Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y43F4B_4
(1092 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17555882|ref|NP_499740.1| nuclear Pore complex Protein NPP-18... 751 0.0
gi|39583266|emb|CAE60058.1| Hypothetical protein CBG03573 [Caeno... 673 0.0
gi|50736549|ref|XP_419127.1| PREDICTED: similar to Nucleoporin S... 282 1e-74
gi|49118559|gb|AAH73561.1| Unknown (protein for MGC:82845) [Xeno... 280 4e-74
gi|29427941|sp|Q96EE3|SEH1_HUMAN Nucleoporin SEH1 (SEC13-like pr... 277 4e-73
gi|15214608|gb|AAH12430.1| Sec13-like protein [Homo sapiens] >gn... 277 4e-73
gi|13654288|ref|NP_112493.1| sec13-like protein; nucleoporin Seh... 277 4e-73
gi|20532338|ref|NP_082388.1| sec13-like protein [Mus musculus] >... 276 6e-73
gi|20072655|gb|AAH27244.1| Seh1l protein [Mus musculus] >gnl|BL_... 276 6e-73
gi|16552477|dbj|BAB71317.1| unnamed protein product [Homo sapiens] 275 1e-72
gi|37681939|gb|AAQ97847.1| sec13-like protein [Danio rerio] 266 8e-70
gi|34932115|ref|XP_225856.2| similar to Da1-6 [Rattus norvegicus] 259 1e-67
gi|31210203|ref|XP_314068.1| ENSANGP00000015675 [Anopheles gambi... 254 2e-66
gi|33086682|gb|AAP92653.1| Da1-6 [Rattus norvegicus] 248 2e-64
gi|19921784|ref|NP_610343.1| CG8722-PA [Drosophila melanogaster]... 242 1e-62
gi|47217902|emb|CAG05024.1| unnamed protein product [Tetraodon n... 234 3e-60
gi|41053981|ref|NP_956217.1| sec13-like protein; wu:fa02g03 [Dan... 206 8e-52
gi|28828652|gb|AAO51255.1| similar to Homo sapiens (Human). Sec1... 192 9e-48
gi|48137715|ref|XP_396810.1| similar to sec13-like protein; nucl... 179 1e-43
gi|50547023|ref|XP_500981.1| hypothetical protein [Yarrowia lipo... 157 3e-37
gi|19114663|ref|NP_593751.1| putative nuclear pore protein [Schi... 155 2e-36
gi|46437616|gb|EAK96959.1| hypothetical protein CaO19.9732 [Cand... 137 3e-31
gi|50310729|ref|XP_455386.1| unnamed protein product [Kluyveromy... 136 1e-30
gi|50291457|ref|XP_448161.1| unnamed protein product [Candida gl... 131 3e-29
gi|6321338|ref|NP_011415.1| Nuclear pore protein, homologous to ... 130 5e-29
gi|50419207|ref|XP_458126.1| unnamed protein product [Debaryomyc... 130 7e-29
gi|45198481|ref|NP_985510.1| AFL038Cp [Eremothecium gossypii] >g... 126 1e-27
gi|31207829|ref|XP_312881.1| ENSANGP00000014751 [Anopheles gambi... 120 7e-26
gi|45360589|ref|NP_988967.1| hypothetical protein MGC76017 [Xeno... 111 3e-23
gi|27696242|gb|AAH43755.1| Sec13l1-prov protein [Xenopus laevis] 109 1e-22
gi|49257408|gb|AAH73381.1| Unknown (protein for MGC:80813) [Xeno... 108 2e-22
gi|46441861|gb|EAL01155.1| hypothetical protein CaO19.316 [Candi... 106 8e-22
gi|47207697|emb|CAF89860.1| unnamed protein product [Tetraodon n... 105 2e-21
gi|29150272|ref|NP_077168.2| SEC13 related gene; SEC13 related g... 104 3e-21
gi|27712890|ref|XP_216257.1| similar to SEC13 related gene [Ratt... 104 3e-21
gi|47086987|ref|NP_998500.1| zgc:63980 [Danio rerio] >gnl|BL_ORD... 103 5e-21
gi|50754630|ref|XP_414450.1| PREDICTED: similar to Sec13l1 prote... 102 2e-20
gi|12844743|dbj|BAB26480.1| unnamed protein product [Mus musculus] 102 2e-20
gi|12805321|gb|AAH02128.1| Sec13l1 protein [Mus musculus] 102 2e-20
gi|34335136|ref|NP_109598.2| SEC13-like 1 isoform a; SEC13-relat... 101 3e-20
gi|34335134|ref|NP_899195.1| SEC13-like 1 isoform b; SEC13-relat... 101 3e-20
gi|28317166|gb|AAD46849.2| LD03471p [Drosophila melanogaster] 100 1e-19
gi|21356113|ref|NP_651977.1| CG6773-PA [Drosophila melanogaster]... 100 1e-19
gi|34897242|ref|NP_909967.1| putative coat protein complex II (C... 100 1e-19
gi|17544258|ref|NP_500086.1| protein transport protein SEC13 rel... 100 1e-19
gi|48140558|ref|XP_393516.1| similar to ENSANGP00000014751 [Apis... 99 2e-19
gi|21593146|gb|AAM65095.1| putative protein transport protein SE... 99 2e-19
gi|15227692|ref|NP_180566.1| transducin family protein / WD-40 r... 99 2e-19
gi|50426625|ref|XP_461910.1| unnamed protein product [Debaryomyc... 98 3e-19
gi|39585929|emb|CAE68218.1| Hypothetical protein CBG13889 [Caeno... 97 7e-19
gi|17544260|ref|NP_500087.1| protein transport protein SEC13 rel... 97 9e-19
gi|34393220|dbj|BAC82934.1| putative Sec13p [Oryza sativa (japon... 96 1e-18
gi|21593236|gb|AAM65185.1| transport protein SEC13, putative [Ar... 96 2e-18
gi|15232095|ref|NP_186783.1| protein transport protein SEC13 fam... 96 2e-18
gi|18147582|dbj|BAB83081.1| Sec13p [Oryza sativa] >gnl|BL_ORD_ID... 95 2e-18
gi|6323237|ref|NP_013309.1| cytoplasmic protein involved in rele... 92 2e-17
gi|49071142|ref|XP_399860.1| hypothetical protein UM02245.1 [Ust... 92 2e-17
gi|50291315|ref|XP_448090.1| unnamed protein product [Candida gl... 91 4e-17
gi|49093986|ref|XP_408454.1| hypothetical protein AN4317.2 [Aspe... 91 6e-17
gi|50256494|gb|EAL19219.1| hypothetical protein CNBH3180 [Crypto... 89 2e-16
gi|50259697|gb|EAL22367.1| hypothetical protein CNBB5400 [Crypto... 88 4e-16
gi|32405538|ref|XP_323382.1| hypothetical protein [Neurospora cr... 87 9e-16
gi|18266896|sp|P53024|SC13_PICPA Protein transport protein SEC13... 86 1e-15
gi|46134263|ref|XP_389447.1| hypothetical protein FG09271.1 [Gib... 86 1e-15
