Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y57A10A_19
         (561 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17537611|ref|NP_496599.1| thioredoxin-like protein p19 (21.5 ...   291   4e-78
gi|39591419|emb|CAE73473.1| Hypothetical protein CBG20924 [Caeno...   285   3e-76
gi|17567971|ref|NP_508381.1| thioredoxin-like protein p19 (30.2 ...   114   9e-25
gi|39597669|emb|CAE68360.1| Hypothetical protein CBG14099 [Caeno...   111   1e-23
gi|7705696|ref|NP_056997.1| endoplasmic reticulum thioredoxin su...   105   7e-22
gi|28279844|gb|AAH44076.1| Tlp19-prov protein [Xenopus laevis]        104   9e-22
gi|14286234|gb|AAH08913.1| Endoplasmic reticulum thioredoxin sup...   104   1e-21
gi|34870174|ref|XP_216482.2| similar to RIKEN cDNA 0610040B21 [R...   103   2e-21
gi|13384700|ref|NP_079610.1| endoplasmic reticulum protein ERp19...   103   2e-21
gi|50751596|ref|XP_422470.1| PREDICTED: similar to RAB3C, member...    89   7e-17
gi|49522335|gb|AAH75325.1| Unknown (protein for MGC:89004) [Xeno...    72   5e-12
gi|50732569|ref|XP_418698.1| PREDICTED: similar to GOB-4 [Gallus...    67   2e-10
gi|30583839|gb|AAP36168.1| Homo sapiens anterior gradient 2 homo...    67   3e-10
gi|5453541|ref|NP_006399.1| anterior gradient 2 homolog; anterio...    67   3e-10
gi|16588572|gb|AAL26844.1| cement gland-specific protein CGS [Xe...    67   3e-10
gi|46430522|ref|NP_997414.1| RIKEN cDNA E030025L21 gene [Mus mus...    66   5e-10
gi|19484053|gb|AAH23499.1| RIKEN cDNA E030025L21 gene [Mus muscu...    65   6e-10
gi|30704995|gb|AAH52102.1| MGC53762 protein [Xenopus laevis]           65   8e-10
gi|34865124|ref|XP_216693.2| similar to breast cancer membrane p...    65   8e-10
gi|27662826|ref|XP_216691.1| similar to GOB-4 [Rattus norvegicus]      64   2e-09
gi|50732571|ref|XP_418699.1| PREDICTED: similar to RIKEN cDNA E0...    64   2e-09
gi|6753010|ref|NP_035913.1| anterior gradient 2; anterior gradie...    64   2e-09
gi|28827801|ref|NP_789783.1| breast cancer membrane protein 11; ...    63   4e-09
gi|38049437|ref|XP_354667.1| similar to breast cancer membrane p...    62   7e-09
gi|2565327|gb|AAB81968.1| cement gland-specific [Xenopus laevis]...    59   4e-08
gi|47207057|emb|CAF94244.1| unnamed protein product [Tetraodon n...    59   4e-08
gi|2499133|sp|P55868|XAG_XENLA PUTATIVE SECRETED PROTEIN XAG PRE...    58   1e-07
gi|47498026|ref|NP_998864.1| hypothetical protein MGC69318 [Xeno...    57   2e-07
gi|2851525|sp|P55869|NP77_XENLA PUTATIVE SECRETED PROTEIN NP77 P...    56   4e-07
gi|45655644|ref|YP_003453.1| thiol-disulfide interchange like pr...    51   1e-05
gi|24217139|ref|NP_714622.1| TPR-repeat-containing protein [Lept...    51   1e-05
gi|15922618|ref|NP_378287.1| 628aa long conserved hypothetical p...    49   6e-05
gi|48845771|ref|ZP_00300044.1| COG1047: FKBP-type peptidyl-proly...    49   8e-05
gi|15679737|ref|NP_276855.1| protein disulphide isomerase [Metha...    48   1e-04
gi|39596014|emb|CAE67517.1| Hypothetical protein CBG13036 [Caeno...    45   7e-04
gi|47271260|emb|CAE52277.1| anterior gradient 2 homologue [Bos t...    44   0.001
gi|25147430|ref|NP_495615.2| predicted protein of function (82.4...    44   0.002
gi|25326752|pir||A88216 protein B0495.5 [imported] - Caenorhabdi...    44   0.002
