Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y41D4B_20
(198 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17543286|ref|NP_500115.1| ribosomal protein S28e (7.4 kD) (4C... 103 8e-22
gi|31205489|ref|XP_311696.1| ENSANGP00000015156 [Anopheles gambi... 83 1e-15
gi|22001967|sp|Q90YP3|RS28_ICTPU 40S ribosomal protein S28 >gnl|... 82 3e-15
gi|30267871|gb|AAP21778.1| ribosomal protein S28 [Branchiostoma ... 82 3e-15
gi|45268967|gb|AAS55896.1| 40S ribosomal protein S28 [Sus scrofa] 80 2e-14
gi|12239511|gb|AAG49498.1| ribosomal protein S28 [Cricetulus gri... 80 2e-14
gi|4506715|ref|NP_001022.1| ribosomal protein S28; 40S ribosomal... 80 2e-14
gi|34879186|ref|XP_344538.1| similar to 40S ribosomal protein S2... 80 2e-14
gi|47216403|emb|CAG01954.1| unnamed protein product [Tetraodon n... 79 3e-14
gi|37951023|emb|CAD86893.1| CG15527 [Drosophila simulans] >gnl|B... 79 3e-14
gi|2995699|gb|AAC08344.1| 40S ribosomal protein S28 [Ostertagia ... 77 1e-13
gi|37951017|emb|CAD86890.1| CG15527 [Drosophila simulans] >gnl|B... 77 1e-13
gi|34879172|ref|XP_344536.1| similar to 40S ribosomal protein S2... 77 1e-13
gi|38048191|gb|AAR09998.1| similar to Drosophila melanogaster CG... 77 1e-13
gi|18858095|ref|NP_572568.1| CG2998-PA [Drosophila melanogaster]... 77 1e-13
gi|37951025|emb|CAD86894.1| CG15527 [Drosophila simulans] >gnl|B... 76 2e-13
gi|24651257|ref|NP_651764.1| CG15527-PA [Drosophila melanogaster... 76 2e-13
gi|37951015|emb|CAD86889.1| CG15527 [Drosophila simulans] >gnl|B... 75 4e-13
gi|37951021|emb|CAD86892.1| CG15527 [Drosophila simulans] 74 7e-13
gi|34868100|ref|XP_344014.1| similar to 40S ribosomal protein S2... 74 7e-13
gi|15213842|gb|AAK92196.1| ribosomal protein S28 [Spodoptera fru... 74 1e-12
gi|31195959|ref|XP_306927.1| ENSANGP00000013820 [Anopheles gambi... 69 3e-11
gi|32400865|gb|AAP80664.1| S28 ribosomal protein [Triticum aesti... 69 4e-11
gi|464715|sp|P33286|RS28_KLUMA 40S ribosomal protein S28 (S33) >... 69 4e-11
gi|50311927|ref|XP_455995.1| RS28_KLULA [Kluyveromyces lactis] >... 69 4e-11
gi|50547987|ref|XP_501463.1| hypothetical protein [Yarrowia lipo... 68 6e-11
gi|50292107|ref|XP_448486.1| unnamed protein product [Candida gl... 68 6e-11
gi|45201357|ref|NP_986927.1| AGR261Wp [Eremothecium gossypii] >g... 67 1e-10
gi|34932164|ref|XP_344695.1| similar to 40S ribosomal protein S2... 67 1e-10
gi|46108760|ref|XP_381438.1| hypothetical protein FG01262.1 [Gib... 67 1e-10
gi|32409947|ref|XP_325454.1| hypothetical protein [Neurospora cr... 67 1e-10
gi|6324741|ref|NP_014810.1| Protein component of the small (40S)... 67 1e-10
gi|6323294|ref|NP_013366.1| Protein component of the small (40S)... 67 1e-10
gi|3947719|emb|CAA10101.1| ribosomal protein S28 [Prunus persica... 67 1e-10
gi|50421107|ref|XP_459098.1| unnamed protein product [Debaryomyc... 66 2e-10
gi|40287500|gb|AAR83864.1| 28 kDa small subunit ribosomal protei... 66 2e-10
gi|2739219|emb|CAA04565.1| rpS28 [Hordeum vulgare subsp. vulgare] 66 2e-10
gi|3947725|emb|CAA10104.1| ribosomal protein S28 [Prunus persica] 66 2e-10
gi|11276650|pir||T45114 ribosomal protein S28 - fission yeast (S... 65 3e-10
