Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y55F3C_7
(1566 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25148255|ref|NP_499978.2| voltage-gated channel family member... 1013 0.0
gi|39583546|emb|CAE65650.1| Hypothetical protein CBG10711 [Caeno... 929 0.0
gi|7494575|pir||T34417 delayed rectifier channel protein homolog... 356 7e-97
gi|32566100|ref|NP_504583.2| expulsion defective protein 2 like ... 356 7e-97
gi|39593041|emb|CAE64510.1| Hypothetical protein CBG09245 [Caeno... 353 6e-96
gi|39594151|emb|CAE70261.1| Hypothetical protein CBG16762 [Caeno... 304 4e-81
gi|31249890|gb|AAB52604.3| K (potassium) voltage-gated sensory c... 303 7e-81
gi|39752857|gb|AAR30209.1| K (potassium) voltage-gated sensory c... 303 7e-81
gi|25147276|ref|NP_509301.2| K (potassium) Voltage-gated Sensory... 303 7e-81
gi|29123088|gb|AAO65852.1| KVS-1 [Caenorhabditis elegans] 302 1e-80
gi|37359267|gb|AAN75511.1| KVS-2 [Caenorhabditis elegans] 302 1e-80
gi|7497879|pir||T15829 hypothetical protein C53C9.3 - Caenorhabd... 297 4e-79
gi|32564679|ref|NP_499417.2| k+ channel tetramerisation and ion ... 290 5e-77
gi|7509961|pir||T26983 hypothetical protein Y48A6B.6 - Caenorhab... 289 1e-76
gi|50470587|emb|CAA19530.3| Hypothetical protein Y48A6B.6a [Caen... 288 3e-76
gi|39591750|emb|CAE71328.1| Hypothetical protein CBG18227 [Caeno... 268 2e-70
gi|50470586|emb|CAH04760.1| Hypothetical protein Y48A6B.6b [Caen... 258 2e-67
gi|7496828|pir||T19635 hypothetical protein C32C4.1 - Caenorhabd... 256 1e-66
gi|32566712|ref|NP_505725.2| k+ channel tetramerisation and ion ... 253 7e-66
gi|39593393|emb|CAE64863.1| Hypothetical protein CBG09661 [Caeno... 252 2e-65
gi|16758912|ref|NP_446452.1| potassium voltage gated channel, Sh... 234 3e-60
gi|38049342|ref|XP_136482.3| RIKEN cDNA 9630047L19 [Mus musculus] 234 3e-60
gi|24418850|sp|Q63099|KCB2_RAT Potassium voltage-gated channel s... 234 3e-60
gi|1163141|gb|AAC59757.1| potassium channel alpha subunit Kv2.2 ... 233 1e-59
gi|1163143|gb|AAC59758.1| potassium channel alpha subunit Kv2.1 ... 229 2e-58
gi|47229758|emb|CAG06954.1| unnamed protein product [Tetraodon n... 226 1e-57
gi|24418849|sp|P15387|KCB1_RAT Potassium voltage-gated channel s... 222 2e-56
gi|31560819|ref|NP_032446.2| potassium voltage gated channel, Sh... 222 2e-56
gi|24418471|sp|Q03717|KCB1_MOUSE Potassium voltage-gated channel... 222 2e-56
gi|6981120|ref|NP_037318.1| potassium voltage gated channel, Sha... 222 2e-56
gi|30410858|gb|AAH51422.1| Kcnb1 protein [Mus musculus] 222 2e-56
gi|4826784|ref|NP_004966.1| potassium voltage-gated channel, Sha... 220 8e-56
gi|47523520|ref|NP_999383.1| delayed rectifier potassium channel... 220 8e-56
gi|24418477|sp|Q9MZ19|KCB1_RABIT Potassium voltage-gated channel... 220 8e-56
gi|186798|gb|AAA36156.1| voltage-gated potassium channel 220 8e-56
gi|31295626|gb|AAP46292.1| voltage-gated potassium channel alpha... 219 1e-55
gi|27436974|ref|NP_004761.2| potassium voltage-gated channel, Sh... 219 1e-55
gi|7321945|gb|AAC60504.2| action potential broadening potassium ... 219 1e-55
gi|743110|prf||2011375A K channel 219 1e-55
gi|1546839|gb|AAB08433.1| delayed rectifier potassium channel pr... 219 1e-55
gi|24418473|sp|Q95L11|KCB2_RABIT Potassium voltage-gated channel... 219 2e-55
gi|4519932|dbj|BAA75810.1| Kv2 channel alpha-subunit [Halocynthi... 219 2e-55
gi|13195252|gb|AAK15623.1| delayed rectifier potassium channel K... 218 2e-55
gi|2315214|emb|CAA74748.1| Kv2 voltage-gated potassium channel [... 218 3e-55
gi|31215061|ref|XP_315955.1| ENSANGP00000013550 [Anopheles gambi... 213 1e-53
gi|1546837|gb|AAB08432.1| delayed rectifier potassium channel pr... 212 2e-53
gi|24418856|sp|Q95167|KCB2_CANFA Potassium voltage-gated channel... 212 2e-53
gi|47215595|emb|CAG11626.1| unnamed protein product [Tetraodon n... 211 3e-53
gi|24656289|ref|NP_523894.2| CG1066-PB [Drosophila melanogaster]... 210 7e-53
gi|24656294|ref|NP_728783.1| CG1066-PA [Drosophila melanogaster]... 210 7e-53
gi|13492973|ref|NP_002242.2| potassium voltage-gated channel del... 201 5e-50
gi|6329973|dbj|BAA86458.1| KIAA1144 protein [Homo sapiens] 199 1e-49
gi|45383011|ref|NP_065748.1| potassium voltage-gated channel, de... 199 1e-49
gi|50510805|dbj|BAD32388.1| mKIAA1144 protein [Mus musculus] 197 4e-49
gi|6680550|ref|NP_032462.1| K+ voltage-gated channel, subfamily ... 197 4e-49
gi|13027418|ref|NP_076456.1| potassium channel, alpha subunit (k... 197 4e-49
gi|3493321|gb|AAC33365.1| delayed rectifier potassium channel [D... 197 6e-49
gi|17380406|sp|P17970|CIKB_DROME Potassium voltage-gated channel... 197 6e-49
gi|27734146|ref|NP_775593.1| potassium voltage-gated channel, de... 196 1e-48
gi|31543041|ref|NP_113966.2| Shab-related delayed-rectifier K+ c... 196 1e-48
gi|2739121|gb|AAB94882.1| Shab-related delayed-rectifier K+ chan... 196 1e-48
gi|7514119|pir||JE0276 voltage-gated potassium channel alpha cha... 196 1e-48
gi|158459|gb|AAA28896.1| Shab11 protein 196 2e-48
gi|2815899|gb|AAC13164.1| Shab-related delayed-rectifier K+ chan... 195 2e-48
gi|25952108|ref|NP_002243.3| potassium voltage-gated channel del... 195 2e-48
gi|24418478|sp|Q9TT17|KCS3_RABIT Potassium voltage-gated channel... 195 3e-48
gi|16198531|gb|AAH15947.1| Potassium voltage-gated channel delay... 195 3e-48
gi|6680548|ref|NP_032461.1| K+ voltage-gated channel, subfamily ... 194 4e-48
gi|30584613|gb|AAP36559.1| Homo sapiens potassium voltage-gated ... 194 5e-48
