Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y45F3A_1
(419 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17555896|ref|NP_499327.1| putative nuclear protein, with 2 co... 273 5e-73
gi|39591869|emb|CAE71447.1| Hypothetical protein CBG18358 [Caeno... 232 1e-60
gi|30171184|gb|AAO37759.1| GTPase activating protein [Leptosphae... 40 0.008
gi|34852906|ref|XP_215420.2| similar to RIKEN cDNA 2410017P07 [R... 40 0.010
gi|42557661|emb|CAF28780.1| FYVE and coiled-coil [Gallus gallus] 39 0.017
gi|30171179|gb|AAO37755.1| GTPase activating protein [Leptosphae... 39 0.023
gi|48785827|ref|ZP_00282036.1| COG0784: FOG: CheY-like receiver ... 38 0.051
gi|30409980|ref|NP_848481.1| RIKEN cDNA 5830437M04 [Mus musculus... 38 0.051
gi|17552394|ref|NP_497151.1| putative protein, with a coiled coi... 37 0.087
gi|34878427|ref|XP_223515.2| similar to hypothetical protein FLJ... 37 0.11
gi|46434724|gb|EAK94126.1| hypothetical protein CaO19.2410 [Cand... 37 0.11
gi|46434778|gb|EAK94179.1| hypothetical protein CaO19.9948 [Cand... 37 0.11
gi|48096809|ref|XP_394779.1| similar to ENSANGP00000014171 [Apis... 36 0.15
gi|49096352|ref|XP_409636.1| hypothetical protein AN5499.2 [Aspe... 36 0.15
gi|586120|sp|Q07283|TRHY_HUMAN Trichohyalin >gnl|BL_ORD_ID|13043... 36 0.15
gi|15227354|ref|NP_181677.1| apurinic endonuclease-redox protein... 36 0.19
gi|47606316|sp|Q9LME2|YCO2_ARATH Hypothetical protein At1g22260 ... 36 0.19
gi|30687788|ref|NP_173645.2| expressed protein [Arabidopsis thal... 36 0.19
gi|18640314|ref|NP_570470.1| hypothetical protein; CMLV080 [Came... 36 0.19
gi|472869|emb|CAA54234.1| ARP protein [Arabidopsis thaliana] 36 0.19
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 36 0.19
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 36 0.19
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 36 0.19
gi|38111592|gb|EAA57149.1| hypothetical protein MG08118.4 [Magna... 35 0.25
gi|15081523|ref|NP_150036.1| conserved hypothetical protein [Clo... 35 0.33
gi|48138232|ref|XP_393395.1| similar to ENSANGP00000010751 [Apis... 35 0.33
gi|50305711|ref|XP_452816.1| unnamed protein product [Kluyveromy... 35 0.33
gi|45184715|ref|NP_982433.1| AAL109Wp [Eremothecium gossypii] >g... 35 0.33
gi|18309198|ref|NP_561132.1| probable exonuclease [Clostridium p... 35 0.43
gi|48103540|ref|XP_395596.1| similar to ENSANGP00000009214 [Apis... 35 0.43
gi|39939113|ref|NP_950879.1| DNA primase [Onion yellows phytopla... 35 0.43
gi|13177635|gb|AAK14906.1| phospholipase C beta-3 [Rattus norveg... 35 0.43
gi|46125857|ref|XP_387482.1| hypothetical protein FG07306.1 [Gib... 35 0.43
gi|38073613|ref|XP_127084.3| thyroid hormone receptor interactor... 35 0.43
gi|423977|pir||A45493 phospholipase C-beta 3 - rat (fragment) 35 0.43
gi|32699414|sp|Q99JE6|PIB3_RAT 1-phosphatidylinositol-4,5-bispho... 35 0.43
gi|41053529|ref|NP_957132.1| hypothetical protein MGC63688 [Dani... 35 0.43