gi|19075843|ref|NP_588343.1| probable 40s ribosomal protein 28s ... 65 3e-10
gi|1173237|sp|P46302|RS28_MAIZE 40S RIBOSOMAL PROTEIN S28 >gnl|B... 65 3e-10
gi|34875936|ref|XP_346048.1| similar to 40S ribosomal protein S2... 65 5e-10
gi|21902507|gb|AAM78552.1| ribosomal protein small subunit 28 kD... 65 5e-10
gi|38099314|gb|EAA46673.1| hypothetical protein MG09894.4 [Magna... 64 7e-10
gi|49099471|ref|XP_410769.1| hypothetical protein AN6632.2 [Aspe... 64 9e-10
gi|23479021|gb|EAA15961.1| Ribosomal protein S28e [Plasmodium yo... 63 2e-09
gi|23509807|ref|NP_702474.1| ribosomal protein S28e, putative [P... 62 3e-09
gi|13812293|ref|NP_113411.1| 40S ribosomal protein S28 [Guillard... 62 3e-09
gi|34871309|ref|XP_343886.1| similar to 40S ribosomal protein S2... 61 7e-09
gi|46227984|gb|EAK88904.1| similar to 40S ribosomal protein S28,... 60 2e-08
gi|15232831|ref|NP_187620.1| 40S ribosomal protein S28 (RPS28A) ... 59 2e-08
gi|15237617|ref|NP_201219.1| 40S ribosomal protein S28 (RPS28C) ... 59 3e-08
gi|49068196|ref|XP_398387.1| hypothetical protein UM00772.1 [Ust... 58 5e-08
gi|38083652|ref|XP_358517.1| hypothetical protein XP_358517 [Mus... 53 2e-06
gi|8894681|emb|CAB95841.1| ribosomal protein S33 [Leishmania inf... 52 5e-06
gi|20094881|ref|NP_614728.1| Ribosomal protein S28E/S33 [Methano... 51 6e-06
gi|29250236|gb|EAA41733.1| GLP_554_36117_36311 [Giardia lamblia ... 51 6e-06
gi|41615149|ref|NP_963647.1| NEQ359 [Nanoarchaeum equitans Kin4-... 51 8e-06
gi|14520883|ref|NP_126358.1| SSU ribosomal protein S28E [Pyrococ... 47 1e-04
gi|34810006|pdb|1NY4|A Chain A, Solution Structure Of The 30s Ri... 47 1e-04
gi|18977740|ref|NP_579097.1| SSU ribosomal protein S28E [Pyrococ... 47 1e-04
gi|13541281|ref|NP_110969.1| 30S ribosomal protein S28E [Thermop... 46 2e-04
gi|34304494|gb|AAQ63316.1| 40S ribosomal protein S28 [Hippocampu... 46 2e-04
gi|11498371|ref|NP_069599.1| SSU ribosomal protein S28E (rps28E)... 45 3e-04
gi|18314007|ref|NP_560674.1| ribosomal protein S28 [Pyrobaculum ... 45 3e-04
gi|14602030|ref|NP_148575.1| 30S ribosomal protein S28 [Aeropyru... 45 3e-04
gi|12231039|sp|Q9Y9A6|RS28_AERPE 30S ribosomal protein S28e 45 3e-04
gi|15897178|ref|NP_341783.1| SSU ribosomal protein S28E (rps28E)... 45 4e-04
gi|19173247|ref|NP_597050.1| 40S RIBOSOMAL PROTEIN S28 [Encephal... 45 4e-04
gi|15678284|ref|NP_275399.1| ribosomal protein S28 [Methanotherm... 45 4e-04
gi|20140180|sp|Q980Q5|RS28_SULSO 30S ribosomal protein S28e 45 4e-04
gi|16082137|ref|NP_394574.1| probable 30S ribosomal protein S28 ... 45 6e-04
gi|15920472|ref|NP_376141.1| 83aa long hypothetical 30S ribosoma... 45 6e-04
gi|48478353|ref|YP_024059.1| small subunit ribosomal protein S28... 44 7e-04
gi|12231024|sp|P54065|RS28_METJA 30S ribosomal protein S28E 44 7e-04
gi|15669388|ref|NP_248197.1| SSU ribosomal protein S28E [Methano... 44 7e-04
gi|48852097|ref|ZP_00306288.1| COG2053: Ribosomal protein S28E/S... 44 0.001
gi|14270770|emb|CAC39482.1| small subunit ribosomal protein [Que... 41 0.006
gi|12230579|sp|P57710|RS28_HALN1 30S ribosomal protein S28e >gnl... 41 0.008
gi|45358203|ref|NP_987760.1| SSU ribosomal protein S28E [Methano... 40 0.014
gi|21228568|ref|NP_634490.1| SSU ribosomal protein S28E [Methano... 38 0.068