gi|24418475|sp|Q9BQ31|KCS3_HUMAN Potassium voltage-gated channel... 194 5e-48
gi|1168949|sp|Q05037|CIK4_BOVIN Potassium voltage-gated channel ... 194 6e-48
gi|27805965|ref|NP_776796.1| potassium voltage-gated channel, sh... 194 6e-48
gi|16758838|ref|NP_446406.1| K+ voltage-gated channel, subfamily... 193 8e-48
gi|21311753|gb|AAM46838.1| potassium channel alpha subunit Kv1.4... 191 3e-47
gi|7514118|pir||JE0275 voltage-gated potassium channel alpha cha... 191 4e-47
gi|47217887|emb|CAG05009.1| unnamed protein product [Tetraodon n... 190 9e-47
gi|47210943|emb|CAF91112.1| unnamed protein product [Tetraodon n... 190 9e-47
gi|103386|pir||S12746 potassium channel protein shab11 - fruit f... 189 1e-46
gi|103307|pir||B41359 potassium channel protein shab11 - fruit f... 189 1e-46
gi|5031819|ref|NP_005540.1| potassium voltage-gated channel, sha... 189 2e-46
gi|4504817|ref|NP_002224.1| potassium voltage-gated channel, sha... 188 3e-46
gi|50745143|ref|XP_426211.1| PREDICTED: similar to potassium vol... 188 4e-46
gi|3023496|sp|Q28527|CIK4_MUSPF Potassium voltage-gated channel ... 187 5e-46
gi|6981116|ref|NP_037103.1| potassium voltage gated channel, sha... 187 5e-46
gi|16903202|gb|AAL27857.1| potassium channel shaker alpha subuni... 187 5e-46
gi|4204389|gb|AAD11454.1| potassium channel Shaker cKv1.4 [Gallu... 187 6e-46
gi|31543026|ref|NP_067250.2| potassium voltage-gated channel, sh... 186 1e-45
gi|2493594|sp|Q61762|CIK5_MOUSE Potassium voltage-gated channel ... 186 1e-45
gi|116431|sp|P15385|CIK4_RAT Potassium voltage-gated channel sub... 186 1e-45
gi|116430|sp|P22459|CIK4_HUMAN Potassium voltage-gated channel s... 186 2e-45
gi|45383237|ref|NP_989793.1| shaker subfamily potassium channel ... 185 2e-45
gi|33112054|gb|AAP94028.1| shaker subfamily potassium channel Kv... 185 3e-45
gi|33112048|gb|AAP94025.1| shaker subfamily potassium channel Kv... 185 3e-45
gi|112170|pir||A43531 potassium channel KV1.3 - rat 184 5e-45
gi|20875435|ref|XP_143471.1| similar to potassium voltage-gated ... 184 5e-45
gi|4996280|dbj|BAA78383.1| TuKvI [Halocynthia roretzi] 184 5e-45
gi|6981118|ref|NP_037104.1| potassium voltage-gated channel, sha... 184 7e-45
gi|25952087|ref|NP_002225.2| potassium voltage-gated channel, sh... 183 9e-45
gi|499659|gb|AAA29794.1| K+ channel protein [Panulirus interruptus] 183 9e-45
gi|3264841|gb|AAC24718.1| glibenclamide-sensitive voltage-gated ... 183 9e-45
gi|47230729|emb|CAF99922.1| unnamed protein product [Tetraodon n... 183 9e-45
gi|190203|gb|AAA60146.1| potassium channel 183 1e-44
gi|3023498|sp|Q61423|CIK4_MOUSE Potassium voltage-gated channel ... 183 1e-44
gi|206635|gb|AAA42035.1| voltage-gated potassium channel protein 183 1e-44
gi|22122429|ref|NP_666095.1| potassium voltage-gated channel, sh... 183 1e-44
gi|1705863|sp|P22460|CIK5_HUMAN Potassium voltage-gated channel ... 182 1e-44
gi|9506827|ref|NP_062143.1| potassium voltage gated channel, sha... 182 1e-44
gi|34860120|ref|XP_227577.2| similar to potassium voltage-gated ... 182 1e-44
gi|40352738|gb|AAH64595.1| Unknown (protein for IMAGE:5755761) [... 182 2e-44
gi|539662|pir||A38101 potassium channel KCNA3 - human >gnl|BL_OR... 182 2e-44
gi|25952082|ref|NP_002223.2| potassium voltage-gated channel, sh... 182 2e-44
gi|39587219|emb|CAE57687.1| Hypothetical protein CBG00686 [Caeno... 181 3e-44
gi|28261369|gb|AAO32845.1| delayed rectifier K+ channel [Canis f... 181 3e-44
gi|27684873|ref|XP_220024.1| similar to potassium channel, subfa... 181 4e-44
gi|1705864|sp|P50638|CIK5_RABIT Potassium voltage-gated channel ... 181 4e-44
gi|1082705|pir||A56031 potassium channel KCNA5 - human >gnl|BL_O... 181 6e-44
gi|385223|gb|AAC31761.1| potassium channel [Homo sapiens] 181 6e-44
gi|6680516|ref|NP_032444.1| potassium voltage-gated channel, sha... 181 6e-44
gi|47210727|emb|CAF95758.1| unnamed protein product [Tetraodon n... 180 7e-44
gi|189673|gb|AAA36425.1| potassium channel protein 180 7e-44
gi|57035|emb|CAA34132.1| unnamed protein product [Rattus rattus] 180 7e-44
gi|32564084|ref|NP_871939.1| k+ channel tetramerisation and ion ... 180 1e-43
gi|32564076|ref|NP_495752.2| k+ channel tetramerisation and ion ... 180 1e-43
gi|32564086|ref|NP_871940.1| k+ channel tetramerisation and ion ... 180 1e-43
gi|32564090|ref|NP_871942.1| k+ channel tetramerisation and ion ... 180 1e-43
gi|7499096|pir||T20896 hypothetical protein F14F11.1 - Caenorhab... 180 1e-43
gi|32564082|ref|NP_871938.1| k+ channel tetramerisation and ion ... 180 1e-43
gi|7305201|ref|NP_038596.1| potassium voltage-gated channel, sha... 180 1e-43
gi|32564088|ref|NP_871941.1| k+ channel tetramerisation and ion ... 180 1e-43
gi|32564080|ref|NP_871937.1| k+ channel tetramerisation and ion ... 180 1e-43
gi|603152|gb|AAA57320.1| delayed rectifier K+ channel >gnl|BL_OR... 179 1e-43
gi|5817540|gb|AAD52813.1| Kv3.1 potassium channel [Xenopus laevis] 179 2e-43
gi|19424136|ref|NP_598004.1| potassium channel, subfamily V, mem... 179 2e-43
gi|308765|gb|AAA61276.1| voltage-gated potassium channel 179 2e-43
gi|116435|sp|P17659|CIK6_RAT Potassium voltage-gated channel sub... 179 2e-43
gi|29373795|gb|AAO45535.1| potassium channel Kv3.2 [Notoplana at... 178 3e-43
gi|25952092|ref|NP_114092.2| potassium voltage-gated channel, sh... 178 3e-43
gi|12830377|emb|CAC29065.1| potassium voltage-gated channel, sha... 178 3e-43
gi|107365|pir||S12787 potassium channel KCNA2 - human 178 4e-43