gi|48894050|ref|ZP_00327248.1| COG0526: Thiol-disulfide isomeras...    44   0.003
gi|28210673|ref|NP_781617.1| thymidylate kinase [Clostridium tet...    44   0.003
gi|48894426|ref|ZP_00327535.1| COG1331: Highly conserved protein...    43   0.003
gi|11499326|ref|NP_070565.1| conserved hypothetical protein [Arc...    43   0.004
gi|30248134|ref|NP_840204.1| putative similar to unknown protein...    42   0.007
gi|15898979|ref|NP_343584.1| Conserved hypothetical protein [Sul...    42   0.010
gi|47207117|emb|CAF93073.1| unnamed protein product [Tetraodon n...    42   0.010
gi|18313540|ref|NP_560207.1| conserved hypothetical protein [Pyr...    41   0.013
gi|48856612|ref|ZP_00310769.1| COG1331: Highly conserved protein...    41   0.016
gi|15607089|ref|NP_214471.1| hypothetical protein aq_2146 [Aquif...    41   0.016
gi|48862008|ref|ZP_00315906.1| COG0526: Thiol-disulfide isomeras...    40   0.021
gi|41351283|gb|AAH65526.1| SSP411 protein [Homo sapiens]               40   0.021
gi|47211932|emb|CAF92441.1| unnamed protein product [Tetraodon n...    40   0.021
gi|47220234|emb|CAF98999.1| unnamed protein product [Tetraodon n...    40   0.021
gi|17228066|ref|NP_484614.1| thioredoxin-like protein [Nostoc sp...    40   0.021
gi|45547636|ref|ZP_00187680.1| COG1331: Highly conserved protein...    40   0.021
gi|23473886|ref|ZP_00129181.1| COG1331: Highly conserved protein...    40   0.028
gi|16330578|ref|NP_441306.1| thiol:disulfide interchange protein...    40   0.037
gi|24213658|ref|NP_711139.1| conserved hypothetical protein [Lep...    40   0.037
gi|45658527|ref|YP_002613.1| conserved hypothetical protein [Lep...    40   0.037
gi|31542723|ref|NP_073738.2| sperm protein SSP411; transcript in...    39   0.048
gi|21244602|ref|NP_644184.1| disulphide-isomerase [Xanthomonas a...    39   0.048
gi|21233251|ref|NP_639168.1| disulphide-isomerase [Xanthomonas c...    39   0.048
gi|10437433|dbj|BAB15051.1| unnamed protein product [Homo sapiens]     39   0.048
gi|19309415|emb|CAD27314.1| hypothetical protein [Aspergillus fu...    39   0.048
gi|49237261|ref|ZP_00331316.1| COG1331: Highly conserved protein...    39   0.062
gi|23130703|ref|ZP_00112516.1| COG0526: Thiol-disulfide isomeras...    39   0.062
gi|46198930|ref|YP_004597.1| hypothetical conserved protein [The...    39   0.082
gi|45532034|ref|ZP_00183053.1| COG1331: Highly conserved protein...    39   0.082
gi|17064908|gb|AAL32608.1| predicted protein of unknown function...    39   0.082
gi|30679394|ref|NP_192229.3| expressed protein [Arabidopsis thal...    39   0.082
gi|15896782|ref|NP_350131.1| Highly conserved protein containing...    38   0.11
gi|23111586|ref|ZP_00097203.1| COG1331: Highly conserved protein...    38   0.11
gi|20092523|ref|NP_618598.1| conserved hypothetical protein [Met...    38   0.11
gi|46915754|emb|CAG22525.1| conserved hypothetical protein [Phot...    38   0.14
gi|21674102|ref|NP_662167.1| conserved hypothetical protein [Chl...    38   0.14
gi|38091770|ref|XP_354637.1| transcript increased in spermiogene...    38   0.14
gi|48860413|ref|ZP_00314338.1| COG1331: Highly conserved protein...    37   0.18
gi|48853256|ref|ZP_00307436.1| COG1331: Highly conserved protein...    37   0.24
gi|49615095|dbj|BAD24714.2| protein disulfide isomerase-like pro...    37   0.24