gi|34861526|ref|XP_342006.1| phospholipase C, beta 3 [Rattus nor... 35 0.43
gi|38541231|gb|AAH62839.1| Zgc:77695 protein [Danio rerio] 34 0.56
gi|50510441|dbj|BAD32206.1| mKIAA0291 protein [Mus musculus] 34 0.56
gi|11496271|ref|NP_068837.1| cytoplasmic linker 2 [Rattus norveg... 34 0.56
gi|9800516|gb|AAF99333.1| CYLN2 [Mus musculus] >gnl|BL_ORD_ID|15... 34 0.56
gi|31418549|gb|AAH53048.1| Cyln2 protein [Mus musculus] 34 0.56
gi|24657655|gb|AAH39162.1| Cyln2 protein [Mus musculus] 34 0.56
gi|6753562|ref|NP_034120.1| cytoplasmic linker 2; cytoplasmic li... 34 0.73
gi|32041948|ref|ZP_00139531.1| COG1538: Outer membrane protein [... 34 0.73
gi|37520204|ref|NP_923581.1| two-component hybrid sensor and reg... 34 0.73
gi|335675|gb|AAB59815.1| ORF G5R; putative >gnl|BL_ORD_ID|170211... 34 0.73
gi|11281449|pir||T37350 probable 49.8K protein - vaccinia virus ... 34 0.73
gi|9791005|ref|NP_063732.1| Hypothetical protein [Vaccinia virus... 34 0.73
gi|30519456|emb|CAD90631.1| H5R protein [Cowpox virus] 34 0.73
gi|5732904|gb|AAD49332.1| M protein precursor [Streptococcus pyo... 34 0.73
gi|20178458|ref|NP_619879.1| CPXV092 protein [Cowpox virus] >gnl... 34 0.73
gi|39582082|emb|CAE63725.1| Hypothetical protein CBG08250 [Caeno... 34 0.73
gi|5911306|gb|AAD55745.1| M protein precursor [Streptococcus pyo... 34 0.73
gi|46228752|gb|EAK89622.1| trehalose-6-phosphate synthase of lik... 34 0.73
gi|48856658|ref|ZP_00310815.1| COG0784: FOG: CheY-like receiver ... 34 0.73
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 34 0.73
gi|27881860|gb|AAH44383.1| Zgc:55375 protein [Danio rerio] 33 0.96
gi|5091607|gb|AAD39596.1| 10A19I.11 [Oryza sativa (japonica cult... 33 0.96
gi|15921537|ref|NP_377206.1| 311aa long conserved hypothetical p... 33 0.96
gi|48772747|ref|ZP_00277089.1| COG0542: ATPases with chaperone a... 33 0.96
gi|14530418|emb|CAA99841.2| Hypothetical protein F20G4.3 [Caenor... 33 1.3
gi|1477559|gb|AAC47238.1| non-muscle myosin heavy chain II 33 1.3
gi|25150089|ref|NP_492186.2| non-muscle myosin, cytoplasmic, hea... 33 1.3
gi|50539784|ref|NP_001002362.1| zgc:92104 [Danio rerio] >gnl|BL_... 33 1.3
gi|24762494|ref|NP_726397.1| CG30175-PA [Drosophila melanogaster... 33 1.3
gi|7499530|pir||T21174 hypothetical protein F20G4.3 - Caenorhabd... 33 1.3
gi|11496937|ref|NP_045730.1| B. burgdorferi predicted coding reg... 33 1.3
gi|13384806|ref|NP_079693.1| COMM domain containing 4 [Mus muscu... 33 1.3
gi|34863487|ref|XP_343397.1| similar to RIKEN cDNA 1110039H05 [R... 33 1.3
gi|21389505|ref|NP_653321.1| multiple coiled-coil GABABR1-bindin... 33 1.3
gi|28436730|gb|AAH47075.1| Multiple coiled-coil GABABR1-binding ... 33 1.3
gi|47215877|emb|CAG12269.1| unnamed protein product [Tetraodon n... 33 1.3
gi|19074690|ref|NP_586196.1| similarity to HYPOTHETICAL PROTEIN ... 33 1.3
gi|34870961|ref|XP_342907.1| similar to macrophin 1 isoform 4 [R... 33 1.3
