Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y47G6A_27
(528 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17510035|ref|NP_491184.1| putative protein, with a coiled coi... 311 4e-84
gi|39586216|emb|CAE66627.1| Hypothetical protein CBG11963 [Caeno... 196 2e-49
gi|39586701|emb|CAE69421.1| Hypothetical protein CBG15585 [Caeno... 37 0.16
gi|30249671|ref|NP_841741.1| putative transmembrane protein [Nit... 37 0.27
gi|118685|sp|P11532|DMD_HUMAN Dystrophin 36 0.46
gi|5032283|ref|NP_003997.1| dystrophin Dp427m isoform; dystrophi... 36 0.46
gi|87340|pir||A27605 dystrophin, muscle - human >gnl|BL_ORD_ID|8... 36 0.46
gi|30846|emb|CAA32479.1| unnamed protein product [Homo sapiens] 36 0.46
gi|5032281|ref|NP_000100.2| dystrophin Dp427c isoform; dystrophi... 36 0.46
gi|5032287|ref|NP_004000.1| dystrophin Dp427p1 isoform; dystroph... 36 0.46
gi|226299|prf||1506301B Duchenne muscle dystrophy gene 36 0.46
gi|5032289|ref|NP_004002.1| dystrophin Dp260-1 isoform; dystroph... 36 0.46
gi|5032285|ref|NP_003998.1| dystrophin Dp427l isoform; dystrophi... 36 0.46
gi|29249857|gb|EAA41360.1| GLP_630_3463_8346 [Giardia lamblia AT... 36 0.46
gi|15193244|gb|AAK91740.1| axoneme-associated protein GASP-180 [... 36 0.46
gi|5032291|ref|NP_004003.1| dystrophin Dp260-2 isoform; dystroph... 36 0.46
gi|31238859|ref|XP_319862.1| ENSANGP00000016534 [Anopheles gambi... 35 0.60
gi|49118010|gb|AAH72947.1| Unknown (protein for IMAGE:4884362) [... 35 0.79
gi|47550965|ref|NP_999656.1| kinesin-like protein KRP180 [Strong... 35 1.0
gi|19423962|gb|AAL87331.1| unknown protein [Arabidopsis thaliana... 34 1.3
gi|17550806|ref|NP_509975.1| intracellular protein transport lik... 34 1.3
gi|9634794|ref|NP_039087.1| ORF FPV124 N1R/p28 gene family prote... 34 1.8
gi|22328978|ref|NP_680744.1| protein transport protein-related [... 33 2.3
gi|39938842|ref|NP_950608.1| ATP-dependent Zn protease [Onion ye... 33 2.3
gi|15615243|ref|NP_243546.1| ABC transporter (ATP-binding protei... 33 2.3
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa... 33 2.3
gi|23508409|ref|NP_701078.1| hypothetical protein [Plasmodium fa... 33 2.3
gi|34762107|ref|ZP_00143115.1| hydrolase (HD superfamily) [Fusob... 33 2.3
gi|39592934|emb|CAE62548.1| Hypothetical protein CBG06657 [Caeno... 33 2.3
gi|47226832|emb|CAG06674.1| unnamed protein product [Tetraodon n... 33 2.3
gi|6325399|ref|NP_015467.1| Minus-end-directed microtubule motor... 33 2.3
gi|47221834|emb|CAG08888.1| unnamed protein product [Tetraodon n... 33 2.3
gi|12655864|gb|AAK00630.1| ninein isotype 3 [Homo sapiens] 33 3.0
gi|33946319|ref|NP_891990.1| ninein isoform 3; GSK3B-interacting... 33 3.0
gi|31544390|ref|NP_852968.1| SpoT [Mycoplasma gallisepticum R] >... 33 3.0
gi|33946321|ref|NP_891991.1| ninein isoform 5; GSK3B-interacting... 33 3.0
gi|39938550|ref|NP_950316.1| ATP-dependent Zn protease [Onion ye... 33 3.0
gi|21930287|gb|AAG33512.2| ninein-Lm isoform [Homo sapiens] 33 3.0
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 33 3.0