gi|40786501|ref|NP_955434.1| sperm protein SSP411 [Rattus norveg...    37   0.24
gi|29840066|ref|NP_829172.1| conserved hypothetical protein [Chl...    37   0.31
gi|15618835|ref|NP_225121.1| Thioredoxin Disulfide Isomerase [Ch...    37   0.31
gi|15678778|ref|NP_275895.1| conserved protein [Methanothermobac...    36   0.40
gi|15790345|ref|NP_280169.1| Vng1303c [Halobacterium sp. NRC-1] ...    36   0.40
gi|46317795|ref|ZP_00218373.1| COG0526: Thiol-disulfide isomeras...    36   0.40
gi|32473422|ref|NP_866416.1| conserved hypothetical protein-puta...    36   0.40
gi|21226721|ref|NP_632643.1| conserved protein [Methanosarcina m...    36   0.40
gi|50728802|ref|XP_416290.1| PREDICTED: similar to FLJ23322 prot...    36   0.40
gi|24214021|ref|NP_711502.1| thiol:disulfide interchange protein...    36   0.53
gi|46579138|ref|YP_009946.1| conserved hypothetical protein [Des...    36   0.53
gi|48840197|ref|ZP_00297125.1| COG1331: Highly conserved protein...    36   0.53
gi|46322800|ref|ZP_00223167.1| COG0526: Thiol-disulfide isomeras...    36   0.53
gi|45658250|ref|YP_002336.1| disulfide interchange transmembrane...    36   0.53
gi|16081134|ref|NP_391962.1| yyaL [Bacillus subtilis subsp. subt...    35   0.69
gi|50254378|gb|EAL17131.1| hypothetical protein CNBN2230 [Crypto...    35   0.69
gi|17228732|ref|NP_485280.1| hypothetical protein [Nostoc sp. PC...    35   0.69
gi|48845914|ref|ZP_00300184.1| COG1331: Highly conserved protein...    35   0.69
gi|28198930|ref|NP_779244.1| disulphide isomerase [Xylella fasti...    35   0.69
gi|22996532|ref|ZP_00040785.1| COG0526: Thiol-disulfide isomeras...    35   0.69
gi|15838432|ref|NP_299120.1| disulphide isomerase [Xylella fasti...    35   0.69
gi|22994227|ref|ZP_00038739.1| COG0526: Thiol-disulfide isomeras...    35   0.69
gi|37521713|ref|NP_925090.1| hypothetical protein gll2144 [Gloeo...    35   0.69
gi|29348478|ref|NP_811981.1| putative disulphide-isomerase [Bact...    35   0.69
gi|5803121|ref|NP_006801.1| for protein disulfide isomerase-rela...    35   0.90
gi|49257111|dbj|BAD24713.1| protein disufide isomerase-like prot...    35   0.90
gi|50750688|ref|XP_422097.1| PREDICTED: similar to Protein disul...    35   0.90
gi|46130315|ref|ZP_00165137.2| COG0526: Thiol-disulfide isomeras...    35   0.90
gi|15605079|ref|NP_219864.1| multidomain protein family [Chlamyd...    35   0.90
gi|12804437|gb|AAH01625.1| PDIR protein [Homo sapiens]                 35   0.90
gi|20129985|ref|NP_610953.1| CG8613-PA [Drosophila melanogaster]...    35   0.90
gi|29373133|gb|AAO72715.1| thioredoxin 2 [Melopsittacus undulatus]     35   1.2
gi|6320303|ref|NP_010383.1| Hydroperoxide and superoxide-radical...    35   1.2
gi|27694724|gb|AAH43794.1| Txn2-prov protein [Xenopus laevis]          35   1.2
gi|22297898|ref|NP_681145.1| thiol:disulfide interchange protein...    35   1.2
gi|46446752|ref|YP_008117.1| conserved hypothetical protein [Par...    35   1.2
gi|49081438|ref|XP_404127.1| hypothetical protein UM06512.1 [Ust...    35   1.2
gi|15835250|ref|NP_297009.1| conserved hypothetical protein [Chl...    35   1.2
gi|49086270|ref|XP_405194.1| hypothetical protein AN1057.2 [Aspe...    34   1.5
gi|47459229|ref|YP_016091.1| truncated maltose-binding protein [...    34   1.5
gi|46119202|ref|ZP_00176226.2| COG0526: Thiol-disulfide isomeras...    34   1.5