gi|7493828|pir||T10477 sec13 protein - yeast (Pichia pastoris) 86 1e-15
gi|50305967|ref|XP_452944.1| unnamed protein product [Kluyveromy... 84 4e-15
gi|45185885|ref|NP_983601.1| ACR199Cp [Eremothecium gossypii] >g... 84 8e-15
gi|19113484|ref|NP_596692.1| protein transport protein sec13 hom... 82 2e-14
gi|38102106|gb|EAA48983.1| hypothetical protein MG00641.4 [Magna... 81 4e-14
gi|50557258|ref|XP_506037.1| hypothetical protein [Yarrowia lipo... 81 5e-14
gi|23508990|ref|NP_701658.1| hypothetical protein [Plasmodium fa... 75 3e-12
gi|13544069|gb|AAH06167.1| Unknown (protein for IMAGE:3959959) [... 71 4e-11
gi|23478458|gb|EAA15542.1| hypothetical protein [Plasmodium yoel... 70 1e-10
gi|50233904|ref|NP_956441.2| similar to WD40 protein Ciao1 [Dani... 67 9e-10
gi|49097132|ref|XP_410026.1| hypothetical protein AN5889.2 [Aspe... 65 2e-09
gi|28279952|gb|AAH44534.1| Zgc:55911 protein [Danio rerio] 65 3e-09
gi|50289933|ref|XP_447398.1| unnamed protein product [Candida gl... 63 1e-08
gi|12832206|dbj|BAB22008.1| unnamed protein product [Mus musculus] 62 2e-08
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae... 61 4e-08
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC... 61 5e-08
gi|47213175|emb|CAF92184.1| unnamed protein product [Tetraodon n... 60 7e-08
gi|31542399|ref|NP_079572.2| WD40 protein Ciao1 [Mus musculus] >... 60 7e-08
gi|4757988|ref|NP_004795.1| WD40 protein Ciao1 [Homo sapiens] >g... 60 9e-08
gi|32394538|gb|AAM93967.1| protein stansport protein [Griffithsi... 59 2e-07
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae... 59 2e-07
gi|18408028|ref|NP_564830.1| transducin family protein / WD-40 r... 59 3e-07
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae... 59 3e-07
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae... 59 3e-07
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc... 58 4e-07
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc... 58 4e-07
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 57 1e-06
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 57 1e-06
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc... 57 1e-06
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho... 57 1e-06
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 56 2e-06
gi|21593083|gb|AAM65032.1| seh1-like protein [Arabidopsis thaliana] 56 2e-06
gi|25404474|pir||E96667 unknown protein, 62092-56687 [imported] ... 56 2e-06
gi|23486890|gb|EAA20921.1| hypothetical protein [Plasmodium yoel... 55 2e-06
gi|12584926|gb|AAG59882.1| seh1-like protein [Arabidopsis thaliana] 55 2e-06
gi|49072206|ref|XP_400392.1| hypothetical protein UM02777.1 [Ust... 55 2e-06
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 55 2e-06
gi|38110284|gb|EAA56026.1| hypothetical protein MG01677.4 [Magna... 55 2e-06
gi|50798183|ref|XP_423992.1| PREDICTED: similar to WD-repeat con... 55 2e-06
gi|31203399|ref|XP_310648.1| ENSANGP00000020796 [Anopheles gambi... 55 3e-06
gi|32406232|ref|XP_323729.1| predicted protein [Neurospora crass... 55 3e-06
gi|45185777|ref|NP_983493.1| ACR091Wp [Eremothecium gossypii] >g... 55 4e-06
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC... 54 5e-06
gi|31226862|ref|XP_317781.1| ENSANGP00000022244 [Anopheles gambi... 54 5e-06
gi|39581518|emb|CAE64254.1| Hypothetical protein CBG08899 [Caeno... 54 6e-06
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 54 6e-06
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 54 6e-06
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC... 54 6e-06
gi|48102256|ref|XP_395314.1| similar to CG12797-PA [Apis mellifera] 54 8e-06
gi|19115776|ref|NP_594864.1| putative chromatin assembly factor ... 54 8e-06
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 54 8e-06
gi|45508332|ref|ZP_00160671.1| COG2319: FOG: WD40 repeat [Anabae... 54 8e-06
gi|45190866|ref|NP_985120.1| AER263Cp [Eremothecium gossypii] >g... 53 1e-05
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol... 53 1e-05
gi|47212444|emb|CAG11397.1| unnamed protein product [Tetraodon n... 53 1e-05
gi|46123615|ref|XP_386361.1| hypothetical protein FG06185.1 [Gib... 53 1e-05
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 53 1e-05
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac... 52 2e-05
gi|4559414|gb|AAD23059.1| LIS [Mus musculus] 52 2e-05
gi|349828|gb|AAA02882.1| Miller-Dieker lissencephaly protein 52 2e-05
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd... 52 2e-05
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [... 52 2e-05
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy... 52 2e-05
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno... 52 2e-05
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd... 52 2e-05
gi|48097023|ref|XP_393667.1| similar to ENSANGP00000022244 [Apis... 52 2e-05
gi|48096118|ref|XP_392399.1| similar to CG8440-PA [Apis mellifera] 52 2e-05
gi|480009|pir||S36113 LIS-1 protein - human 52 2e-05
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 52 2e-05
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus] 52 2e-05
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus] 52 2e-05