gi|38114739|gb|AAH02661.2| KRT13 protein [Homo sapiens] 33 1.6
gi|50603586|gb|AAH77718.1| KRT13 protein [Homo sapiens] 33 1.6
gi|24234696|ref|NP_705694.1| keratin 13 isoform a; keratin, type... 33 1.6
gi|71526|pir||KRHU3 keratin 13, type I, cytoskeletal, long splic... 33 1.6
gi|19880160|gb|AAM00269.1| leucine zipper motif-containing prote... 33 1.6
gi|4504911|ref|NP_002265.1| keratin 13 isoform b; keratin, type ... 33 1.6
gi|46198851|ref|YP_004518.1| chromosome partition protein smc [T... 33 1.6
gi|6273778|gb|AAF06360.1| trabeculin-alpha [Homo sapiens] 33 1.6
gi|14285345|sp|Q9UPN3|MACF_HUMAN Microtubule-actin crosslinking ... 33 1.6
gi|5821434|dbj|BAA83821.1| actin binding protein ABP620 [Homo sa... 33 1.6
gi|33188445|ref|NP_036222.3| microfilament and actin filament cr... 33 1.6
gi|17974987|ref|NP_536501.1| G5R [Monkeypox virus] >gnl|BL_ORD_I... 33 1.6
gi|9627588|ref|NP_042111.1| H5R [Variola virus] >gnl|BL_ORD_ID|3... 33 1.6
gi|34328014|dbj|BAA32310.3| KIAA0465 protein [Homo sapiens] 33 1.6
gi|11137614|emb|CAC15920.1| dJ562N20.1.1 (trabeculin alpha (acti... 33 1.6
gi|19387850|ref|NP_077772.1| leucine zipper protein 1 [Mus muscu... 33 1.6
gi|14521629|ref|NP_127105.1| hypothetical protein PAB1429 [Pyroc... 33 1.6
gi|15597072|ref|NP_250566.1| hypothetical protein [Pseudomonas a... 33 1.6
gi|30316105|sp|Q96PK2|MAC4_HUMAN Microtubule-actin crosslinking ... 33 1.6
gi|31193924|gb|AAP44759.1| unknown protein [Oryza sativa (japoni... 33 1.6
gi|33188443|ref|NP_149033.2| microfilament and actin filament cr... 33 1.6
gi|17426164|gb|AAL39000.1| macrophin 1 isoform 2 [Homo sapiens] 33 1.6
gi|21750830|dbj|BAC03847.1| unnamed protein product [Homo sapiens] 33 1.6
gi|17426161|gb|AAL38997.1| macrophin 1 isoform 4 [Homo sapiens] 33 1.6
gi|49094764|ref|XP_408843.1| hypothetical protein AN4706.2 [Aspe... 33 1.6
gi|12849307|dbj|BAB28289.1| unnamed protein product [Mus musculus] 33 1.6
gi|7494399|pir||D71619 PSD2-like 26S proteasomal subunit PFB0260... 32 2.1
gi|46431216|gb|EAK90823.1| hypothetical protein CaO19.1294 [Cand... 32 2.1
gi|47227926|emb|CAF97555.1| unnamed protein product [Tetraodon n... 32 2.1
gi|39591348|emb|CAE73401.1| Hypothetical protein CBG20842 [Caeno... 32 2.1
gi|32352206|dbj|BAC78596.1| hypothetical protein [Oryza sativa (... 32 2.1
gi|27717163|ref|XP_216681.1| similar to IgD B-cell receptor-asso... 32 2.1
gi|46401972|ref|YP_006715.1| RPXV071 [Rabbitpox virus] >gnl|BL_O... 32 2.1
gi|7519835|pir||A72159 I5R protein - variola minor virus (strain... 32 2.1
gi|23508760|ref|NP_701428.1| hypothetical protein [Plasmodium fa... 32 2.1
gi|27882652|gb|AAH44026.1| LOC398445 protein [Xenopus laevis] 32 2.1
gi|49077418|ref|XP_402570.1| hypothetical protein UM04955.1 [Ust... 32 2.1
gi|50745113|ref|XP_419989.1| PREDICTED: similar to intersectin 2... 32 2.1
gi|42522699|ref|NP_968079.1| chromosome segregation SMC protein ... 32 2.8