gi|1098962|gb|AAA92054.1| cGMP-gated potassium channel 177 5e-43
gi|34146982|gb|AAA83447.2| Hypothetical protein F44A2.2 [Caenorh... 177 5e-43
gi|92635|pir||JH0167 potassium channel KV1.6 - rat 177 6e-43
gi|6685288|sp|P79197|CIK5_MUSPF Potassium voltage-gated channel ... 177 6e-43
gi|13021995|gb|AAK11603.1| Kv1.4 potassium channel [Xenopus laevis] 177 6e-43
gi|48094389|ref|XP_392118.1| similar to potassium channel protei... 177 8e-43
gi|4504821|ref|NP_002226.1| potassium voltage-gated channel, sha... 177 8e-43
gi|50731319|ref|XP_417226.1| PREDICTED: similar to K+ channel Kv... 177 8e-43
gi|15077851|gb|AAK83378.1| shaker-like potassium channel subunit... 176 1e-42
gi|17737641|ref|NP_524159.1| CG9262-PA [Drosophila melanogaster]... 176 1e-42
gi|1085443|pir||S51212 BAK5 protein - bovine >gnl|BL_ORD_ID|5815... 176 1e-42
gi|34147232|ref|NP_899002.1| potassium channel, subfamily V, mem... 176 1e-42
gi|34856190|ref|XP_344890.1| similar to voltage-gated potassium ... 176 1e-42
gi|11878237|gb|AAG40860.1| Kv3.3 potassium channel subunit precu... 175 2e-42
gi|31199537|ref|XP_308716.1| ENSANGP00000007629 [Anopheles gambi... 175 2e-42
gi|47937676|gb|AAH72256.1| LOC432287 protein [Xenopus laevis] 175 2e-42
gi|22252948|gb|AAM94168.1| shaker-like potassium channel Kv1.4 [... 175 3e-42
gi|17544122|ref|NP_500975.1| kv4.3 potassium channel (4H148) [Ca... 175 3e-42
gi|6959886|gb|AAF33249.1| Shaw-related potassium channel protein... 175 3e-42
gi|6754414|ref|NP_034726.1| potassium voltage-gated channel, sha... 174 5e-42
gi|7800634|gb|AAF70088.1| shaker-related potassium channel Tsha2... 174 5e-42
gi|39589243|emb|CAE57976.1| Hypothetical protein CBG01037 [Caeno... 174 5e-42
gi|1363211|pir||C49507 potassium channel Kv1.5, form 3 - mouse 174 5e-42
gi|41054215|ref|NP_956096.1| potassium voltage-gated channel, Sh... 174 5e-42
gi|47228620|emb|CAG07352.1| unnamed protein product [Tetraodon n... 174 7e-42
gi|37619860|emb|CAE48498.1| Hypothetical protein F14F11.1h [Caen... 174 7e-42
gi|47220744|emb|CAG11813.1| unnamed protein product [Tetraodon n... 174 7e-42
gi|112166|pir||S17150 potassium channel protein - rat 173 9e-42
gi|285134|pir||S22703 voltage-gated potassium channel protein Ra... 173 9e-42
gi|41281706|ref|NP_631962.1| Shaw-related voltage-gated potassiu... 173 9e-42
gi|21217561|ref|NP_631874.1| Shaw-related voltage-gated potassiu... 173 9e-42
gi|50731321|ref|XP_425660.1| PREDICTED: similar to potassium cha... 173 9e-42
gi|21217563|ref|NP_631875.1| Shaw-related voltage-gated potassiu... 173 9e-42
gi|21217559|ref|NP_631963.1| Shaw-related voltage-gated potassiu... 173 9e-42
gi|24497458|ref|NP_715624.1| Shaw-related voltage-gated potassiu... 173 9e-42
gi|29692336|gb|AAO89503.1| Kv3.2d voltage-gated potassium channe... 173 9e-42
gi|13021992|gb|AAK11602.1| Kv1.2' potassium channel [Xenopus lae... 173 9e-42
gi|13021998|gb|AAK11604.1| Kv1.10 potassium channel [Xenopus lae... 173 1e-41
gi|9652317|gb|AAF91476.1| potassium channel subunit Kv 1.2 [Oryc... 172 2e-41
gi|7510995|pir||T27759 hypothetical protein ZK1321.2 - Caenorhab... 172 2e-41
gi|32564068|ref|NP_496104.2| k+ channel tetramerisation and ion ... 172 2e-41
gi|47224427|emb|CAG08677.1| unnamed protein product [Tetraodon n... 172 2e-41
gi|39584176|emb|CAE61551.1| Hypothetical protein CBG05460 [Caeno... 172 2e-41
gi|50507493|emb|CAH04712.1| Hypothetical protein ZK1321.2e [Caen... 172 2e-41
gi|32564070|ref|NP_871934.1| k+ channel tetramerisation and ion ... 172 2e-41
gi|510098|gb|AAC37227.1| potassium channel protein 172 2e-41
gi|25742772|ref|NP_037102.1| potassium voltage-gated channel, sh... 172 3e-41
gi|31543024|ref|NP_032443.2| potassium voltage-gated channel, sh... 172 3e-41
gi|38257916|sp|P59995|KCD2_RABIT Potassium voltage-gated channel... 172 3e-41
gi|48141224|ref|XP_393546.1| similar to CG1066-PA [Apis mellifera] 171 4e-41
gi|544035|sp|P22739|CIK2_XENLA Potassium voltage-gated channel s... 171 4e-41
gi|3219511|gb|AAC23503.1| Shaw potassium channel Kv3.1a [Aplysia... 170 8e-41
gi|206549|gb|AAA19867.1| cardiac delayed rectifier potassium cha... 170 8e-41
gi|155764|gb|AAA27756.1| potassium channel 170 1e-40
gi|21311759|gb|AAM46841.1| potassium channel alpha subunit Kv4.2... 170 1e-40
gi|6680526|ref|NP_032449.1| potassium voltage-gated channel, Sha... 169 1e-40
gi|50760247|ref|XP_429232.1| PREDICTED: hypothetical protein XP_... 169 1e-40
gi|46048948|ref|NP_989657.1| potassium voltage-gated channel, Sh... 169 1e-40
gi|47220492|emb|CAG05518.1| unnamed protein product [Tetraodon n... 169 1e-40
gi|50745141|ref|XP_426210.1| PREDICTED: similar to potassium vol... 169 1e-40
gi|4826782|ref|NP_004965.1| potassium voltage-gated channel, sha... 169 2e-40
gi|50762086|ref|XP_429194.1| PREDICTED: similar to Potassium cha... 169 2e-40
gi|34933431|ref|XP_217601.2| similar to potassium channel protei... 169 2e-40
gi|17136468|ref|NP_476721.1| CG2822-PA [Drosophila melanogaster]... 169 2e-40
gi|28574020|ref|NP_722937.2| CG2822-PB [Drosophila melanogaster]... 169 2e-40
gi|108868|pir||S21144 potassium channel protein RCK5 - bovine (f... 168 3e-40
gi|45383239|ref|NP_989794.1| shaker subfamily potassium channel ... 168 3e-40
gi|103308|pir||A41359 potassium channel protein shaw2 - fruit fl... 167 5e-40
gi|47228621|emb|CAG07353.1| unnamed protein product [Tetraodon n... 167 6e-40