gi|14602126|ref|NP_148674.1| hypothetical protein APE2533 [Aerop...    34   2.0
gi|46311192|ref|ZP_00211802.1| COG4232: Thiol:disulfide intercha...    34   2.0
gi|49899130|gb|AAH76861.1| Unknown (protein for MGC:84594) [Xeno...    34   2.0
gi|1709618|sp|P55059|PDI_HUMIN Protein disulfide-isomerase precu...    34   2.0
gi|32477916|ref|NP_870910.1| probable thiol:disulfide interchang...    34   2.0
gi|16758038|ref|NP_445783.1| thioredoxin 2; thioredoxin, mitocho...    34   2.0
gi|1809135|gb|AAB41631.1| thioredoxin [Homo sapiens] >gnl|BL_ORD...    34   2.0
gi|9903609|ref|NP_064297.1| thioredoxin 2; thioredoxin nuclear g...    34   2.0
gi|21361403|ref|NP_036605.2| thioredoxin 2 precursor; mitochondr...    34   2.0
gi|21673901|ref|NP_661966.1| thiol:disulfide interchange protein...    34   2.0
gi|46446581|ref|YP_007946.1| putative thioredoxin [Parachlamydia...    34   2.0
gi|46438572|gb|EAK97900.1| hypothetical protein CaO19.12595 [Can...    33   2.6
gi|48478494|ref|YP_024200.1| thymidylate kinase [Picrophilus tor...    33   2.6
gi|24475865|ref|NP_722576.1| G-protein coupled receptor 112 [Hom...    33   2.6
gi|41152670|gb|AAR34547.2| conserved hypothetical protein [Geoba...    33   2.6
gi|5902592|gb|AAD55566.1| protein disulfide isomerase precursor ...    33   2.6
gi|27806369|ref|NP_776633.1| thioredoxin 2 [Bos taurus] >gnl|BL_...    33   2.6
gi|29611564|gb|AAO85093.1| G protein-coupled receptor GPR112 [Ho...    33   2.6
gi|28828569|gb|AAO51173.1| similar to Dictyostelium discoideum (...    33   3.4
gi|48854435|ref|ZP_00308597.1| COG1331: Highly conserved protein...    33   3.4
gi|28140231|gb|AAO26314.1| protein disulphide isomerase [Elaeis ...    33   3.4
gi|41719191|ref|ZP_00148105.1| COG0526: Thiol-disulfide isomeras...    33   3.4
gi|50789207|dbj|BAD34455.1| protein disulfide isomerase-like pro...    33   3.4
gi|46135803|ref|XP_389593.1| hypothetical protein FG09417.1 [Gib...    33   3.4
gi|46319591|ref|ZP_00219994.1| COG4232: Thiol:disulfide intercha...    33   3.4
gi|33860800|ref|NP_892361.1| thioredoxin-like protein TxlA [Proc...    33   3.4
gi|48861342|ref|ZP_00315245.1| COG4232: Thiol:disulfide intercha...    33   3.4
gi|13473777|ref|NP_105345.1| hypothetical protein mlr4484 [Mesor...    33   4.5
gi|13541562|ref|NP_111250.1| Uncharacterized conserved protein c...    33   4.5
gi|30794140|ref|NP_082571.1| protein disulfide isomerase-related...    33   4.5
gi|39996273|ref|NP_952224.1| conserved hypothetical protein [Geo...    33   4.5
gi|22971243|ref|ZP_00018221.1| hypothetical protein [Chloroflexu...    33   4.5
gi|38080622|ref|XP_358800.1| similar to Protein disulfide isomer...    33   4.5
gi|48110355|ref|XP_393124.1| similar to transcript increased in ...    33   4.5
gi|16923261|dbj|BAB21938.2| H-Haspin [Homo sapiens]                    33   4.5
gi|13994374|ref|NP_114171.1| haspin [Homo sapiens] >gnl|BL_ORD_I...    33   4.5
gi|15226610|ref|NP_182269.1| thioredoxin family protein [Arabido...    32   5.8
gi|47459227|ref|YP_016089.1| truncated maltose-binding protein [...    32   5.8
gi|34496780|ref|NP_900995.1| probable thiol-disulfide isomerase ...    32   5.8
gi|30697408|ref|NP_568926.2| thioredoxin family protein [Arabido...    32   5.8
gi|23126706|ref|ZP_00108595.1| COG1331: Highly conserved protein...    32   5.8