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens] 52 2e-05
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL... 52 2e-05
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3... 52 2e-05
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy... 52 2e-05
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr... 52 2e-05
gi|47215488|emb|CAG01596.1| unnamed protein product [Tetraodon n... 52 2e-05
gi|18029281|gb|AAL56459.1| similar to retinoblastoma binding pro... 52 2e-05
gi|17391209|gb|AAH18512.1| 8030499H02Rik protein [Mus musculus] 52 2e-05
gi|19922278|ref|NP_610996.1| CG12797-PA [Drosophila melanogaster... 52 2e-05
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep... 52 2e-05
gi|15150805|ref|NP_150600.1| transducin beta-like 1Y; transducin... 52 2e-05
gi|17933648|ref|NP_524354.1| CG4236-PA [Drosophila melanogaster]... 52 2e-05
gi|41152231|ref|NP_958503.1| platelet-activating factor acetylhy... 52 3e-05
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis] 52 3e-05
gi|31207939|ref|XP_312936.1| ENSANGP00000014714 [Anopheles gambi... 52 3e-05
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7... 52 3e-05
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 52 3e-05
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae... 52 3e-05
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy... 51 4e-05
gi|26327737|dbj|BAC27612.1| unnamed protein product [Mus musculus] 51 4e-05
gi|28277505|gb|AAH45315.1| Unknown (protein for MGC:55349) [Dani... 51 4e-05
gi|17225202|gb|AAL37297.1| beta transducin-like protein HET-E4s ... 51 4e-05
gi|26326543|dbj|BAC27015.1| unnamed protein product [Mus musculus] 51 4e-05
gi|33468969|ref|NP_065626.1| transducin (beta)-like 1 X-linked; ... 51 4e-05
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex... 51 4e-05
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 51 4e-05
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 51 4e-05
gi|50258634|gb|EAL21321.1| hypothetical protein CNBD3750 [Crypto... 51 4e-05
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno... 51 4e-05
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc... 51 4e-05
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho... 51 4e-05
gi|32406548|ref|XP_323887.1| hypothetical protein [Neurospora cr... 51 5e-05
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 51 5e-05
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens] 51 5e-05
gi|50309847|ref|XP_454937.1| unnamed protein product [Kluyveromy... 51 5e-05
gi|33390985|gb|AAQ17185.1| WD40 protein Ciao1-like protein [Cras... 51 5e-05
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol... 51 5e-05
gi|50804410|ref|XP_424310.1| PREDICTED: similar to transducin (b... 51 5e-05
gi|50881441|gb|AAT85286.1| MSI type nucleosome/chromatin assembl... 51 5e-05
gi|45709030|gb|AAH67546.1| Rbb4l protein [Danio rerio] 50 7e-05
gi|47227921|emb|CAF97550.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|47221781|emb|CAG08835.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|47226994|emb|CAG05886.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|47086813|ref|NP_997775.1| Unknown (protein for MGC:85617) [Da... 50 7e-05
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd... 50 9e-05
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 50 9e-05
gi|17137500|ref|NP_477329.1| CG4063-PA [Drosophila melanogaster]... 50 9e-05
gi|50305243|ref|XP_452581.1| unnamed protein product [Kluyveromy... 50 9e-05
gi|31240513|ref|XP_320670.1| ENSANGP00000021164 [Anopheles gambi... 50 9e-05
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol... 50 9e-05
gi|50405084|ref|YP_054176.1| Transducin, putative [Paramecium te... 50 1e-04
gi|297906|emb|CAA50685.1| IEF SSP 9306 [Homo sapiens] 50 1e-04
gi|45382771|ref|NP_990001.1| Rbap46 polypeptide [Gallus gallus] ... 50 1e-04
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho... 50 1e-04
gi|19075884|ref|NP_588384.1| notchless-like; WD repeat protein [... 50 1e-04
gi|34871596|ref|XP_232764.2| similar to retinoblastoma-binding p... 50 1e-04
gi|2494893|sp|Q60972|RBB4_MOUSE Chromatin assembly factor 1 subu... 50 1e-04
gi|15929379|gb|AAH15123.1| Similar to retinoblastoma-binding pro... 50 1e-04
gi|11034672|dbj|BAB17174.1| P0407B12.11 [Oryza sativa (japonica ... 50 1e-04
gi|10383804|ref|NP_009997.2| Protein required for cell viability... 50 1e-04
gi|5032027|ref|NP_005601.1| retinoblastoma binding protein 4; MS... 50 1e-04
gi|45361415|ref|NP_989285.1| hypothetical protein MGC76124 [Xeno... 50 1e-04
gi|47937750|gb|AAH72311.1| MGC82618 protein [Xenopus laevis] 50 1e-04
gi|45382339|ref|NP_990183.1| chromatin assembly factor 1 p48 sub... 50 1e-04
gi|50603606|gb|AAH77257.1| Unknown (protein for MGC:79922) [Xeno... 50 1e-04
gi|3309245|gb|AAC26046.1| retinoblastoma A associated protein; R... 50 1e-04
gi|27503223|gb|AAH42283.1| Rbbp7-prov protein [Xenopus laevis] 50 1e-04
gi|23125398|ref|ZP_00107333.1| COG2319: FOG: WD40 repeat [Nostoc... 49 2e-04
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD... 49 2e-04
gi|50290845|ref|XP_447855.1| unnamed protein product [Candida gl... 49 2e-04