gi|47220743|emb|CAG11812.1| unnamed protein product [Tetraodon n... 167 6e-40
gi|47224426|emb|CAG08676.1| unnamed protein product [Tetraodon n... 167 6e-40
gi|7800632|gb|AAF70087.1| shaker-related potassium channel Tsha1... 167 8e-40
gi|14190051|gb|AAK55541.1| potassium channel protein Shal 1.e [P... 166 1e-39
gi|14190049|gb|AAK55540.1| potassium channel protein Shal 1.d [P... 166 1e-39
gi|13929491|gb|AAA81592.2| shal 1 potassium channel [Panulirus i... 166 1e-39
gi|39593232|emb|CAE64702.1| Hypothetical protein CBG09488 [Caeno... 166 1e-39
gi|1587846|prf||2207310A shal gene 166 1e-39
gi|14190059|gb|AAK55545.1| potassium channel protein Shal 1.i [P... 166 1e-39
gi|31560570|ref|NP_034725.2| potassium voltage-gated channel, sh... 166 1e-39
gi|27465523|ref|NP_775118.1| potassium voltage-gated channel, sh... 166 1e-39
gi|116420|sp|P16388|CIK1_MOUSE Potassium voltage-gated channel s... 166 1e-39
gi|14190055|gb|AAK55543.1| potassium channel protein Shal 1.g [P... 166 1e-39
gi|14190057|gb|AAK55544.1| potassium channel protein Shal 1.h [P... 166 1e-39
gi|1245451|gb|AAB02884.1| voltage-dependent potassium channel Sq... 166 1e-39
gi|17225492|gb|AAL37430.1| potassium voltage-gated channel [Sus ... 166 1e-39
gi|14190047|gb|AAK55539.1| potassium channel protein Shal 1.c [P... 166 1e-39
gi|14190053|gb|AAK55542.1| potassium channel protein Shal 1.f [P... 166 1e-39
gi|14190045|gb|AAK55538.1| potassium channel protein Shal 1.b [P... 166 1e-39
gi|4557685|ref|NP_000208.1| potassium voltage-gated channel, sha... 166 1e-39
gi|32564074|ref|NP_871936.1| k+ channel tetramerisation and ion ... 166 1e-39
gi|32564072|ref|NP_871935.1| k+ channel tetramerisation and ion ... 166 1e-39
gi|1763619|gb|AAB39750.1| potassium channel alpha subunit [Polyo... 166 1e-39
gi|2133555|pir||JC4787 shaw protein - California spiny lobster >... 166 2e-39
gi|987509|gb|AAB02603.1| potassium channel homolog 166 2e-39
gi|539708|pir||A48672 delayed rectifier potassium channel Kv1.2,... 166 2e-39
gi|31223140|ref|XP_317268.1| ENSANGP00000022006 [Anopheles gambi... 165 2e-39
gi|2134137|pir||I51532 potassium channel - African clawed frog >... 165 2e-39
gi|50759023|ref|XP_425704.1| PREDICTED: similar to delayed recti... 165 2e-39
gi|3023493|sp|Q03721|CIKG_HUMAN Potassium voltage-gated channel ... 165 3e-39
gi|24497464|ref|NP_720198.1| Shaw-related voltage-gated potassiu... 165 3e-39
gi|24497462|ref|NP_004969.2| Shaw-related voltage-gated potassiu... 165 3e-39
gi|688438|gb|AAA62590.1| noninactivating potassium channel 165 3e-39
gi|12313899|emb|CAC19684.1| dJ1003J2.3.2 (potassium voltage-gate... 165 3e-39
gi|104160|pir||JH0313 potassium channel protein XSha2 - African ... 165 3e-39
gi|17563264|ref|NP_506248.1| SHaW family of potassium channels (... 164 4e-39
gi|28076887|ref|NP_080010.2| voltage-gated potassium channel sub... 164 5e-39
gi|27436981|ref|NP_004970.3| potassium voltage-gated channel, Sh... 164 7e-39
gi|34863358|ref|XP_216678.2| similar to potassium voltage-gated ... 163 1e-38
gi|8272404|dbj|BAA96454.1| shal-type potassium channel (Kv4.1) [... 163 1e-38
gi|41462415|ref|NP_963289.1| potassium voltage-gated channel, su... 162 2e-38
gi|24642916|ref|NP_728123.1| CG12348-PE [Drosophila melanogaster... 162 2e-38
gi|47208124|emb|CAF91031.1| unnamed protein product [Tetraodon n... 162 2e-38
gi|2959684|gb|AAC05909.1| potassium channel [Panulirus interruptus] 162 2e-38
gi|8601|emb|CAA30143.1| unnamed protein product [Drosophila mela... 162 2e-38
gi|85242|pir||JH0193 potassium channel shaker form epsilon - fru... 162 2e-38
gi|13432103|sp|P08510|CIKS_DROME Potassium voltage-gated channel... 162 2e-38
gi|24642914|ref|NP_728122.1| CG12348-PC [Drosophila melanogaster... 162 2e-38
gi|21392146|gb|AAM48427.1| RE58855p [Drosophila melanogaster] 162 3e-38
gi|24642910|ref|NP_728120.1| CG12348-PD [Drosophila melanogaster... 162 3e-38
gi|45549143|ref|NP_523393.3| CG12348-PB [Drosophila melanogaster... 162 3e-38
gi|50760267|ref|XP_417948.1| PREDICTED: similar to shaker subfam... 161 5e-38
gi|20070166|ref|NP_002227.2| potassium voltage-gated channel, su... 160 6e-38
gi|29470162|gb|AAO74497.1| voltage-gated K channel [Limulus poly... 160 6e-38
gi|2218158|gb|AAB95119.1| voltage-dependent potassium channel al... 160 1e-37
gi|17569273|ref|NP_509795.1| EGg Laying defective EGL-36, SHaW f... 160 1e-37
gi|1763617|gb|AAB39749.1| potassium channel gamma subunit [Polyo... 160 1e-37
gi|31203841|ref|XP_310869.1| ENSANGP00000008044 [Anopheles gambi... 159 1e-37
gi|47228763|emb|CAG07495.1| unnamed protein product [Tetraodon n... 159 2e-37
gi|3023483|sp|Q63734|CIKG_RAT Potassium voltage-gated channel su... 159 2e-37
gi|22122333|ref|NP_666034.1| potassium voltage gated channel, Sh... 159 2e-37
gi|48115206|ref|XP_396385.1| similar to Potassium voltage-gated ... 158 4e-37
gi|50794590|ref|XP_428021.1| PREDICTED: similar to potassium cha... 156 1e-36
gi|47217776|emb|CAG05998.1| unnamed protein product [Tetraodon n... 155 3e-36
gi|47220096|emb|CAF99009.1| unnamed protein product [Tetraodon n... 154 4e-36
gi|45384276|ref|NP_990370.1| Shab-like voltage-gated potassium c... 154 6e-36
gi|47224674|emb|CAG03658.1| unnamed protein product [Tetraodon n... 154 6e-36
gi|38075353|ref|XP_141545.2| similar to Potassium voltage-gated ... 154 7e-36
gi|50759082|ref|XP_417510.1| PREDICTED: similar to Potassium vol... 154 7e-36
gi|987511|gb|AAB02604.1| potassium channel homolog 153 1e-35