gi|50753741|ref|XP_414113.1| PREDICTED: similar to myosin light ... 33 3.0
gi|33112616|gb|AAF37724.3| diaphanous protein [Entamoeba histoly... 33 3.0
gi|33946313|ref|NP_057434.3| ninein isoform 4; GSK3B-interacting... 33 3.0
gi|39938889|ref|NP_950655.1| ATP-dependent Zn protease [Onion ye... 33 3.0
gi|7159336|gb|AAF37725.1| diaphanous protein [Entamoeba histolyt... 33 3.0
gi|34876769|ref|XP_223335.2| similar to disrupter of silencing S... 33 3.0
gi|9966799|ref|NP_065101.1| disrupter of silencing 10 [Homo sapi... 33 3.0
gi|49065514|emb|CAG38575.1| SAS10 [Homo sapiens] 33 3.0
gi|6319437|ref|NP_009519.1| Suppressor of cold-sensitive tub2 mu... 33 3.0
gi|48768725|ref|ZP_00273073.1| COG0501: Zn-dependent protease wi... 33 3.0
gi|17933552|ref|NP_525064.1| CG6450-PC [Drosophila melanogaster]... 33 3.0
gi|12655860|gb|AAK00628.1| ninein isotype 1 [Homo sapiens] 33 3.0
gi|33946317|ref|NP_891989.1| ninein isoform 1; GSK3B-interacting... 33 3.0
gi|12655862|gb|AAK00629.1| ninein isotype 2 [Homo sapiens] 33 3.0
gi|33946315|ref|NP_065972.2| ninein isoform 2; GSK3B-interacting... 33 3.0
gi|39939139|ref|NP_950905.1| hypothetical protein [Onion yellows... 33 3.0
gi|15233020|ref|NP_186943.1| expressed protein [Arabidopsis thal... 33 3.0
gi|20093122|ref|NP_619197.1| chromosome segregation protein [Met... 33 3.0
gi|46250167|gb|AAH68922.1| MGC83153 protein [Xenopus laevis] 33 3.9
gi|26450189|dbj|BAC42213.1| unknown protein [Arabidopsis thaliana] 33 3.9
gi|32565059|ref|NP_741024.2| M protein repeat containing protein... 33 3.9
gi|3093478|gb|AAC38445.1| fibrinogen-binding protein [Streptococ... 33 3.9
gi|20810291|gb|AAH29524.1| MGC33887 protein [Homo sapiens] 33 3.9
gi|23467422|ref|ZP_00123004.1| COG4942: Membrane-bound metallope... 33 3.9
gi|27923958|sp|O94833|BPEA_HUMAN Bullous pemphigoid antigen 1, i... 33 3.9
gi|18157651|gb|AAL62061.1| bullous pemphigoid antigen 1 eA [Homo... 33 3.9
gi|21930292|gb|AAF23015.2| ninein [Homo sapiens] 33 3.9
gi|25149965|ref|NP_741023.1| M protein repeat containing protein... 33 3.9
gi|12322006|gb|AAG51044.1| kinesin heavy chain, putative; 55116-... 33 3.9
gi|21428694|gb|AAM50007.1| SD02391p [Drosophila melanogaster] 33 3.9
gi|39939213|ref|NP_950979.1| ATP-dependent Zn protease [Onion ye... 32 5.1
gi|50415109|gb|AAH77356.1| LOC398498 protein [Xenopus laevis] 32 5.1
gi|417296|sp|P32389|MET4_YEAST Transcriptional activator of sulf... 32 5.1
gi|50797380|ref|XP_428275.1| PREDICTED: similar to bassoon; bass... 32 5.1
gi|7511463|pir||T15822 kinesin-like protein unc-104 - Caenorhabd... 32 5.1
gi|25154069|ref|NP_741019.1| kinesin-like protein, monomeric syn... 32 5.1
gi|22532964|gb|AAM98043.1| Uncoordinated protein 104, isoform a ... 32 5.1
gi|549143|sp|P23678|U104_CAEEL Kinesin-like protein unc-104 (Unc... 32 5.1
gi|48859547|ref|ZP_00313480.1| COG0419: ATPase involved in DNA r... 32 5.1
gi|49387852|dbj|BAD26517.1| putative GAJ protein [Oryza sativa (... 32 5.1