gi|41152229|ref|NP_958502.1| platelet-activating factor acetylhy... 49 2e-04
gi|49087072|ref|XP_405522.1| hypothetical protein AN1385.2 [Aspe... 49 2e-04
gi|39645450|gb|AAH63984.1| Retinoblastoma binding protein 4 [Dan... 49 2e-04
gi|47086841|ref|NP_997760.1| retinoblastoma binding protein 4 [D... 49 2e-04
gi|16331266|ref|NP_441994.1| beta transducin-like protein [Synec... 49 2e-04
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho... 49 2e-04
gi|47230304|emb|CAG10718.1| unnamed protein product [Tetraodon n... 49 2e-04
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe... 49 2e-04
gi|83249|pir||S19487 hypothetical protein YCR072c - yeast (Sacch... 49 2e-04
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae... 49 2e-04
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 49 2e-04
gi|29144967|gb|AAH49117.1| WD repeat domain 1 [Mus musculus] 49 2e-04
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc... 49 2e-04
gi|17566626|ref|NP_505737.1| WD repeat domain 5B (54.5 kD) (5L21... 49 2e-04
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I... 49 2e-04
gi|12836360|dbj|BAB23622.1| unnamed protein product [Mus musculus] 49 2e-04
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 49 2e-04
gi|6755995|ref|NP_035845.1| WD repeat domain 1; WD40 repeat prot... 49 2e-04
gi|12835959|dbj|BAB23435.1| unnamed protein product [Mus musculus] 49 2e-04
gi|46124841|ref|XP_386974.1| hypothetical protein FG06798.1 [Gib... 49 2e-04
gi|449693|prf||1919424A Miller-Dieker lissencephaly gene 49 2e-04
gi|31982059|ref|NP_033057.2| retinoblastoma binding protein 7; G... 49 2e-04
gi|2494892|sp|Q60973|RBB7_MOUSE Histone acetyltransferase type B... 49 2e-04
gi|4506439|ref|NP_002884.1| retinoblastoma binding protein 7; re... 49 2e-04
gi|25301665|pir||JC7558 chromatin assembly factor-1 p48 subunit ... 49 3e-04
gi|38105086|gb|EAA51555.1| hypothetical protein MG03150.4 [Magna... 49 3e-04
gi|4884326|emb|CAB43276.1| hypothetical protein [Homo sapiens] 49 3e-04
gi|12652891|gb|AAH00201.1| WD repeat-containing protein 1, isofo... 49 3e-04
gi|49120003|ref|XP_412324.1| hypothetical protein AN8187.2 [Aspe... 49 3e-04
gi|15241134|ref|NP_200424.1| transducin family protein / WD-40 r... 49 3e-04
gi|22329107|ref|NP_195025.2| transducin family protein / WD-40 r... 48 3e-04
gi|6624971|emb|CAB61534.1| transducin beta like 1 [Mus musculus] 48 3e-04
gi|16331137|ref|NP_441865.1| beta transducin-like protein [Synec... 48 3e-04
gi|2853277|gb|AAC02261.1| WD splicing factor Hprp4p [Homo sapiens] 48 3e-04
gi|6324322|ref|NP_014392.1| Required for amino acid permease tra... 48 3e-04
gi|5032159|ref|NP_005638.1| transducin beta-like 1X; transducin ... 48 3e-04
gi|4827056|ref|NP_005103.1| WD repeat-containing protein 1 isofo... 48 3e-04
gi|9257257|ref|NP_059830.1| WD repeat-containing protein 1 isofo... 48 3e-04
gi|50747214|ref|XP_420788.1| PREDICTED: similar to WDR1 protein ... 48 3e-04
gi|12230748|sp|O93277|WDR1_CHICK WD-repeat protein 1 (Actin inte... 48 3e-04
gi|49076638|ref|XP_402273.1| hypothetical protein UM04658.1 [Ust... 48 3e-04
gi|24431950|ref|NP_004688.2| PRP4 pre-mRNA processing factor 4 h... 48 3e-04
gi|2708305|gb|AAC51925.1| U4/U6 small nuclear ribonucleoprotein ... 48 3e-04
gi|34878397|ref|XP_341229.1| similar to Wdr1 protein [Rattus nor... 48 3e-04
gi|13938549|gb|AAH07424.1| PRP4 pre-mRNA processing factor 4 hom... 48 3e-04
gi|48146327|emb|CAG33386.1| PRPF4 [Homo sapiens] 48 3e-04
gi|23503100|sp|O60907|TBLX_HUMAN F-box-like/WD-repeat protein TB... 48 3e-04
gi|45200901|ref|NP_986471.1| AGL196Cp [Eremothecium gossypii] >g... 48 5e-04
gi|17017388|gb|AAL33648.1| MSI type nucleosome/chromatin assembl... 48 5e-04
gi|50543284|ref|XP_499808.1| hypothetical protein [Yarrowia lipo... 48 5e-04
gi|50757510|ref|XP_415544.1| PREDICTED: similar to U4/U6 small n... 48 5e-04
gi|49098124|ref|XP_410522.1| hypothetical protein AN6385.2 [Aspe... 48 5e-04
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 48 5e-04
gi|48893643|ref|ZP_00326841.1| COG2319: FOG: WD40 repeat [Tricho... 48 5e-04
gi|41054303|ref|NP_956049.1| Unknown (protein for MGC:65943); mg... 48 5e-04
gi|38090732|ref|XP_137286.2| similar to retinoblastoma-binding p... 47 6e-04
gi|34868449|ref|XP_233022.2| similar to U4/U6 small nuclear ribo... 47 6e-04
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]... 47 6e-04
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 47 6e-04
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 47 6e-04
gi|38086813|ref|XP_136080.2| similar to retinoblastoma-binding p... 47 6e-04
gi|26354947|dbj|BAC41100.1| unnamed protein product [Mus musculus] 47 6e-04
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 47 6e-04
gi|20832158|ref|XP_131444.1| PRP4 pre-mRNA processing factor 4 h... 47 6e-04
gi|30185730|gb|AAH51639.1| Prpf4 protein [Mus musculus] 47 6e-04
gi|17488592|gb|AAL40359.1| unknown protein [Takifugu rubripes] 47 6e-04
gi|17056923|gb|AAL34973.1| Miller-Dieker lissencephaly protein [... 47 8e-04
gi|38104097|gb|EAA50714.1| hypothetical protein MG04473.4 [Magna... 47 8e-04