gi|7513252|pir||JC5919 potassium channel 1 - human >gnl|BL_ORD_I... 153 1e-35
gi|50740396|ref|XP_419451.1| PREDICTED: similar to potassium vol... 152 3e-35
gi|33112050|gb|AAP94026.1| shaker subfamily potassium channel Kv... 150 6e-35
gi|31223114|ref|XP_317265.1| ENSANGP00000025283 [Anopheles gambi... 149 1e-34
gi|47212908|emb|CAF90798.1| unnamed protein product [Tetraodon n... 149 2e-34
gi|31223124|ref|XP_317266.1| ENSANGP00000006819 [Anopheles gambi... 149 2e-34
gi|6912444|ref|NP_036415.1| potassium voltage-gated channel, sub... 149 2e-34
gi|27436996|ref|NP_758857.1| potassium voltage-gated channel, su... 148 4e-34
gi|24418462|sp|Q9QYU3|KCG2_RAT Potassium voltage-gated channel s... 148 4e-34
gi|38078841|ref|XP_357386.1| hypothetical protein XP_357386 [Mus... 147 5e-34
gi|27436988|ref|NP_002228.2| potassium voltage-gated channel, su... 147 9e-34
gi|19071574|ref|NP_579875.1| potassium voltage-gated channel, su... 146 1e-33
gi|47222380|emb|CAG05129.1| unnamed protein product [Tetraodon n... 144 4e-33
gi|28302320|gb|AAH46629.1| Potassium voltage-gated channel, subf... 144 4e-33
gi|45550160|ref|NP_609284.2| CG4450-PA [Drosophila melanogaster]... 144 4e-33
gi|23943842|ref|NP_705732.1| potassium voltage-gated channel, su... 144 4e-33
gi|48097437|ref|XP_391895.1| similar to ENSANGP00000008044 [Apis... 144 6e-33
gi|24418460|sp|Q8R523|KCG3_RAT Potassium voltage-gated channel s... 143 1e-32
gi|7513253|pir||JC5920 potassium channel 2 - human >gnl|BL_ORD_I... 143 1e-32
gi|27436993|ref|NP_758847.1| potassium voltage-gated channel, su... 141 4e-32
gi|47224454|emb|CAG08704.1| unnamed protein product [Tetraodon n... 141 4e-32
gi|38090715|ref|XP_193580.3| similar to Potassium voltage-gated ... 141 5e-32
gi|45383576|ref|NP_989610.1| potassium voltage-gated channel, Sh... 141 5e-32
gi|41351867|gb|AAS00646.1| potassium channel Kv4; CionaKv4 [Cion... 140 6e-32
gi|17981488|gb|AAL51038.1| voltage-gated potassium channel Kv4.3... 140 8e-32
gi|50731856|ref|XP_418390.1| PREDICTED: similar to potassium cha... 140 1e-31
gi|21311763|gb|AAM46843.1| potassium channel alpha subunit Kv4.3... 139 2e-31
gi|9910302|ref|NP_064315.1| potassium voltage-gated channel, Sha... 139 2e-31
gi|2815400|dbj|BAA24525.1| Kv4.3 [Rattus norvegicus] 139 2e-31
gi|38258267|sp|Q9UK17|KCD3_HUMAN Potassium voltage-gated channel... 139 2e-31
gi|38258261|sp|Q9TTT5|KCD3_RABIT Potassium voltage-gated channel... 139 2e-31
gi|38257804|sp|Q62897|KCD3_RAT Potassium voltage-gated channel s... 139 2e-31
gi|27436984|ref|NP_004971.2| potassium voltage-gated channel, Sh... 139 2e-31
gi|4324647|gb|AAD16974.1| potassium channel Kv4.3M [Mus musculus] 139 2e-31
gi|1658483|gb|AAB18337.1| Kv4.3 potassium channel [Rattus norveg... 139 2e-31
gi|27436986|ref|NP_751948.1| potassium voltage-gated channel, Sh... 139 2e-31
gi|1050332|gb|AAA80459.1| voltage-gated K+ channel 139 2e-31
gi|26329581|dbj|BAC28529.1| unnamed protein product [Mus musculus] 139 2e-31
gi|12751419|gb|AAK07651.1| transient voltage dependent potassium... 139 2e-31
gi|47217564|emb|CAG02491.1| unnamed protein product [Tetraodon n... 139 2e-31
gi|13929040|ref|NP_113927.1| potassium voltage gated channel, Sh... 139 2e-31
gi|21311755|gb|AAM46839.1| potassium channel alpha subunit Kv3.4... 139 2e-31
gi|50760255|ref|XP_417943.1| PREDICTED: similar to Shaw-related ... 139 2e-31
gi|7648673|gb|AAF65618.1| voltage-gated potassium channel Kv4.2 ... 138 3e-31
gi|8918934|dbj|BAA97986.1| unnamed protein product [Mus musculus] 138 4e-31
gi|24061764|gb|AAN39878.1| voltage-gated potassium channel Kv4.2... 138 4e-31
gi|4530478|gb|AAD22053.1| potassium channel KV4.2 [Homo sapiens] 138 4e-31
gi|9790093|ref|NP_062671.1| potassium voltage-gated channel, Sha... 138 4e-31
gi|38257805|sp|Q63881|KCD2_RAT Potassium voltage-gated channel s... 138 4e-31
gi|9789987|ref|NP_036413.1| potassium voltage-gated channel, Sha... 138 4e-31
gi|40789029|dbj|BAA82996.2| KIAA1044 protein [Homo sapiens] 138 4e-31
gi|6007795|gb|AAF01044.1| voltage gated potassium channel Kv4.3 ... 138 4e-31
gi|6007797|gb|AAF01045.1| voltage gated potassium channel Kv4.3 ... 138 4e-31
gi|26006243|dbj|BAC41464.1| mKIAA1044 protein [Mus musculus] 138 4e-31
gi|13929026|ref|NP_113918.1| potassium channel Kv4.2 [Rattus nor... 138 4e-31
gi|24497460|ref|NP_004968.2| Shaw-related voltage-gated potassiu... 137 5e-31
gi|8488974|sp|Q14003|KNC3_HUMAN Potassium voltage-gated channel ... 137 5e-31
gi|346305|pir||S19552 potassium channel protein - human >gnl|BL_... 137 5e-31
gi|16758906|ref|NP_446449.1| potassium voltage gated channel, Sh... 137 7e-31
gi|27530020|dbj|BAC53864.1| Kv4 class voltage-gated potassium ch... 137 7e-31
gi|27818772|gb|AAO23560.1| Kv3.3c voltage gated potassium channe... 137 7e-31
gi|3023480|sp|Q01956|KNC3_RAT Potassium voltage-gated channel su... 137 7e-31
gi|27530018|dbj|BAC53863.1| Kv4 class voltage-gated potassium ch... 137 7e-31
gi|27818774|gb|AAO23561.1| Kv3.3d voltage gated potassium channe... 137 7e-31
gi|6680524|ref|NP_032448.1| potassium voltage gated channel, Sha... 137 9e-31
gi|3023499|sp|Q63959|KNC3_MOUSE Potassium voltage-gated channel ... 137 9e-31
gi|23320901|gb|AAN15930.1| Shaw type potassium channel Kv3.3 [Or... 135 4e-30
gi|50747836|ref|XP_421008.1| PREDICTED: similar to Potassium vol... 134 6e-30
gi|40737187|gb|AAR89084.1| shaker-like potassium channel [Callip... 134 8e-30