gi|31205765|ref|XP_311834.1| ENSANGP00000017589 [Anopheles gambi... 32 2.8
gi|20094127|ref|NP_613974.1| SMC1-family ATPase involved in DNA ... 32 2.8
gi|14285343|sp|Q9QXZ0|MACF_MOUSE Microtubule-actin crosslinking ... 32 2.8
gi|6503052|gb|AAF14565.1| resistance protein RPS2 homolog [Brass... 32 2.8
gi|20868964|ref|XP_130881.1| similar to CDA02 protein [Mus muscu... 32 2.8
gi|50748027|ref|XP_421078.1| PREDICTED: similar to golgi-associa... 32 2.8
gi|50306783|ref|XP_453367.1| unnamed protein product [Kluyveromy... 32 2.8
gi|280635|pir||A37352 myosin heavy chain - sea urchin (Lytechinu... 32 2.8
gi|23509405|ref|NP_702072.1| hypothetical protein [Plasmodium fa... 32 2.8
gi|25021548|ref|XP_110503.2| microtubule-actin crosslinking fact... 32 2.8
gi|3023586|sp|P79955|CTK2_XENLA Carboxy-terminal kinesin 2 (XCTK... 32 2.8
gi|27819643|ref|NP_777288.1| rho-associated, coiled-coil contain... 32 2.8
gi|4468708|emb|CAB38183.1| intermediate filament protein IF2 [Sa... 32 2.8
gi|49119563|gb|AAH73107.1| Unknown (protein for MGC:83587) [Xeno... 32 2.8
gi|50418025|gb|AAH77347.1| Unknown (protein for IMAGE:6317108) [... 32 2.8
gi|26347343|dbj|BAC37320.1| unnamed protein product [Mus musculus] 32 2.8
gi|23612448|ref|NP_704009.1| hypothetical protein [Plasmodium fa... 32 2.8
gi|50120075|ref|YP_049242.1| 2-dehydropantoate 2-reductase [Erwi... 32 2.8
gi|24374427|ref|NP_718470.1| SMC family protein [Shewanella onei... 32 2.8
gi|1848063|emb|CAA50182.1| Cytoplasmic intermediate filament (IF... 32 3.6
gi|33300472|emb|CAD90188.2| Hypothetical protein ZK1151.1c [Caen... 32 3.6
gi|2367400|gb|AAB69637.1| GrfA [Dictyostelium discoideum] 32 3.6
gi|50591838|ref|ZP_00333140.1| COG1193: Mismatch repair ATPase (... 32 3.6
gi|34875950|ref|XP_237151.2| similar to hypothetical protein DKF... 32 3.6
gi|27763989|emb|CAD44324.1| VAB-10B protein [Caenorhabditis eleg... 32 3.6
gi|50557088|ref|XP_505952.1| hypothetical protein [Yarrowia lipo... 32 3.6
gi|27763987|emb|CAD44323.1| VAB-10A protein [Caenorhabditis eleg... 32 3.6
gi|27801758|emb|CAD44515.1| VAB-10A protein [Caenorhabditis eleg... 32 3.6
gi|27801756|emb|CAD44514.1| VAB-10A protein [Caenorhabditis eleg... 32 3.6
gi|6066748|emb|CAB58264.1| ML protein [Trypanosoma brucei] 32 3.6
gi|50877270|emb|CAG37110.1| hypothetical protein [Desulfotalea p... 32 3.6
gi|27801760|emb|CAD44516.1| VAB-10B protein [Caenorhabditis eleg... 32 3.6
gi|23509526|ref|NP_702193.1| hypothetical protein [Plasmodium fa... 32 3.6
gi|17511185|ref|NP_492998.1| VAB-10A protein family member, Vari... 32 3.6
gi|12833313|dbj|BAB22477.1| unnamed protein product [Mus musculus] 32 3.6
gi|16804903|ref|NP_472932.1| rifin [Plasmodium falciparum 3D7] >... 32 3.6
gi|25149995|ref|NP_741903.1| intermediate Filament, A (66.5 kD) ... 32 3.6
gi|25149990|ref|NP_741902.1| intermediate Filament, A (66.5 kD) ... 32 3.6
gi|34853944|ref|XP_231193.2| similar to RIKEN cDNA 0710001G09 [R... 32 3.6
