb|AAH13974.1| SDC3 protein [Homo sapiens] 40 0.11
gi|9929920|dbj|BAB12118.1| intestinal mucin [Homo sapiens] 40 0.11
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 40 0.11
gi|5326779|gb|AAD42044.1| unknown [Cryptosporidium parvum] 40 0.11
gi|17534947|ref|NP_494708.1| putative secreted or extracellular ... 40 0.11
gi|50304909|ref|XP_452410.1| unnamed protein product [Kluyveromy... 40 0.11
gi|50548999|ref|XP_501970.1| hypothetical protein [Yarrowia lipo... 40 0.11
gi|46229137|gb|EAK89986.1| large extracellular protein with a si... 40 0.15
gi|6911555|emb|CAB72127.1| chitobiase [Arthrobacter sp.] 40 0.15
gi|39591043|emb|CAE58823.1| Hypothetical protein CBG02033 [Caeno... 40 0.15
gi|6324467|ref|NP_014536.1| cell wall integrity and stress respo... 40 0.15
gi|17567957|ref|NP_508986.1| retinal pigment precursor (95.0 kD)... 40 0.15
gi|37790534|gb|AAR03418.1| attachment protein [Human respiratory... 40 0.15
gi|37790524|gb|AAR03413.1| attachment protein [Human respiratory... 40 0.15
>gi|25149620|ref|NP_504756.2| putative protein, with a transmembrane
domain (5H426) [Caenorhabditis elegans]
gi|16604203|gb|AAK68538.2| Hypothetical protein Y57E12B.4
[Caenorhabditis elegans]
Length = 405
Score = 667 bits (1722), Expect = 0.0
Identities = 341/405 (84%), Positives = 341/405 (84%)
Frame = -1
Query: 1218 MPSKTFIAVLCLAIVFYMVTAVPVELVEXXXXXXXXXXXXXXXXSDPTPAGSTETTTKSG 1039
MPSKTFIAVLCLAIVFYMVTAVPVELVE SDPTPAGSTETTTKSG
Sbjct: 1 MPSKTFIAVLCLAIVFYMVTAVPVELVEASASSTTSSVTKNSNSSDPTPAGSTETTTKSG 60
Query: 1038 NGVSMIFTLIPVAIWLLNSYFTTFTKTVGHSFFSWLHKILVDNIFASAASLRDAFFSVIT 859
NGVSMIFTLIPVAIWLLNSYFTTFTKTVGHSFFSWLHKILVDNIFASAASLRDAFFSVIT
Sbjct: 61 NGVSMIFTLIPVAIWLLNSYFTTFTKTVGHSFFSWLHKILVDNIFASAASLRDAFFSVIT 120
Query: 858 QVPCEILEADLSDDSHVTPFIERKHSTPKQNIPTTPCATSPAEIDTTTPQVSSSEPFTTS 679
QVPCEILEADLSDDSHVTPFIERKHSTPKQNIPTTPCATSPAEIDTTTPQVSSSEPFTTS
Sbjct: 121 QVPCEILEADLSDDSHVTPFIERKHSTPKQNIPTTPCATSPAEIDTTTPQVSSSEPFTTS 180
Query: 678 ENSSTAEPFAPSDXXXXXXXXXXXXXXXXXXXEIHYTEKPATLEPSKAPTDDCPTTLVVE 499
ENSSTAEPFAPSD EIHYTEKPATLEPSKAPTDDCPTTLVVE
Sbjct: 181 ENSSTAEPFAPSDSTTSINETQTTSTHAETTPEIHYTEKPATLEPSKAPTDDCPTTLVVE 240
Query: 498 NKTLTPTEHKPTEHSTTIENTEPTTGRDRTTDPVISDKTETPSTNFSTVAENTASSTPIY 319
NKTLTPTEHKPTEHSTTIENTEPTTGRDRTTDPVISDKTETPSTNFSTVAENTASSTPIY
Sbjct: 241 NKTLTPTEHKPTEHSTTIENTEPTTGRDRTTDPVISDKTETPSTNFSTVAENTASSTPIY 300
Query: 318 ITKVPTTFERSEPTMGTEATTDPVFPDKTTNFATVSEHSRSSTPNYIXXXXXXXXXXXXX 139
ITKVPTTFERSEPTMGTEATTDPVFPDKTTNFATVSEHSRSSTPNYI
Sbjct: 301 ITKVPTTFERSEPTMGTEATTDPVFPDKTTNFATVSEHSRSSTPNYITEHPTTFESSTES 360
Query: 138 XXXXXXXXXXXXXXXXTKVQELTTQTSNGVPLLLSTAIWAIVMWL 4
TKVQELTTQTSNGVPLLLSTAIWAIVMWL
Sbjct: 361 TDDPTPDVTPVVFVQTTKVQELTTQTSNGVPLLLSTAIWAIVMWL 405