gi|40737185|gb|AAR89083.1| shaker-like potassium channel [Callip... 134 8e-30
gi|186673|gb|AAA59458.1| type l voltage-gated K+ channel of lymp... 133 1e-29
gi|4826786|ref|NP_004967.1| Shaw-related voltage-gated potassium... 133 1e-29
gi|4960161|gb|AAD34618.1| Kv3.1 [Canis familiaris] 132 2e-29
gi|6981122|ref|NP_036988.1| potassium voltage gated channel, Sha... 132 2e-29
gi|6680522|ref|NP_032447.1| potassium voltage gated channel, Sha... 132 2e-29
gi|2935436|gb|AAC05122.1| Kv4.3 potassium channel long splice va... 132 2e-29
gi|47209609|emb|CAF89593.1| unnamed protein product [Tetraodon n... 132 2e-29
gi|2935434|gb|AAC05121.1| Kv4.3 potassium channel short splice v... 132 2e-29
gi|22164090|gb|AAM93552.1| voltage-gated potassium channel subun... 132 3e-29
gi|2143920|pir||I57681 potassium channel protein - rat (fragment... 132 3e-29
gi|22164086|gb|AAM93550.1| voltage-gated potassium channel subun... 131 4e-29
gi|39594573|emb|CAE72151.1| Hypothetical protein CBG19249 [Caeno... 130 7e-29
gi|47214297|emb|CAG00963.1| unnamed protein product [Tetraodon n... 130 9e-29
gi|47216402|emb|CAG01953.1| unnamed protein product [Tetraodon n... 130 9e-29
gi|26329483|dbj|BAC28480.1| unnamed protein product [Mus musculus] 130 9e-29
gi|47229124|emb|CAG03876.1| unnamed protein product [Tetraodon n... 130 9e-29
gi|28460685|ref|NP_080476.1| potassium channel Kv8.1 homolog; ne... 129 2e-28
gi|1438971|gb|AAC52727.1| potassium channel Kv8.1 [Mesocricetus ... 129 3e-28
gi|7657289|ref|NP_055194.1| potassium channel, subfamily V, memb... 129 3e-28
gi|20381121|gb|AAH28739.1| Potassium channel, subfamily V, membe... 129 3e-28
gi|26345098|dbj|BAC36198.1| unnamed protein product [Mus musculus] 129 3e-28
gi|12848914|dbj|BAB28134.1| unnamed protein product [Mus musculus] 129 3e-28
gi|40557626|gb|AAR88106.1| potassium channel Kv3.1 [Taenopygia g... 128 3e-28
gi|11067433|ref|NP_067729.1| potassium channel, subfamily V, mem... 128 3e-28
gi|27704938|ref|XP_215951.1| similar to Potassium voltage-gated ... 125 2e-27
gi|34851811|ref|XP_226524.2| similar to RIKEN cDNA 4921535I01 [R... 125 4e-27
gi|19173804|ref|NP_596917.1| potassium voltage-gated channel, su... 124 6e-27
gi|47228622|emb|CAG07354.1| unnamed protein product [Tetraodon n... 122 2e-26
gi|31223131|ref|XP_317267.1| ENSANGP00000021912 [Anopheles gambi... 122 2e-26
gi|2738111|gb|AAB94379.1| potassium channel xKv4.3 [Xenopus laevis] 120 9e-26
gi|47221868|emb|CAF98880.1| unnamed protein product [Tetraodon n... 119 2e-25
gi|50753909|ref|XP_425129.1| PREDICTED: similar to Voltage-gated... 119 2e-25
gi|38084655|ref|XP_140499.3| similar to Potassium voltage-gated ... 118 3e-25
gi|34932488|ref|XP_225718.2| similar to Potassium voltage-gated ... 118 3e-25
gi|47216576|emb|CAG00611.1| unnamed protein product [Tetraodon n... 118 4e-25
gi|29373793|gb|AAO45534.1| potassium channel Kv3.1 [Notoplana at... 116 2e-24
gi|3387822|gb|AAC28565.1| voltage-gated potassium-channel LKv1; ... 116 2e-24
gi|3415132|gb|AAC31613.1| shaker related delayed rectifier potas... 115 3e-24
gi|554466|gb|AAA41499.1| potassium channel-Kv2 110 7e-23
gi|17560924|ref|NP_505407.1| potassium voltage-gated channel sub... 110 7e-23
gi|50405239|ref|YP_054331.1| K+ channel, putative [Paramecium te... 110 1e-22
gi|9967389|dbj|BAB12398.1| voltage-dependent potassium channel [... 108 4e-22
gi|48854478|ref|ZP_00308640.1| COG1226: Kef-type K+ transport sy... 105 2e-21
gi|47212272|emb|CAF89504.1| unnamed protein product [Tetraodon n... 105 3e-21
gi|46201458|ref|ZP_00054971.2| COG1226: Kef-type K+ transport sy... 104 5e-21
gi|39937293|ref|NP_949569.1| Cyclic nucleotide regulated K+ chan... 103 1e-20
gi|47212422|emb|CAF93578.1| unnamed protein product [Tetraodon n... 102 3e-20
gi|47222813|emb|CAF96480.1| unnamed protein product [Tetraodon n... 97 7e-20
gi|41689524|ref|ZP_00146057.1| COG1226: Kef-type K+ transport sy... 99 3e-19
gi|46106887|ref|ZP_00200211.1| COG1226: Kef-type K+ transport sy... 97 8e-19
gi|9711573|dbj|BAB07847.1| voltage-dependent K channel [Sus scrofa] 96 2e-18
gi|46912722|emb|CAG19512.1| Putative potassium channel [Photobac... 96 3e-18
gi|27380860|ref|NP_772389.1| bll5749 [Bradyrhizobium japonicum U... 95 4e-18
gi|15805856|ref|NP_294554.1| ion transporter, putative [Deinococ... 95 5e-18
gi|48895851|ref|ZP_00328835.1| COG1226: Kef-type K+ transport sy... 94 7e-18
gi|5814288|gb|AAD52159.1| voltage-gated potassium channel protei... 94 1e-17
gi|41473939|gb|AAS07530.1| unknown [Homo sapiens] 93 2e-17
gi|46202428|ref|ZP_00053231.2| COG1226: Kef-type K+ transport sy... 93 2e-17
gi|33590528|gb|AAQ22995.1| voltage-gated potassium channel, Shal... 92 3e-17
gi|28870782|ref|NP_793401.1| ion transport protein, putative [Ps... 92 3e-17
gi|20090882|ref|NP_616957.1| potassium channel protein [Methanos... 91 8e-17
gi|21229291|ref|NP_635213.1| Potassium channel protein [Methanos... 91 1e-16
gi|37679357|ref|NP_933966.1| putative potassium channel protein ... 91 1e-16
gi|27366380|ref|NP_761908.1| Probable potassium channel [Vibrio ... 91 1e-16
gi|45513140|ref|ZP_00164706.1| COG1226: Kef-type K+ transport sy... 90 1e-16
gi|21244155|ref|NP_643737.1| ion transporter [Xanthomonas axonop... 89 2e-16
gi|28898897|ref|NP_798502.1| putative potassium channel [Vibrio ... 89 3e-16
gi|11141731|gb|AAG32051.1| putative potassium channel Kv1 [Trema... 89 4e-16
gi|29349894|ref|NP_813397.1| voltage-gated K+ channel protein [B... 89 4e-16