gi|46227230|gb|EAK88180.1| hypothetical protein cgd5_330 [Crypto... 32 3.6
gi|6319994|ref|NP_010074.1| Cytoplasmic nucleoporin required for... 32 3.6
gi|25405837|pir||H96597 hypothetical protein T5A14.5 [imported] ... 32 3.6
gi|30794192|ref|NP_084069.1| golgi autoantigen, golgin subfamily... 32 3.6
gi|50470589|emb|CAH04759.1| Hypothetical protein ZK1151.1g [Caen... 32 3.6
gi|32189724|ref|NP_859454.1| hypothetical protein Chr3_0210 [Lei... 32 3.6
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap... 32 3.6
gi|37595302|gb|AAQ94536.1| M protein [Streptococcus pyogenes] 32 3.6
gi|39582203|emb|CAE64154.1| Hypothetical protein CBG08772 [Caeno... 32 3.6
gi|32414799|ref|XP_327879.1| hypothetical protein [Neurospora cr... 32 3.6
gi|24762562|ref|NP_523837.2| CG4012-PA [Drosophila melanogaster]... 32 3.6
gi|7447203|pir||T18872 intermediate filament protein A - Caenorh... 32 3.6
gi|50507815|emb|CAH04708.1| Hypothetical protein ZK1151.1d [Caen... 32 3.6
gi|2772930|gb|AAB96643.1| Genghis Khan [Drosophila melanogaster] 32 3.6
gi|18405413|ref|NP_564694.1| proline-rich family protein [Arabid... 32 3.6
gi|7510924|pir||T22552 hypothetical protein ZK1151.1 - Caenorhab... 32 3.6
gi|21954068|gb|AAK59573.2| unknown protein [Arabidopsis thaliana] 32 3.6
gi|1658161|gb|AAB18257.1| M protein precursor [Streptococcus pyo... 32 3.6
gi|15239202|ref|NP_196187.1| nuclear pore complex protein-relate... 32 3.6
gi|50752034|ref|XP_422624.1| PREDICTED: similar to Secretogranin... 32 3.6
gi|28950352|emb|CAD70976.1| probable myosin MYO2 [Neurospora cra... 32 3.6
gi|3550539|emb|CAA06944.1| K15 intermediate filament type I kera... 32 3.6
gi|37595304|gb|AAQ94537.1| M protein [Streptococcus pyogenes] 32 3.6
gi|32469766|sp|Q92805|GOA1_HUMAN Golgi autoantigen, golgin subfa... 32 3.6
gi|4504063|ref|NP_002068.1| golgin 97; gap junction protein, alp... 32 3.6
gi|50507817|emb|CAH04710.1| Hypothetical protein ZK1151.1f [Caen... 32 3.6
gi|21361653|ref|NP_060255.2| hypothetical protein FLJ20364 [Homo... 31 4.8
gi|19115307|ref|NP_594395.1| hypothetical serine-rich protein. [... 31 4.8
gi|26334981|dbj|BAC31191.1| unnamed protein product [Mus musculus] 31 4.8
gi|14041978|dbj|BAB55058.1| unnamed protein product [Homo sapiens] 31 4.8
gi|17533741|ref|NP_494820.1| M protein repeat containing protein... 31 4.8
gi|21956484|gb|AAM83402.1| eukaryotic translation initiation fac... 31 4.8
gi|15487195|emb|CAC37123.2| hypothetical predicted protein P1046... 31 4.8
gi|20093845|ref|NP_613692.1| Uncharacterized protein conserved i... 31 4.8
gi|25149148|ref|NP_504245.2| ribosome biogenesis protein bms1 ho... 31 4.8
gi|46437031|gb|EAK96384.1| hypothetical protein CaO19.3100 [Cand... 31 4.8
gi|38073634|ref|XP_283677.2| similar to CDC42-binding protein ki... 31 4.8
gi|28948916|pdb|1NKT|A Chain A, Crystal Structure Of The Seca Pr... 31 4.8
gi|46226818|gb|EAK87784.1| hypothetical protein with signal pept... 31 4.8