gi|23612945|ref|NP_704484.1| vacuolar proton-translocating ATPas... 32 5.1
gi|39592658|emb|CAE62272.1| Hypothetical protein CBG06331 [Caeno... 32 5.1
gi|28302297|gb|AAH46684.1| LOC398498 protein [Xenopus laevis] 32 5.1
gi|37956531|gb|AAP20592.1| effector protein A [Legionella pneumo... 32 5.1
gi|27372213|dbj|BAC53624.1| cytoplasmic dynein heavy chain [Aspe... 32 5.1
gi|48101428|ref|XP_392673.1| similar to schwannomin [Apis mellif... 32 5.1
gi|27713427|gb|AAM98044.2| Uncoordinated protein 104, isoform b ... 32 5.1
gi|39583327|emb|CAE66301.1| Hypothetical protein CBG11551 [Caeno... 32 5.1
gi|6324226|ref|NP_014296.1| Lecine-zipper transcriptional activa... 32 5.1
gi|171940|gb|AAA34776.1| leucine zipper protein 32 5.1
gi|21227133|ref|NP_633055.1| Chromosome partition protein [Metha... 32 5.1
gi|50085380|ref|YP_046890.1| proline/betaine transporter (MFS su... 32 5.1
gi|21756268|dbj|BAC04848.1| unnamed protein product [Homo sapiens] 32 6.7
gi|23508440|ref|NP_701109.1| hypothetical protein [Plasmodium fa... 32 6.7
gi|16549862|dbj|BAB70870.1| unnamed protein product [Homo sapiens] 32 6.7
gi|50547193|ref|XP_501066.1| hypothetical protein [Yarrowia lipo... 32 6.7
gi|34577049|ref|NP_056363.2| bullous pemphigoid antigen 1 isofor... 32 6.7
gi|48098704|ref|XP_394822.1| similar to CG33206-PA [Apis mellifera] 32 6.7
gi|28829350|gb|AAO51892.1| similar to Plasmodium falciparum (iso... 32 6.7
gi|16905073|ref|NP_071428.2| SoxLZ/Sox6 leucine zipper binding p... 32 6.7
gi|48893139|ref|ZP_00326432.1| COG1360: Flagellar motor protein ... 32 6.7
gi|34577047|ref|NP_899236.1| bullous pemphigoid antigen 1 isofor... 32 6.7
gi|15239514|ref|NP_197959.1| hypothetical protein [Arabidopsis t... 32 6.7
gi|23509331|ref|NP_701998.1| hypothetical protein [Plasmodium fa... 32 6.7
gi|23613830|ref|NP_704851.1| hypothetical protein [Plasmodium fa... 32 6.7
gi|46486940|gb|AAS98885.1| slow-tonic S2 tropomyosin [Homarus am... 32 6.7
gi|14285796|sp|O44119|TPM_HOMAM Tropomyosin (Allergen Hom a 1) >... 32 6.7
gi|21450779|ref|NP_659473.1| hypothetical protein MGC33887 [Homo... 32 6.7
gi|39938802|ref|NP_950568.1| ATP-dependent Zn protease [Onion ye... 32 8.7
gi|20521057|dbj|BAA32299.2| KIAA0454 protein [Homo sapiens] 32 8.7
gi|30722358|emb|CAD91152.1| hypothetical protein [Homo sapiens] 32 8.7
gi|47568869|ref|ZP_00239562.1| S-layer homology domain protein [... 32 8.7
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 32 8.7
gi|32417180|ref|XP_329068.1| hypothetical protein [Neurospora cr... 32 8.7
gi|42656791|ref|XP_036988.9| KIAA1000 protein [Homo sapiens] 32 8.7
gi|26352726|dbj|BAC39993.1| unnamed protein product [Mus musculus] 32 8.7
gi|19705218|ref|NP_602713.1| hydrolase (HD superfamily) [Fusobac... 32 8.7
gi|31563507|ref|NP_852118.1| GRIP coiled-coil protein GCC185 iso... 32 8.7
gi|46156679|ref|ZP_00132327.2| COG4942: Membrane-bound metallope... 32 8.7
gi|38083816|ref|XP_128924.4| expressed sequence AI043120 [Mus mu... 32 8.7