gi|41054770|ref|NP_957333.1| similar to WD repeat domain 1 [Dani... 47 8e-04
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 47 8e-04
gi|37595360|gb|AAQ94566.1| WD repeat domain 1 [Danio rerio] >gnl... 47 8e-04
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7... 47 8e-04
gi|32420473|ref|XP_330680.1| hypothetical protein [Neurospora cr... 47 8e-04
gi|38104844|gb|EAA51352.1| hypothetical protein MG09369.4 [Magna... 47 8e-04
gi|47213925|emb|CAF90748.1| unnamed protein product [Tetraodon n... 47 0.001
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens] 47 0.001
gi|45270090|gb|AAS56426.1| YGR200C [Saccharomyces cerevisiae] 47 0.001
gi|6321639|ref|NP_011716.1| Elongator protein, part of the six-s... 47 0.001
gi|50419087|ref|XP_458066.1| unnamed protein product [Debaryomyc... 47 0.001
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol... 47 0.001
gi|49073067|ref|XP_400779.1| hypothetical protein UM03164.1 [Ust... 47 0.001
gi|48100231|ref|XP_392611.1| similar to TUWD12 [Apis mellifera] 47 0.001
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 47 0.001
gi|27732211|ref|XP_215837.1| WD40 protein Ciao1 [Rattus norvegicus] 47 0.001
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc... 47 0.001
gi|21222277|ref|NP_628056.1| putative WD-40 repeat protein [Stre... 46 0.001
gi|3122386|sp|O22466|MSI1_LYCES WD-40 repeat protein MSI1 >gnl|B... 46 0.001
gi|34865864|ref|XP_236595.2| similar to RIKEN cDNA E330026B02 [R... 46 0.001
gi|6320473|ref|NP_010553.1| Protein required for cell viability;... 46 0.001
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 46 0.001
gi|7479150|pir||T42045 beta transducin-like protein homolog - St... 46 0.001
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu... 46 0.001
gi|23593529|ref|XP_135092.2| RIKEN cDNA 2510040D07 [Mus musculus] 46 0.001
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g... 46 0.001
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 46 0.001
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae... 46 0.001
gi|49523068|gb|AAH75548.1| Unknown (protein for MGC:89488) [Xeno... 46 0.001
gi|38111378|gb|EAA56968.1| hypothetical protein MG07323.4 [Magna... 46 0.001
gi|46116924|ref|XP_384480.1| hypothetical protein FG04304.1 [Gib... 46 0.001
gi|32406078|ref|XP_323652.1| hypothetical protein [Neurospora cr... 46 0.002
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 46 0.002
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]... 46 0.002
gi|32473597|ref|NP_866591.1| putative WD-repeat containing prote... 46 0.002
gi|20269306|dbj|BAB91015.1| WD repeat1 protein [Cavia porcellus] 46 0.002
gi|22028422|gb|AAH34901.1| 2510040D07Rik protein [Mus musculus] 46 0.002
gi|46106236|ref|XP_380590.1| hypothetical protein FG00414.1 [Gib... 46 0.002
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster] 46 0.002
gi|28950172|emb|CAD71040.1| related to NUCLEAR MIGRATION PROTEIN... 46 0.002
gi|46107568|ref|XP_380843.1| hypothetical protein FG00667.1 [Gib... 46 0.002
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 46 0.002
gi|12846941|dbj|BAB27371.1| unnamed protein product [Mus musculus] 46 0.002
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 45 0.002
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 45 0.002
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 45 0.002
gi|49069454|ref|XP_399016.1| hypothetical protein UM01401.1 [Ust... 45 0.002
gi|11359003|pir||T45528 Arp2/3 complex chain sop2 - fission yeas... 45 0.002
gi|19112701|ref|NP_595909.1| probable arp2-3 complex 41 kd subun... 45 0.002
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae... 45 0.002
gi|50794621|ref|XP_428026.1| PREDICTED: similar to WD-repeat con... 45 0.002
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 45 0.002
gi|15240710|ref|NP_201533.1| WD-40 repeat family protein [Arabid... 45 0.002
gi|32412970|ref|XP_326965.1| hypothetical protein [Neurospora cr... 45 0.003
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide... 45 0.003
gi|17508661|ref|NP_492551.1| RetinoBlastoma Associated protein p... 45 0.003
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho... 45 0.003
gi|7490259|pir||T42364 conserved hypothetical protein - fission ... 45 0.003
gi|22450205|gb|AAM97148.1| sperm-associated WD repeat protein [M... 45 0.003
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 45 0.003
gi|12852956|dbj|BAB29591.1| unnamed protein product [Mus musculu... 45 0.003
gi|18401018|ref|NP_565615.1| transducin family protein / WD-40 r... 45 0.003
gi|31240155|ref|XP_320491.1| ENSANGP00000008643 [Anopheles gambi... 45 0.003
gi|34394959|dbj|BAC84508.1| putative WD40 protein Ciao1 [Oryza s... 45 0.004
gi|50311303|ref|XP_455676.1| unnamed protein product [Kluyveromy... 45 0.004
gi|34864785|ref|XP_343203.1| similar to TUWD12 [Rattus norvegicus] 45 0.004
gi|37748601|gb|AAH60007.1| MGC68560 protein [Xenopus laevis] 45 0.004
gi|2462069|emb|CAA04998.1| vanadium chloroperoxidase [Nostoc sp.... 45 0.004
gi|17228167|ref|NP_484715.1| WD-repeat protein [Nostoc sp. PCC 7... 45 0.004
gi|20977604|gb|AAM28229.1| nucleosome/chromatin assembly factor ... 45 0.004