gi|6959888|gb|AAF33250.1| Shaw-related potassium channel protein... 88 5e-16
gi|46141646|ref|ZP_00204009.1| COG1226: Kef-type K+ transport sy... 88 6e-16
gi|21232712|ref|NP_638629.1| ion transporter [Xanthomonas campes... 87 8e-16
gi|1705862|sp|Q09081|CIK2_RABIT Potassium voltage-gated channel ... 87 8e-16
gi|16760140|ref|NP_455757.1| possible membrane transport protein... 87 8e-16
gi|16765085|ref|NP_460700.1| putative voltage-gated potassium ch... 87 8e-16
gi|9454360|gb|AAF87774.1| delayed rectifier potassium ion channe... 87 8e-16
gi|50731357|ref|XP_425662.1| PREDICTED: similar to Potassium vol... 87 8e-16
gi|34499017|ref|NP_903232.1| probable ion transporter [Chromobac... 87 1e-15
gi|32477506|ref|NP_870500.1| potassium channel [Pirellula sp. 1]... 87 1e-15
gi|23473800|ref|ZP_00129095.1| COG1226: Kef-type K+ transport sy... 86 2e-15
gi|33337887|gb|AAQ13572.1| voltage-gated Kv1.3 potassium channel... 86 2e-15
gi|50085477|ref|YP_046987.1| putative potassium channel protein ... 86 3e-15
gi|33862490|ref|NP_894050.1| possible potassium channel, VIC fam... 85 4e-15
gi|31217139|ref|XP_316369.1| ENSANGP00000004228 [Anopheles gambi... 85 4e-15
gi|5468522|gb|AAD43822.1| voltage-gated potassium channel isofor... 85 4e-15
gi|2137051|pir||I46855 voltage-gated potassium channel - rabbit ... 85 5e-15
gi|24642918|ref|NP_728124.1| CG12348-PA [Drosophila melanogaster... 84 7e-15
gi|5468520|gb|AAD43820.1| voltage-gated potassium channel isofor... 84 9e-15
gi|47229620|emb|CAG06816.1| unnamed protein product [Tetraodon n... 82 3e-14
gi|48729526|ref|ZP_00263276.1| COG1226: Kef-type K+ transport sy... 82 3e-14
gi|28175209|gb|AAH43564.1| Similar to potassium voltage-gated ch... 82 4e-14
gi|48861391|ref|ZP_00315293.1| COG1226: Kef-type K+ transport sy... 81 6e-14
gi|23121342|ref|ZP_00103672.1| COG1226: Kef-type K+ transport sy... 80 1e-13
gi|90191|pir||S09048 potassium channel protein HaK-6 - hamster (... 80 2e-13
gi|5468523|gb|AAD43823.1| voltage-gated potassium channel isofor... 80 2e-13
gi|91192|pir||S09044 potassium channel protein MK-3 - mouse (fra... 79 2e-13
gi|15838027|ref|NP_298715.1| ion transporter [Xylella fastidiosa... 79 2e-13
gi|91193|pir||S09045 potassium channel protein MK-4 - mouse (fra... 79 3e-13
gi|15596693|ref|NP_250187.1| probable potassium channel [Pseudom... 79 3e-13
gi|22997750|ref|ZP_00041977.1| COG1226: Kef-type K+ transport sy... 79 3e-13
gi|28198561|ref|NP_778875.1| ion transporter 33.9 kDa [Xylella f... 79 3e-13
gi|91195|pir||S09047 potassium channel protein MK-6 - mouse (fra... 79 4e-13
gi|34541624|ref|NP_906103.1| ion transporter [Porphyromonas ging... 78 5e-13
gi|47223540|emb|CAF98027.1| unnamed protein product [Tetraodon n... 78 5e-13
gi|49083349|gb|AAT51009.1| PA1496 [synthetic construct] 77 9e-13
gi|50259918|gb|EAL22586.1| hypothetical protein CNBB4630 [Crypto... 77 9e-13
gi|33240976|ref|NP_875918.1| Kef-type K+ transport system predic... 77 1e-12
gi|26990995|ref|NP_746420.1| cation transporter, VIC family [Pse... 76 3e-12
gi|48768627|ref|ZP_00272976.1| COG1226: Kef-type K+ transport sy... 76 3e-12
gi|50876151|emb|CAG35991.1| related to voltage-gated potassium c... 76 3e-12
gi|5468521|gb|AAD43821.1| voltage-gated potassium channel isofor... 75 3e-12
gi|91191|pir||S09043 potassium channel protein MK-2 - mouse (fra... 75 4e-12
gi|45517074|ref|ZP_00168626.1| COG1226: Kef-type K+ transport sy... 75 6e-12
gi|45517078|ref|ZP_00168630.1| COG1226: Kef-type K+ transport sy... 75 6e-12
gi|45517076|ref|ZP_00168628.1| COG1226: Kef-type K+ transport sy... 75 6e-12
gi|91190|pir||S09042 potassium channel protein MK-1 - mouse (fra... 74 1e-11
gi|26332573|dbj|BAC30004.1| unnamed protein product [Mus musculus] 74 1e-11
gi|36928408|gb|AAQ86807.1| charybdotoxin-sensitive KCNQ1 potassi... 73 2e-11
gi|48129508|ref|XP_396650.1| similar to ENSANGP00000013550 [Apis... 72 3e-11
gi|26343351|dbj|BAC35332.1| unnamed protein product [Mus musculus] 72 3e-11
gi|5468519|gb|AAD43819.1| voltage-gated potassium channel isofor... 72 3e-11
gi|33864687|ref|NP_896246.1| possible potassium channel, VIC fam... 71 8e-11
gi|27382967|ref|NP_774496.1| blr7856 [Bradyrhizobium japonicum U... 69 2e-10
gi|90192|pir||S09049 potassium channel protein HaK-7 - hamster (... 69 2e-10
gi|46187362|ref|ZP_00205309.1| COG1226: Kef-type K+ transport sy... 69 2e-10
gi|25012477|gb|AAN71343.1| RE26469p [Drosophila melanogaster] 69 3e-10
gi|24637840|gb|AAN63887.1| potassium channel [Drosophila melanog... 69 3e-10
gi|23125946|ref|ZP_00107859.1| COG1226: Kef-type K+ transport sy... 69 3e-10
gi|18252526|gb|AAL66301.1| voltage-gated potassium channel Kv3.4... 69 4e-10
gi|45506627|ref|ZP_00158979.1| COG1226: Kef-type K+ transport sy... 68 5e-10
gi|24380209|ref|NP_722164.1| hypothetical protein [Streptococcus... 68 7e-10
gi|32564066|ref|NP_496875.2| potassium channel, KvQLT family (kq... 67 9e-10
gi|50786047|ref|XP_427694.1| PREDICTED: similar to potassium cha... 67 9e-10
gi|17232125|ref|NP_488673.1| probable ion transporter [Nostoc sp... 67 1e-09
gi|31711384|gb|AAM94040.1| potassium channel protein KCNQ1 varia... 67 2e-09
gi|2961249|gb|AAC05705.1| slow delayed rectifier channel subunit... 67 2e-09
gi|32479527|ref|NP_000209.2| potassium voltage-gated channel, KQ... 67 2e-09
gi|5042385|emb|CAB44649.1| KvLQT1 [Homo sapiens] 67 2e-09
gi|39579626|emb|CAE74565.1| Hypothetical protein CBG22329 [Caeno... 67 2e-09