gi|33337980|gb|AAQ13612.1| MSTP089 [Homo sapiens] 31 4.8
gi|47211270|emb|CAF96642.1| unnamed protein product [Tetraodon n... 31 4.8
gi|32565065|ref|NP_872028.1| M protein repeat containing protein... 31 4.8
gi|34867549|ref|XP_343097.1| similar to KIAA1509 protein [Rattus... 31 4.8
gi|20095024|ref|NP_614871.1| Uncharacterized Zn-finger-containin... 31 4.8
gi|14042941|ref|NP_114414.1| CDA02 protein [Homo sapiens] >gnl|B... 31 4.8
gi|16758474|ref|NP_446109.1| CDC42-binding protein kinase alpha;... 31 4.8
gi|4468777|emb|CAB38186.1| cytoplasmic intermediate filament pro... 31 4.8
gi|27695730|gb|AAH43115.1| 0610010D24Rik protein [Mus musculus] ... 31 4.8
gi|4757834|ref|NP_004273.1| BCL2-associated athanogene 2; BAG-fa... 31 4.8
gi|28571426|ref|NP_788862.1| CG32918-PB [Drosophila melanogaster... 31 4.8
gi|26351171|dbj|BAC39222.1| unnamed protein product [Mus musculus] 31 4.8
gi|49065418|emb|CAG38527.1| BAG2 [Homo sapiens] 31 4.8
gi|23482828|gb|EAA18696.1| dynein beta chain, ciliary [Plasmodiu... 31 4.8
gi|48783965|ref|ZP_00280346.1| COG0243: Anaerobic dehydrogenases... 31 4.8
gi|9712508|emb|CAC01301.1| dJ417I1.2 (BAG-family molecular chape... 31 4.8
gi|46906291|ref|YP_012680.1| conserved hypothetical protein [Lis... 31 4.8
gi|50756157|ref|XP_415041.1| PREDICTED: similar to CDC42-binding... 31 4.8
gi|7489162|pir||T03792 kinesin-related protein tck1 - common tob... 31 4.8
gi|19704578|ref|NP_604140.1| Glycosyl transferase [Fusobacterium... 31 4.8
gi|17533743|ref|NP_494821.1| M protein repeat containing protein... 31 4.8
gi|6503056|gb|AAF14567.1| resistance protein RPS2 homolog [Brass... 31 4.8
gi|17533739|ref|NP_494819.1| M protein repeat containing protein... 31 4.8
gi|15606379|ref|NP_213759.1| hypothetical protein aq_1111 [Aquif... 31 4.8
gi|21703784|ref|NP_663367.1| Bcl2-associated athanogene 2 [Mus m... 31 4.8
gi|7020414|dbj|BAA91119.1| unnamed protein product [Homo sapiens] 31 4.8
gi|50309893|ref|XP_454960.1| unnamed protein product [Kluyveromy... 31 4.8
gi|38089151|ref|XP_134108.2| RIKEN cDNA E330005F07 gene [Mus mus... 31 4.8
gi|9954208|gb|AAG08983.1| Vga-A variant [Staphylococcus aureus] 31 6.2
gi|25149352|ref|NP_741539.1| myosin heavy chain (5G32) [Caenorha... 31 6.2
gi|790526|gb|AAB65849.1| snoN2 [Mus musculus] 31 6.2
gi|995557|emb|CAA61623.1| DRPLA [Rattus norvegicus] 31 6.2
gi|33620941|gb|AAM29663.2| Hypothetical protein C18C4.5b [Caenor... 31 6.2
gi|741022|prf||2006282A keratin 15 31 6.2
gi|50780312|ref|XP_423346.1| PREDICTED: similar to Williams Beur... 31 6.2
gi|6680602|ref|NP_032495.1| keratin complex 1, acidic, gene 15; ... 31 6.2
gi|17511187|ref|NP_492996.1| VAB-10B protein family member, Vari... 31 6.2
gi|34852751|ref|XP_218658.2| similar to muscle-derived protein M... 31 6.2
gi|45527240|ref|ZP_00178441.1| COG0542: ATPases with chaperone a... 31 6.2
gi|23126479|ref|ZP_00108373.1| COG0642: Signal transduction hist... 31 6.2