gi|34857068|ref|XP_227252.2| similar to retinoblastoma-binding p... 45 0.004
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu... 45 0.004
gi|7446121|pir||T02617 hypothetical protein At2g26060 [imported]... 45 0.004
gi|39582675|emb|CAE73779.1| Hypothetical protein CBG21324 [Caeno... 45 0.004
gi|17508127|ref|NP_492552.1| RetinoBlastoma Associated protein p... 44 0.005
gi|13472512|ref|NP_104079.1| WD-repeart protein, beta transducin... 44 0.005
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot... 44 0.005
gi|46121319|ref|XP_385214.1| hypothetical protein FG05038.1 [Gib... 44 0.005
gi|3123169|sp|P90916|RBA2_CAEEL Trp-Asp repeats containing prote... 44 0.005
gi|23124911|ref|ZP_00106869.1| COG2319: FOG: WD40 repeat [Nostoc... 44 0.005
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis] 44 0.005
gi|46122641|ref|XP_385874.1| hypothetical protein FG05698.1 [Gib... 44 0.005
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 44 0.005
gi|39597733|emb|CAE68424.1| Hypothetical protein CBG14204 [Caeno... 44 0.005
gi|49125072|ref|XP_412642.1| hypothetical protein AN8505.2 [Aspe... 44 0.005
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 44 0.005
gi|48102237|ref|XP_395312.1| similar to PAK1 interacting protein... 44 0.005
gi|20988575|gb|AAH30541.1| WDR1 protein [Homo sapiens] 44 0.007
gi|30683865|ref|NP_188219.2| coatomer protein complex, subunit b... 44 0.007
gi|39595121|emb|CAE60158.1| Hypothetical protein CBG03710 [Caeno... 44 0.007
gi|31202521|ref|XP_310209.1| ENSANGP00000010454 [Anopheles gambi... 44 0.007
gi|15237273|ref|NP_200094.1| WD-40 repeat family protein / notch... 44 0.007
gi|5051805|emb|CAB45034.1| putative WD-repeat containing protein... 44 0.007
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v... 44 0.007
gi|50256850|gb|EAL19568.1| hypothetical protein CNBG1970 [Crypto... 44 0.007
gi|13027436|ref|NP_076469.1| apoptotic protease activating facto... 44 0.007
gi|9294445|dbj|BAB02664.1| coatomer protein complex, beta prime;... 44 0.007
gi|19113764|ref|NP_592852.1| WD domian, G-beta repeat protein [S... 44 0.007
gi|32698449|emb|CAA22322.2| Hypothetical protein Y18D10A.9 [Caen... 44 0.007
gi|30683862|ref|NP_850592.1| coatomer protein complex, subunit b... 44 0.007
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 44 0.009
gi|50291667|ref|XP_448266.1| unnamed protein product [Candida gl... 44 0.009
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol... 44 0.009
gi|46229807|gb|EAK90625.1| WD40 protein [Cryptosporidium parvum] 44 0.009
gi|34873865|ref|XP_237957.2| similar to RIKEN cDNA 2410044K02 [R... 44 0.009
gi|50551875|ref|XP_503412.1| hypothetical protein [Yarrowia lipo... 44 0.009
gi|39586943|emb|CAE62878.1| Hypothetical protein CBG07064 [Caeno... 44 0.009
gi|50289053|ref|XP_446956.1| unnamed protein product [Candida gl... 44 0.009
gi|50417412|gb|AAH77202.1| AIP1 protein [Xenopus laevis] 44 0.009
gi|32419589|ref|XP_330238.1| hypothetical protein [Neurospora cr... 44 0.009
gi|45768550|gb|AAH67651.1| Unknown (protein for IMAGE:6963216) [... 44 0.009
gi|32417850|ref|XP_329403.1| hypothetical protein [Neurospora cr... 44 0.009
gi|47218966|emb|CAG02004.1| unnamed protein product [Tetraodon n... 44 0.009
gi|17862164|gb|AAL39559.1| LD11036p [Drosophila melanogaster] 44 0.009
gi|42490855|gb|AAH66325.1| Unknown (protein for MGC:87234) [Homo... 44 0.009
gi|50294620|ref|XP_449721.1| unnamed protein product [Candida gl... 44 0.009
gi|14150171|ref|NP_115737.1| THO complex 3 [Homo sapiens] >gnl|B... 44 0.009
gi|7486207|pir||T05307 hypothetical protein F26P21.110 - Arabido... 44 0.009
gi|50750091|ref|XP_421865.1| PREDICTED: similar to PF20; sperm-a... 44 0.009
gi|21312090|ref|NP_082873.1| THO complex 3 [Mus musculus] >gnl|B... 44 0.009
gi|46397748|sp|Q8VE80|THO3_MOUSE THO complex subunit 3 (Tho3) >g... 44 0.009
gi|12230782|sp|Q9W7F2|WDR1_XENLA WD-repeat protein 1 (Actin inte... 44 0.009
gi|38104652|gb|EAA51186.1| hypothetical protein MG08708.4 [Magna... 44 0.009
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein... 44 0.009
gi|24640390|ref|NP_572401.2| CG12153-PA [Drosophila melanogaster... 44 0.009
gi|11346445|pir||A59246 HIRA protein - fruit fly (Drosophila mel... 44 0.009
gi|37231578|gb|AAH58365.1| Prp8bp-pending protein [Mus musculus] 43 0.011
gi|41019302|gb|AAR98560.1| GntN [Micromonospora echinospora] 43 0.011
gi|50428732|gb|AAT77083.1| putative WD G-beta repeat protein [Or... 43 0.011
gi|50752064|ref|XP_422637.1| PREDICTED: similar to beta prime co... 43 0.011
gi|21313414|ref|NP_079921.1| U5 snRNP-specific protein (Prp8-bin... 43 0.011
gi|486784|pir||S35342 Golgi-associated particle 102K chain - human 43 0.011
gi|27805865|ref|NP_776706.1| coatomer protein complex, subunit b... 43 0.011
gi|4758032|ref|NP_004757.1| coatomer protein complex, subunit be... 43 0.011
gi|27697187|gb|AAH41755.1| Wu:fc55e05-prov protein [Xenopus laevis] 43 0.011
gi|50286763|ref|XP_445811.1| unnamed protein product [Candida gl... 43 0.011
gi|17536759|ref|NP_493745.1| protein beta-transducin family (52.... 43 0.011
gi|3687833|gb|AAC62236.1| notchless [Xenopus laevis] 43 0.011