gi|30697404|ref|NP_851234.1| thioredoxin family protein [Arabido...    32   5.8
gi|21593313|gb|AAM65262.1| protein disulfide isomerase precursor...    32   5.8
gi|45387703|ref|NP_991204.1| hypothetical protein zgc:77127 [Dan...    32   5.8
gi|42571269|ref|NP_973708.1| thioredoxin family protein [Arabido...    32   5.8
gi|47092753|ref|ZP_00230538.1| chitin-binding protein/carbohydra...    32   7.6
gi|46908639|ref|YP_015028.1| chitin-binding protein/carbohydrate...    32   7.6
gi|15603570|ref|NP_246644.1| Trx [Pasteurella multocida Pm70] >g...    32   7.6
gi|50745419|ref|XP_420103.1| PREDICTED: similar to Transcript in...    32   7.6
gi|15894361|ref|NP_347710.1| Hypothetical protein, CF-32 family ...    32   7.6
gi|34558295|ref|NP_908110.1| hypothetical protein WS2008 [Woline...    32   7.6
gi|28898780|ref|NP_798385.1| putative suppressor for copper-sens...    32   7.6
gi|11135152|sp|O81332|THIF_MESCR Thioredoxin F-type, chloroplast...    32   7.6
gi|42524631|ref|NP_970011.1| thiol:disulfide interchange protein...    32   7.6
gi|33861642|ref|NP_893203.1| Alpha/beta hydrolase fold:Esterase/...    32   7.6
gi|47222013|emb|CAG08268.1| unnamed protein product [Tetraodon n...    32   10.0
gi|11362263|pir||T46740 microfilarial sheath protein SHP3 [impor...    32   10.0
gi|42541138|gb|AAS19462.1| thioredoxin [Paxillus involutus]            32   10.0
gi|17568717|ref|NP_508293.1| putative protein family member (XC1...    32   10.0
gi|17568719|ref|NP_508292.1| putative protein family member (XC1...    32   10.0
gi|20068287|emb|CAD29445.1| protein disulfide isomerase 1 [Oster...    32   10.0
gi|32034204|ref|ZP_00134426.1| COG4232: Thiol:disulfide intercha...    32   10.0
gi|44889410|gb|AAS48350.1| tryparedoxin [Leishmania infantum]          32   10.0
gi|16123427|ref|NP_406740.1| thioredoxin 2 [Yersinia pestis] >gn...    32   10.0
gi|7437394|pir||T07927 protein disulfide-isomerase (EC 5.3.4.1) ...    32   10.0
gi|28573567|ref|NP_611446.3| CG8517-PA [Drosophila melanogaster]...    32   10.0
gi|32452989|gb|AAP82647.1| Hypothetical protein K06A9.1c [Caenor...    32   10.0
gi|41725960|ref|ZP_00152718.1| COG4232: Thiol:disulfide intercha...    32   10.0


>gi|17537611|ref|NP_496599.1| thioredoxin-like protein p19 (21.5 kD)
           (2M531) [Caenorhabditis elegans]
 gi|7510247|pir||T31643 hypothetical protein Y57A10A.u -
           Caenorhabditis elegans
 gi|5832938|emb|CAB55026.1| Hypothetical protein Y57A10A.23
           [Caenorhabditis elegans]
          Length = 186

 Score =  291 bits (746), Expect = 4e-78
 Identities = 143/172 (83%), Positives = 143/172 (83%)
 Frame = +1

Query: 1   MRXXXXXXXXXXXXXXXFDKIKDSIQNPLARGFGDDIAWVKWEDAIETALDTDKPIFLLI 180
           MR               FDKIKDSIQNPLARGFGDDIAWVKWEDAIETALDTDKPIFLLI
Sbjct: 1   MRSLLLLALVSASAYASFDKIKDSIQNPLARGFGDDIAWVKWEDAIETALDTDKPIFLLI 60

Query: 181 HKSWCHACKALKKTFQQSNAKKAFKKLSEHFVMVNTEDDDEPFEEEYRPDGKYIPRLLFL 360
           HKSWCHACKALKKTFQQSNAKKAFKKLSEHFVMVNTEDDDEPFEEEYRPDGKYIPRLLFL
Sbjct: 61  HKSWCHACKALKKTFQQSNAKKAFKKLSEHFVMVNTEDDDEPFEEEYRPDGKYIPRLLFL 120

Query: 361 DKNGDLLQEFXXXXXXXXXXXXXXSSPADILNSMKDVLKHFGVDIPEAKRGD 516
           DKNGDLLQEF              SSPADILNSMKDVLKHFGVDIPEAKRGD
Sbjct: 121 DKNGDLLQEFKNKKAEYKNYAYYYSSPADILNSMKDVLKHFGVDIPEAKRGD 172




[DB home][top]