gi|34873691|ref|XP_213482.2| similar to cytokeratin 15 [Rattus n... 31 6.2
gi|7510926|pir||T26964 hypothetical protein ZK1151.2b - Caenorha... 31 6.2
gi|1123025|gb|AAB65848.1| snoN protein [Mus musculus] 31 6.2
gi|15606457|ref|NP_213837.1| putative protein [Aquifex aeolicus ... 31 6.2
gi|124727|sp|P24708|INVO_AOTTR Involucrin >gnl|BL_ORD_ID|1836165... 31 6.2
gi|34762711|ref|ZP_00143701.1| Phosphoenolpyruvate-protein phosp... 31 6.2
gi|20137010|ref|NP_619534.1| muscle specific protein [Mus muscul... 31 6.2
gi|24644332|ref|NP_730971.1| CG31551-PA [Drosophila melanogaster... 31 6.2
gi|8393274|ref|NP_058924.1| dentatorubral pallidoluysian atrophy... 31 6.2
gi|11276954|pir||A59234 slow myosin heavy chain 3 - quail >gnl|B... 31 6.2
gi|23593280|ref|NP_472980.2| proteasome 26S regulatory subunit, ... 31 6.2
gi|50728478|ref|XP_416138.1| PREDICTED: similar to Early endosom... 31 6.2
gi|48847787|ref|ZP_00302036.1| COG0265: Trypsin-like serine prot... 31 6.2
gi|7496266|pir||T34107 hypothetical protein C18C4.5 - Caenorhabd... 31 6.2
gi|46120890|ref|XP_385115.1| hypothetical protein FG04939.1 [Gib... 31 6.2
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo... 31 6.2
gi|7510925|pir||T26963 hypothetical protein ZK1151.2a - Caenorha... 31 6.2
gi|28829643|gb|AAO52159.1| similar to C25A11.4b.p [Caenorhabditi... 31 6.2
gi|30089962|ref|NP_003598.2| CDC42-binding protein kinase alpha ... 31 6.2
gi|29373940|emb|CAD57745.1| CDC42 binding protein kinase alpha (... 31 6.2
gi|11138794|gb|AAG31483.1| body wall myosin-like protein [Wucher... 31 6.2
gi|171922|gb|AAA34768.1| MEI5 31 6.2
gi|6325136|ref|NP_015204.1| Meiotic protein required for synapsi... 31 6.2
gi|408671|gb|AAA43659.1| hemagglutinin [Influenza A virus (A/chi... 31 6.2
gi|408527|gb|AAA43284.1| hemagglutinin [Influenza A virus (A/gul... 31 6.2
gi|2144796|pir||I36912 involucrin S - douroucouli (fragment) >gn... 31 6.2
gi|18676640|dbj|BAB84972.1| FLJ00219 protein [Homo sapiens] 31 6.2
gi|25149347|ref|NP_741538.1| myosin heavy chain (5G32) [Caenorha... 31 6.2
gi|24662278|ref|NP_729622.1| CG14154-PA [Drosophila melanogaster... 31 6.2
gi|17511189|ref|NP_492995.1| VAB-10B protein family member, Vari... 31 6.2
gi|24662274|ref|NP_648403.1| CG14154-PB [Drosophila melanogaster... 31 6.2
gi|45190844|ref|NP_985098.1| AER241Wp [Eremothecium gossypii] >g... 31 6.2
gi|49899950|gb|AAH76965.1| Unknown (protein for MGC:89425) [Xeno... 31 6.2
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 31 6.2
gi|39595918|emb|CAE67421.1| Hypothetical protein CBG12909 [Caeno... 31 6.2
gi|47059089|ref|NP_080957.2| DVL-binding protein DAPLE [Mus musc... 31 6.2
gi|34784398|gb|AAH57934.1| Krt1-15 protein [Mus musculus] 31 6.2
gi|46805820|dbj|BAD17170.1| Cingulin-like [Oryza sativa (japonic... 31 6.2
gi|47211780|emb|CAF94090.1| unnamed protein product [Tetraodon n... 30 8.1