gi|46134449|ref|ZP_00157910.2| COG2319: FOG: WD40 repeat [Anabae... 43 0.011
gi|27882062|gb|AAH44710.1| Nle-pending-prov protein [Xenopus lae... 43 0.011
gi|47215078|emb|CAG04532.1| unnamed protein product [Tetraodon n... 43 0.011
gi|50549007|ref|XP_501974.1| hypothetical protein [Yarrowia lipo... 43 0.011
gi|45544464|emb|CAF34034.1| putative WD-repeat-containing protei... 43 0.011
gi|2623856|gb|AAC48360.1| HIRA homolog [Drosophila melanogaster] 43 0.011
gi|50556994|ref|XP_505905.1| hypothetical protein [Yarrowia lipo... 43 0.011
gi|11120716|ref|NP_068533.1| beta prime COP [Rattus norvegicus] ... 43 0.011
gi|29789080|ref|NP_056642.1| coatomer protein complex, subunit b... 43 0.011
gi|45360769|ref|NP_989058.1| hypothetical protein MGC75813 [Xeno... 43 0.011
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa... 43 0.011
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos... 43 0.011
gi|16306637|gb|AAH01494.1| U5 snRNP-specific 40 kDa protein (hPr... 43 0.011
gi|4758560|ref|NP_004805.1| U5 snRNP-specific 40 kDa protein (hP... 43 0.011
gi|50259040|gb|EAL21719.1| hypothetical protein CNBC5830 [Crypto... 43 0.011
gi|48128265|ref|XP_396624.1| similar to CG9615-PA [Apis mellifera] 43 0.015
gi|47228269|emb|CAG07664.1| unnamed protein product [Tetraodon n... 43 0.015
gi|50256458|gb|EAL19183.1| hypothetical protein CNBH2820 [Crypto... 43 0.015
gi|49523180|gb|AAH75588.1| Unknown (protein for MGC:89583) [Xeno... 43 0.015
gi|18139935|gb|AAL60198.1| WD40-repeat-containing protein [Chlam... 43 0.015
gi|34871679|ref|XP_232775.2| similar to U5 snRNP-specific protei... 43 0.015
gi|42568857|ref|NP_178242.2| transducin family protein / WD-40 r... 43 0.015
gi|34895466|ref|NP_909076.1| putative WD40-repeat protein [Oryza... 43 0.015
gi|31228182|ref|XP_318012.1| ENSANGP00000010744 [Anopheles gambi... 43 0.015
gi|50749745|ref|XP_421737.1| PREDICTED: similar to TAF5 RNA poly... 43 0.015
gi|25410898|pir||D84423 probable WD-40-repeat protein [imported]... 43 0.015
gi|31208599|ref|XP_313266.1| ENSANGP00000010488 [Anopheles gambi... 43 0.015
gi|50258709|gb|EAL21394.1| hypothetical protein CNBD0900 [Crypto... 43 0.015
gi|49387914|dbj|BAD25014.1| putative coatomer protein complex, s... 43 0.015
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae... 43 0.015
gi|49387913|dbj|BAD25013.1| putative Golgi-associated particle 1... 43 0.015
gi|46229832|gb|EAK90650.1| coatomer complex beta [Cryptosporidiu... 43 0.015
gi|50258424|gb|EAL21113.1| hypothetical protein CNBD4890 [Crypto... 42 0.019
gi|24663767|ref|NP_648640.1| CG10191-PA [Drosophila melanogaster... 42 0.019
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 42 0.019
gi|8922428|ref|NP_060566.1| Notchless gene homolog; similar to b... 42 0.019
gi|21703860|ref|NP_663406.1| Notchless gene homolog; Notchless g... 42 0.019
gi|19112019|ref|NP_595227.1| WD repeat protein [Schizosaccharomy... 42 0.019
gi|15237140|ref|NP_200631.1| WD-40 repeat protein (MSI1) [Arabid... 42 0.019
gi|33877287|gb|AAH02884.2| FLJ10458 protein [Homo sapiens] 42 0.019
gi|3746658|gb|AAC64041.1| Hira isoform [Drosophila melanogaster] 42 0.019
gi|50759611|ref|XP_417704.1| PREDICTED: similar to Prp8bp-pendin... 42 0.019
gi|49523567|emb|CAF18245.1| STYLOSA protein [Antirrhinum majus] 42 0.019
gi|31231745|ref|XP_318586.1| ENSANGP00000020892 [Anopheles gambi... 42 0.019
gi|3122601|sp|P93107|PF20_CHLRE Flagellar WD-repeat protein PF20... 42 0.019
gi|49097748|ref|XP_410334.1| NUDF_EMENI Nuclear migration protei... 42 0.019
gi|34872912|ref|XP_220770.2| similar to Notchless gene homolog; ... 42 0.019
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 42 0.019
gi|39592427|emb|CAE63504.1| Hypothetical protein CBG07981 [Caeno... 42 0.019
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 42 0.019
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n... 42 0.019
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu... 42 0.019
gi|23508658|ref|NP_701327.1| hypothetical protein [Plasmodium fa... 42 0.025
gi|50080158|ref|NP_001001940.1| coatomer protein complex, subuni... 42 0.025
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol... 42 0.025
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r... 42 0.025
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ... 42 0.025
gi|21224333|ref|NP_630112.1| putative membrane protein [Streptom... 42 0.025
gi|31232083|ref|XP_318645.1| ENSANGP00000020999 [Anopheles gambi... 42 0.025
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana] 42 0.025
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC... 42 0.025
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC... 42 0.025
gi|50256786|gb|EAL19506.1| hypothetical protein CNBG4530 [Crypto... 42 0.025
gi|2653736|gb|AAB87640.1| U4/U6 snRNP 60 kDa protein [Homo sapiens] 42 0.025
gi|17509729|ref|NP_493247.1| transducin WD-40 repeat protein fam... 42 0.025
gi|49115497|gb|AAH73405.1| Unknown (protein for MGC:80868) [Xeno... 42 0.025
gi|21355245|ref|NP_648990.1| CG6322-PA [Drosophila melanogaster]... 42 0.033
gi|28894846|gb|AAO61444.1| Uncoordinated protein 78, isoform b [... 42 0.033