gi|2465515|gb|AAC51781.1| voltage gated potassium channel [Homo ... 67 2e-09
gi|32479525|ref|NP_861463.1| potassium voltage-gated channel, KQ... 67 2e-09
gi|5042386|emb|CAB44650.1| KvLQT1 [Homo sapiens] 67 2e-09
gi|32479523|ref|NP_861462.1| potassium voltage-gated channel, KQ... 66 2e-09
gi|22779261|dbj|BAC15571.1| Q1-type potassium channel spliced va... 66 2e-09
gi|6680546|ref|NP_032460.1| potassium voltage-gated channel, sub... 66 2e-09
gi|33863295|ref|NP_894855.1| possible potassium channel, VIC fam... 66 2e-09
gi|14601099|ref|NP_147625.1| potassium channel [Aeropyrum pernix... 65 4e-09
gi|39591253|emb|CAE73306.1| Hypothetical protein CBG20733 [Caeno... 65 4e-09
gi|41719288|ref|ZP_00148192.1| COG1226: Kef-type K+ transport sy... 65 4e-09
gi|30749950|pdb|1ORQ|C Chain C, X-Ray Structure Of A Voltage-Dep... 65 4e-09
gi|13472825|ref|NP_104392.1| hypothetical protein, similar to po... 65 4e-09
gi|45526586|ref|ZP_00177790.1| COG1226: Kef-type K+ transport sy... 65 6e-09
>gi|25148255|ref|NP_499978.2| voltage-gated channel family member
(59.4 kD) (4B505) [Caenorhabditis elegans]
gi|16604197|gb|AAK72074.2| Hypothetical protein Y55F3C.3
[Caenorhabditis elegans]
Length = 521
Score = 1013 bits (2619), Expect = 0.0
Identities = 500/521 (95%), Positives = 500/521 (95%)
Frame = +1
Query: 1 MIQQIASGSTSMAACERENSVDNQPDRASIDDRSSNKNYDEDVESRMIPVDRPSHKGSIR 180
MIQQIASGSTSMAACERENSVDNQPDRASIDDRSSNKNYDEDVESRMIPVDRPSHKGSIR
Sbjct: 1 MIQQIASGSTSMAACERENSVDNQPDRASIDDRSSNKNYDEDVESRMIPVDRPSHKGSIR 60
Query: 181 DNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFVRMNHEHRRQWADWYFEEQDEYFF 360
DNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFVRMNHEHRRQWADWYFEEQDEYFF
Sbjct: 61 DNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFVRMNHEHRRQWADWYFEEQDEYFF 120
Query: 361 ERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCSPFTQYCVTMGG 540
ERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCSPFTQYCVTMGG
Sbjct: 121 ERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCSPFTQYCVTMGG 180
Query: 541 DPKCTEKDHFIGVRCANIRRRLWLILEGHSQSKWWKAFEIISTAFVVLSISALILGSIPE 720
DPKCTEKDHFIGVRCANIRRRLWLILEGHSQSKWWKAFEIISTAFVVLSISALILGSIPE
Sbjct: 181 DPKCTEKDHFIGVRCANIRRRLWLILEGHSQSKWWKAFEIISTAFVVLSISALILGSIPE 240
Query: 721 FQVPQKSEDGQLVYATATYPTYPNGGGMTIESRTVVREGSDNSTGDLMAEETVPTPRNTG 900
FQVPQKSEDGQLVYATATYPTYPNGGGMTIESRTVVREGSDNSTGDLMAEETVPTPRNTG
Sbjct: 241 FQVPQKSEDGQLVYATATYPTYPNGGGMTIESRTVVREGSDNSTGDLMAEETVPTPRNTG 300
Query: 901 KIEMTEHPVFTWVENVCVIYFSIEYAMRFIVAPRKLAFARQILNVIDLLSIAPFYFELLL 1080
KIEMTEHPVFTWVENVCVIYFSIEYAMRFIVAPRKLAFARQILNVIDLLSIAPFYFELLL
Sbjct: 301 KIEMTEHPVFTWVENVCVIYFSIEYAMRFIVAPRKLAFARQILNVIDLLSIAPFYFELLL 360
Query: 1081 WICGISGENVRKVRWAFLTXXXXXXXXXIRIAKLGRFSPGLANFALTIRKSKKXXXXXXX 1260
WICGISGENVRKVRWAFLT IRIAKLGRFSPGLANFALTIRKSKK
Sbjct: 361 WICGISGENVRKVRWAFLTVRLLRVLRVIRIAKLGRFSPGLANFALTIRKSKKQMQMVGV 420
Query: 1261 XXXXXIIFFSTLIYFLERDEPGTKFTSIPATFWWCVVTMATVGYGDLVPVTVAGKLVGSG 1440
IIFFSTLIYFLERDEPGTKFTSIPATFWWCVVTMATVGYGDLVPVTVAGKLVGSG
Sbjct: 421 VMMTVIIFFSTLIYFLERDEPGTKFTSIPATFWWCVVTMATVGYGDLVPVTVAGKLVGSG 480
Query: 1441 AIVCGVMVLALPITIMVNNFMQVVKLREEEIVKKYAQGDQV 1563
AIVCGVMVLALPITIMVNNFMQVVKLREEEIVKKYAQGDQV
Sbjct: 481 AIVCGVMVLALPITIMVNNFMQVVKLREEEIVKKYAQGDQV 521
>gi|39583546|emb|CAE65650.1| Hypothetical protein CBG10711
[Caenorhabditis briggsae]
Length = 519
Score = 929 bits (2401), Expect = 0.0
Identities = 462/520 (88%), Positives = 476/520 (90%), Gaps = 3/520 (0%)
Frame = +1
Query: 1 MIQQIASGSTSMAA---CERENSVDNQPDRASIDDRSSNKNYDEDVESRMIPVDRPSHKG 171
+ +QIASGSTSMAA CERENSVDNQPDRASIDDRSSNK YDEDVESRMIP++RPSHKG
Sbjct: 1 IFRQIASGSTSMAAVSGCERENSVDNQPDRASIDDRSSNKMYDEDVESRMIPLERPSHKG 60
Query: 172 SIRDNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFVRMNHEHRRQWADWYFEEQDE 351
SIRDNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRF RMNHEHRRQWADWYFE+QDE
Sbjct: 61 SIRDNTPDSILRLNIGGSSYRIRTRSIIKFGPKTLLGRFCRMNHEHRRQWADWYFEDQDE 120
Query: 352 YFFERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCSPFTQYCVT 531
YFFERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCSPF QYCVT
Sbjct: 121 YFFERVPRYFDPIYDFYATGKLHVPKDLCFDKFMAELRFWAVSKSRMDECCSPFAQYCVT 180
Query: 532 MGGDPKCTEKDHFIGVRCANIRRRLWLILEGHSQSKWWKAFEIISTAFVVLSISALILGS 711
MGGDPK TEKDHFIGVRCANIRRRLWLILEGHSQSKWWKAFE+ISTAFVVLSISALILGS
Sbjct: 181 MGGDPKYTEKDHFIGVRCANIRRRLWLILEGHSQSKWWKAFEVISTAFVVLSISALILGS 240
Query: 712 IPEFQVPQKSEDGQLVYATATYPTYPNGGGMTIESRTVVREGSDNSTGDLMAEETVPTPR 891
IPEFQVPQKSEDGQLVYATATYPTYPNGGG TIESRTVVR+ +DNS +M E +
Sbjct: 241 IPEFQVPQKSEDGQLVYATATYPTYPNGGGQTIESRTVVRDVADNSVNHIM-ERSKIIKN 299
Query: 892 NTGKIEMTEHPVFTWVENVCVIYFSIEYAMRFIVAPRKLAFARQILNVIDLLSIAPFYFE 1071
++EMTEHPVFTWVENVCVIYFSIEYAMRFIVAPRKLAFARQILNVIDLLSIAPFYFE
Sbjct: 300 EYFQVEMTEHPVFTWVENVCVIYFSIEYAMRFIVAPRKLAFARQILNVIDLLSIAPFYFE 359
Query: 1072 LLLWICGISGENVRKVRWAFLTXXXXXXXXXIRIAKLGRFSPGLANFALTIRKSKKXXXX 1251
LLLWICGISGENVRKVRWAFLT IRIAKLGRFSPGLANFALTIRKSKK
Sbjct: 360 LLLWICGISGENVRKVRWAFLTVRLLRVLRVIRIAKLGRFSPGLANFALTIRKSKKQMQM 419
Query: 1252 XXXXXXXXIIFFSTLIYFLERDEPGTKFTSIPATFWWCVVTMATVGYGDLVPVTVAGKLV 1431
+IFFSTLIYFLERDEPGTKFTSIPATFWWCVVTMATVGYGDLVPVTVAGKLV
Sbjct: 420 VGIVMMTVVIFFSTLIYFLERDEPGTKFTSIPATFWWCVVTMATVGYGDLVPVTVAGKLV 479
Query: 1432 GSGAIVCGVMVLALPITIMVNNFMQVVKLREEEIVKKYAQ 1551
GSGAIVCGVMVLALPITIMVNNFMQVVKLREE+IVKKYAQ
Sbjct: 480 GSGAIVCGVMVLALPITIMVNNFMQVVKLREEQIVKKYAQ 519