gi|23490410|gb|EAA22196.1| hypothetical protein [Plasmodium yoel... 30 8.1
gi|34851915|ref|XP_226572.2| similar to Mixed lineage kinase 4 [... 30 8.1
gi|18092669|gb|AAL59398.1| BcscD [Burkholderia cepacia genomovar... 30 8.1
gi|18977621|ref|NP_578978.1| putative ABC transporter [Pyrococcu... 30 8.1
gi|45642712|ref|NP_990505.1| snoN; ski-related gene [Gallus gall... 30 8.1
gi|42562587|ref|NP_175186.2| expressed protein [Arabidopsis thal... 30 8.1
gi|46444990|gb|EAL04261.1| hypothetical protein CaO19.13334 [Can... 30 8.1
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 30 8.1
gi|50507816|emb|CAH04709.1| Hypothetical protein ZK1151.1e [Caen... 30 8.1
gi|34526581|dbj|BAC85248.1| unnamed protein product [Homo sapiens] 30 8.1
gi|13172674|gb|AAK14188.1| Vi biosynthesis protein VexD [Citroba... 30 8.1
gi|38049524|ref|XP_286972.2| similar to KIAA2012 protein [Mus mu... 30 8.1
gi|49095604|ref|XP_409263.1| hypothetical protein AN5126.2 [Aspe... 30 8.1
gi|11360369|pir||T42712 myelin transcription factor 1 - mouse >g... 30 8.1
gi|3522869|gb|AAC34131.1| SecA [Mycobacterium bovis] 30 8.1
gi|37536934|ref|NP_922769.1| unknown protein [Oryza sativa (japo... 30 8.1
gi|22537827|ref|NP_688678.1| preprotein translocase, SecA subuni... 30 8.1
gi|3024418|sp|P81060|PN3C_PENVA Penaeidin-3c precursor (Pen-3c) ... 30 8.1
gi|46126801|ref|XP_387954.1| hypothetical protein FG07778.1 [Gib... 30 8.1
gi|37523011|ref|NP_926388.1| probable ABC transporter ATP-bindin... 30 8.1
gi|39587824|emb|CAE67842.1| Hypothetical protein CBG13429 [Caeno... 30 8.1
gi|15238391|ref|NP_200747.1| XH/XS domain-containing protein [Ar... 30 8.1
gi|46228259|gb|EAK89158.1| hypothetical protein having a signal ... 30 8.1
gi|15672097|ref|NP_266271.1| preprotein translocase subunit [Lac... 30 8.1
gi|15610376|ref|NP_217757.1| secA [Mycobacterium tuberculosis H3... 30 8.1
gi|20889383|ref|NP_624334.1| movement protein [Citrus leaf blotc... 30 8.1
>gi|17555896|ref|NP_499327.1| putative nuclear protein, with 2
coiled coil-4 domains (3L648) [Caenorhabditis elegans]
gi|7509891|pir||T25067 hypothetical protein Y45F3A.1 -
Caenorhabditis elegans
gi|3880064|emb|CAA90319.1| Hypothetical protein Y45F3A.1
[Caenorhabditis elegans]
gi|3881024|emb|CAA21496.1| Hypothetical protein Y45F3A.1
[Caenorhabditis elegans]
Length = 329
Score = 273 bits (698), Expect = 5e-73
Identities = 139/139 (100%), Positives = 139/139 (100%)
Frame = -1
Query: 419 MAANNYNMDVETQRRIEYTRQKVMRIEQMNEQLRKLSKSNKGREEKLDRLLKRKESLELD 240
MAANNYNMDVETQRRIEYTRQKVMRIEQMNEQLRKLSKSNKGREEKLDRLLKRKESLELD
Sbjct: 1 MAANNYNMDVETQRRIEYTRQKVMRIEQMNEQLRKLSKSNKGREEKLDRLLKRKESLELD 60
Query: 239 VARLTDASMRAEPEVGAELLHSIEEPMEVDMIYGEAFHAKTCQLKVLLNEIIVRTSFNEK 60
VARLTDASMRAEPEVGAELLHSIEEPMEVDMIYGEAFHAKTCQLKVLLNEIIVRTSFNEK
Sbjct: 61 VARLTDASMRAEPEVGAELLHSIEEPMEVDMIYGEAFHAKTCQLKVLLNEIIVRTSFNEK 120
Query: 59 AMCKEIGHQEAEFENRLKE 3
AMCKEIGHQEAEFENRLKE
Sbjct: 121 AMCKEIGHQEAEFENRLKE 139