gi|48099312|ref|XP_394888.1| similar to Hypothetical protein MGC... 42 0.033
gi|23490239|gb|EAA22065.1| notchless-related [Plasmodium yoelii ... 42 0.033
gi|20810487|gb|AAH29520.1| WDSAM1 protein [Homo sapiens] 42 0.033
gi|22749103|ref|NP_689741.1| WD repeat and SAM domain containing... 42 0.033
gi|15218215|ref|NP_175645.1| coatomer protein complex, subunit b... 42 0.033
gi|50417036|ref|XP_457626.1| unnamed protein product [Debaryomyc... 42 0.033
gi|28893469|ref|NP_796316.1| TAF5 RNA polymerase II, TATA box bi... 42 0.033
gi|47117222|sp|Q8C092|TAF5_MOUSE Transcription initiation factor... 42 0.033
gi|17570175|ref|NP_508590.1| UNCoordinated locomotion UNC-78, WD... 42 0.033
gi|27924436|gb|AAH45034.1| Prp8bp-pending-prov protein [Xenopus ... 42 0.033
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis] 42 0.033
gi|27804457|gb|AAO22525.1| leunig [Brassica rapa subsp. pekinensis] 42 0.033
gi|20091406|ref|NP_617481.1| WD-domain containing protein [Metha... 41 0.043
gi|1491718|emb|CAA64777.1| hTAFII100 [Homo sapiens] 41 0.043
gi|47224493|emb|CAG08743.1| unnamed protein product [Tetraodon n... 41 0.043
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 41 0.043
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 41 0.043
gi|417122|sp|P32479|HIR1_YEAST Histone transcription regulator 1 41 0.043
gi|34851232|ref|XP_214635.2| similar to katanin p80 subunit B 1;... 41 0.043
gi|17568701|ref|NP_510394.1| WD repeat domain 5B (43.1 kD) (XO96... 41 0.043
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae... 41 0.043
>gi|17555882|ref|NP_499740.1| nuclear Pore complex Protein NPP-18,
sec13-like nucleoporin Seh1 (41.7 kD) (npp-18)
[Caenorhabditis elegans]
gi|7509792|pir||T26842 hypothetical protein Y43F4B.4 - Caenorhabditis
elegans
gi|3880929|emb|CAA16333.1| C. elegans NPP-18 protein (corresponding
sequence Y43F4B.4) [Caenorhabditis elegans]
Length = 363
Score = 751 bits (1940), Expect = 0.0
Identities = 363/363 (100%), Positives = 363/363 (100%)
Frame = +1
Query: 1 MQEDDSVKPFQTVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKC 180
MQEDDSVKPFQTVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKC
Sbjct: 1 MQEDDSVKPFQTVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKC 60
Query: 181 HGGAVWRVIWAHPEFGQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRS 360
HGGAVWRVIWAHPEFGQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRS
Sbjct: 61 HGGAVWRVIWAHPEFGQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRS 120
Query: 361 DVTDICFSPRHLGLMMASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGCVTWSLS 540
DVTDICFSPRHLGLMMASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGCVTWSLS
Sbjct: 121 DVTDICFSPRHLGLMMASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGCVTWSLS 180
Query: 541 RMHRPLIAVGSDEKKAENKKRVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVD 720
RMHRPLIAVGSDEKKAENKKRVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVD
Sbjct: 181 RMHRPLIAVGSDEKKAENKKRVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVD 240
Query: 721 SHQLAVASGDVHVYNIKVARSAILEEDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLM 900
SHQLAVASGDVHVYNIKVARSAILEEDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLM
Sbjct: 241 SHQLAVASGDVHVYNIKVARSAILEEDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLM 300
Query: 901 GSVISSTSLDGTLRSWKSLFVNQWVKLSEMNVDDYVPSPEEVRAFISSKTTERLPSQLEK 1080
GSVISSTSLDGTLRSWKSLFVNQWVKLSEMNVDDYVPSPEEVRAFISSKTTERLPSQLEK
Sbjct: 301 GSVISSTSLDGTLRSWKSLFVNQWVKLSEMNVDDYVPSPEEVRAFISSKTTERLPSQLEK 360
Query: 1081 TYF 1089
TYF
Sbjct: 361 TYF 363
>gi|39583266|emb|CAE60058.1| Hypothetical protein CBG03573
[Caenorhabditis briggsae]
Length = 366
Score = 673 bits (1736), Expect = 0.0
Identities = 315/357 (88%), Positives = 341/357 (95%)
Frame = +1
Query: 19 VKPFQTVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDRKPDGNWRRSAHWKCHGGAVW 198
++P++TVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDR+PDGNWRRSAHWKCHGGAVW
Sbjct: 10 IEPYKTVGAHRDLIHCVSFDPHGRRMATCASDMTMAIWDRQPDGNWRRSAHWKCHGGAVW 69
Query: 199 RVIWAHPEFGQIVATCSYDRTIVIWEEQIVRSEKDLKQKESQWIRRTIISDNRSDVTDIC 378
RVIWAHPEFGQIVA+CSYDRTIVIWEEQIVR+EKDLK KESQWIRRTIISDNRSDVTDIC
Sbjct: 70 RVIWAHPEFGQIVASCSYDRTIVIWEEQIVRTEKDLKCKESQWIRRTIISDNRSDVTDIC 129
Query: 379 FSPRHLGLMMASCNVLGTVRIYEAPDIVDASRWNLIHELQAFHTRCGCVTWSLSRMHRPL 558
FSPRHLGL +ASCNVLG VRIYEAPD+VDASRWNLIHELQAFHTRCGCVTWSLSRMHRPL
Sbjct: 130 FSPRHLGLSLASCNVLGAVRIYEAPDVVDASRWNLIHELQAFHTRCGCVTWSLSRMHRPL 189
Query: 559 IAVGSDEKKAENKKRVVIYENIDGLRKWQRINSLVFDLPCPITDLKFSPISMVDSHQLAV 738
IAVGSDEKKA K+RVVIYENIDGLRKWQRI+SLVFD+PCPITDLKFSPISMVDSHQLA+
Sbjct: 190 IAVGSDEKKAGGKERVVIYENIDGLRKWQRIHSLVFDMPCPITDLKFSPISMVDSHQLAI 249
Query: 739 ASGDVHVYNIKVARSAILEEDGVENPIQLADYNLIKVALLGDHRKAWRLRYNLMGSVISS 918
ASGDVHV+NIKV R+AILEEDGV+NPI LADY+ +VALLGD RKAWR+RYNL+GSVI+S
Sbjct: 250 ASGDVHVFNIKVPRTAILEEDGVDNPIHLADYSFQRVALLGDQRKAWRIRYNLIGSVITS 309
Query: 919 TSLDGTLRSWKSLFVNQWVKLSEMNVDDYVPSPEEVRAFISSKTTERLPSQLEKTYF 1089
TSLDGTLRSWKSLFVNQWVKLSEMNVDDYVP+ +EV + +KTTERLPSQL+K YF
Sbjct: 310 TSLDGTLRSWKSLFVNQWVKLSEMNVDDYVPTADEVHKIVEAKTTERLPSQLDKVYF 366