gi|20090381|ref|NP_616456.1| ribosomal protein S28e [Methanosarc... 38 0.068
gi|41720210|ref|ZP_00149023.1| COG2053: Ribosomal protein S28E/S... 37 0.088
gi|39592304|emb|CAE75525.1| Hypothetical protein CBG23547 [Caeno... 33 1.3
gi|50411631|ref|XP_457064.1| unnamed protein product [Debaryomyc... 33 1.7
gi|50727020|gb|AAT81176.1| Hypothetical protein Y34D9A.4 [Caenor... 33 2.2
gi|18490767|gb|AAH22700.1| Kcnj14 protein [Mus musculus] 33 2.2
gi|24962814|ref|NP_733836.1| potassium inwardly-rectifying chann... 33 2.2
gi|26326699|dbj|BAC27093.1| unnamed protein product [Mus musculus] 33 2.2
gi|26336737|dbj|BAC32051.1| unnamed protein product [Mus musculus] 33 2.2
gi|20828250|ref|XP_133468.1| similar to Kir2.4 protein [Mus musc... 33 2.2
gi|41053979|ref|NP_956216.1| Unknown (protein for MGC:63796); wu... 33 2.2
gi|6324046|ref|NP_014116.1| cell wall integrity and stress respo... 33 2.2
gi|17509843|ref|NP_490809.1| putative protein (1B504) [Caenorhab... 33 2.2
gi|17561512|ref|NP_506158.1| predicted CDS, putative protein fam... 33 2.2
gi|10441455|gb|AAG17050.1| inwardly-rectifying potassium channel... 32 2.8
gi|7019439|ref|NP_037480.1| potassium inwardly-rectifying channe... 32 2.8
gi|34861507|ref|XP_342002.1| zinc finger protein 162 [Rattus nor... 32 3.7
gi|46133979|ref|XP_389305.1| hypothetical protein FG09129.1 [Gib... 32 4.9
gi|21751020|dbj|BAC03887.1| unnamed protein product [Homo sapiens] 32 4.9
gi|47212789|emb|CAF93151.1| unnamed protein product [Tetraodon n... 31 6.3
gi|47211703|emb|CAF88759.1| unnamed protein product [Tetraodon n... 31 6.3
gi|50751508|ref|XP_422432.1| PREDICTED: similar to selenoprotein... 31 6.3
gi|32406106|ref|XP_323666.1| hypothetical protein [Neurospora cr... 31 6.3
gi|50728618|ref|XP_416205.1| PREDICTED: similar to ATF7IP protei... 31 6.3
gi|23129915|ref|ZP_00111736.1| COG3409: Putative peptidoglycan-b... 31 6.3
gi|7438327|pir||T03988 Myb-like transcription regulator P - maiz... 31 8.3
gi|29294655|ref|NP_803251.1| melanoma antigen, family C, 3 prote... 31 8.3
gi|127588|sp|P27898|MYBP_MAIZE Myb-related protein P >gnl|BL_ORD... 31 8.3
gi|24647572|ref|NP_650587.1| CG5225-PA [Drosophila melanogaster]... 31 8.3
gi|32418548|ref|XP_329752.1| predicted protein [Neurospora crass... 31 8.3
gi|34903100|ref|NP_912897.1| unnamed protein product [Oryza sati... 31 8.3
gi|16507120|gb|AAL24047.1| myb-like transcription factor [Zea mays] 31 8.3
gi|7441921|pir||T06594 heat shock protein dnaJ - garden pea >gnl... 31 8.3
gi|50762215|ref|XP_429203.1| PREDICTED: similar to ubiquitin ass... 31 8.3
>gi|17543286|ref|NP_500115.1| ribosomal protein S28e (7.4 kD)
(4C425) [Caenorhabditis elegans]
gi|14574339|gb|AAK68479.1| Ribosomal protein, small subunit protein
28 [Caenorhabditis elegans]
gi|39587955|emb|CAE67974.1| Hypothetical protein CBG13580
[Caenorhabditis briggsae]
Length = 65
Score = 103 bits (258), Expect = 8e-22
Identities = 51/51 (100%), Positives = 51/51 (100%)
Frame = +1
Query: 1 MDKLTLARVTKVIGRTGSQGQCTQVRVEFINDQNNRSIIRNVKGPVREGDI 153
MDKLTLARVTKVIGRTGSQGQCTQVRVEFINDQNNRSIIRNVKGPVREGDI
Sbjct: 1 MDKLTLARVTKVIGRTGSQGQCTQVRVEFINDQNNRSIIRNVKGPVREGDI 51