gi|46432876|gb|EAK92339.1| hypothetical protein CaO19.6345 [Cand... 32 8.7
gi|10956337|ref|NP_052786.1| pXO1-90 [Bacillus anthracis] >gnl|B... 32 8.7
gi|46432949|gb|EAK92409.1| hypothetical protein CaO19.13701 [Can... 32 8.7
gi|37360324|dbj|BAC98140.1| mKIAA1311 protein [Mus musculus] 32 8.7
gi|7662062|ref|NP_055450.1| GRIP coiled-coil protein GCC185 isof... 32 8.7
gi|23098912|ref|NP_692378.1| hypothetical protein OB1457 [Oceano... 32 8.7
gi|34874210|ref|XP_343977.1| similar to 1700001M19Rik protein [R... 32 8.7
gi|45190458|ref|NP_984712.1| AEL149Cp [Eremothecium gossypii] >g... 32 8.7
gi|21355535|ref|NP_648373.1| CG8104-PA [Drosophila melanogaster]... 32 8.7
gi|39594717|emb|CAE72296.1| Hypothetical protein CBG19426 [Caeno... 32 8.7
gi|34875511|ref|XP_344593.1| similar to NK13 [Rattus norvegicus] 32 8.7
gi|21732272|emb|CAD38529.1| hypothetical protein [Homo sapiens] 32 8.7
gi|50658069|ref|NP_001002812.1| phosphodiesterase 4D interacting... 32 8.7
gi|27529750|dbj|BAA76844.2| KIAA1000 protein [Homo sapiens] 32 8.7
gi|39938852|ref|NP_950618.1| ATP-dependent Zn protease [Onion ye... 32 8.7
gi|50658073|ref|NP_055459.3| phosphodiesterase 4D interacting pr... 32 8.7
gi|39938812|ref|NP_950578.1| ATP-dependent Zn protease [Onion ye... 32 8.7
gi|32449689|gb|AAH54080.1| Rbm27 protein [Mus musculus] 32 8.7
gi|38636442|emb|CAE81978.1| related to vesicular transport prote... 32 8.7
gi|42655857|ref|XP_378185.1| hypothetical protein XP_378185 [Hom... 32 8.7
gi|40788217|dbj|BAA20794.2| KIAA0336 [Homo sapiens] 32 8.7
gi|40788275|dbj|BAA32322.2| KIAA0477 protein [Homo sapiens] 32 8.7
gi|12698147|dbj|BAB21900.1| hypothetical protein [Macaca fascicu... 32 8.7
gi|50658071|ref|NP_001002811.1| phosphodiesterase 4D interacting... 32 8.7
gi|7512997|pir||T00259 hypothetical protein KIAA0477 - human 32 8.7
gi|42656083|ref|XP_380170.1| phosphodiesterase 4D interacting pr... 32 8.7
gi|30268245|emb|CAD89923.1| hypothetical protein [Homo sapiens] 32 8.7
gi|50747622|ref|XP_420933.1| PREDICTED: similar to hypothetical ... 27 9.7
>gi|17510035|ref|NP_491184.1| putative protein, with a coiled coil-4
domain (1E172) [Caenorhabditis elegans]
gi|7331981|gb|AAF60669.1| Human/fission yeast mis (minichromosome
stability) homolog protein 12 [Caenorhabditis elegans]
Length = 175
Score = 311 bits (797), Expect = 4e-84
Identities = 160/175 (91%), Positives = 160/175 (91%)
Frame = -1
Query: 528 MESELSGISNENQXXXXXXXXXXXXXXXFNIYVDAWEEVCSNEFKNSLKKLTDKDRLCLL 349
MESELSGISNENQ FNIYVDAWEEVCSNEFKNSLKKLTDKDRLCLL
Sbjct: 1 MESELSGISNENQISFFGFSAGSFSDSIFNIYVDAWEEVCSNEFKNSLKKLTDKDRLCLL 60
Query: 348 SFPFSDKTNEKAFKMMKRFCVTNIFRIPASVTLPECKKMLIASAKEHKSLKQVEKEFDEK 169
SFPFSDKTNEKAFKMMKRFCVTNIFRIPASVTLPECKKMLIASAKEHKSLKQVEKEFDEK
Sbjct: 61 SFPFSDKTNEKAFKMMKRFCVTNIFRIPASVTLPECKKMLIASAKEHKSLKQVEKEFDEK 120
Query: 168 LEKIRQLRIKLAKRHDELEAVNNAIEVLHVMEKSQEQLISQKRIVPDSPTRMSPV 4
LEKIRQLRIKLAKRHDELEAVNNAIEVLHVMEKSQEQLISQKRIVPDSPTRMSPV
Sbjct: 121 LEKIRQLRIKLAKRHDELEAVNNAIEVLHVMEKSQEQLISQKRIVPDSPTRMSPV 175