Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= Y17G7B_22
         (1137 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17536953|ref|NP_496573.1| related to bicoid interacting prote...   744   0.0
gi|17536951|ref|NP_496572.1| related to bicoid interacting prote...   739   0.0
gi|39591487|emb|CAE73541.1| Hypothetical protein CBG21009 [Caeno...   623   e-177
gi|31543172|ref|NP_659162.2| DNA segment, Chr 5, Wayne State Uni...   223   5e-57
gi|34871399|ref|XP_222048.2| similar to Hypothetical protein MGC...   223   8e-57
gi|47271406|ref|NP_062552.2| hypothetical protein FLJ20257 [Homo...   221   2e-56
gi|47227229|emb|CAG00591.1| unnamed protein product [Tetraodon n...   211   3e-53
gi|21357335|ref|NP_649577.1| CG1239-PA [Drosophila melanogaster]...   207   3e-52
gi|8843849|dbj|BAA97375.1| unnamed protein product [Arabidopsis ...   180   6e-44
gi|18423241|ref|NP_568752.1| expressed protein [Arabidopsis thal...   180   6e-44
gi|48097282|ref|XP_393742.1| similar to CG13466-PA [Apis mellifera]   166   9e-40
gi|38636673|dbj|BAD03094.1| bicoid-interacting protein 3-like [O...   163   8e-39
gi|16877853|gb|AAH17157.1| D5Wsu46e protein [Mus musculus]            162   1e-38
gi|7020228|dbj|BAA91040.1| unnamed protein product [Homo sapiens...   160   7e-38
gi|31240051|ref|XP_320439.1| ENSANGP00000016906 [Anopheles gambi...   140   4e-32
gi|7528184|gb|AAF63187.1| bicoid-interacting protein BIN3 [Droso...   134   4e-30
gi|24585988|ref|NP_724468.1| CG8276-PA [Drosophila melanogaster]...   134   4e-30
gi|19113012|ref|NP_596220.1| hypothetical protein [Schizosacchar...   110   6e-23
gi|48094729|ref|XP_392173.1| similar to CG11342-PA [Apis mellifera]    71   4e-11
gi|49068220|ref|XP_398399.1| hypothetical protein UM00784.1 [Ust...    69   3e-10
gi|23490235|gb|EAA22061.1| hypothetical protein [Plasmodium yoel...    59   2e-07
gi|24657574|ref|NP_647896.1| CG11342-PA [Drosophila melanogaster...    59   2e-07
gi|23508655|ref|NP_701324.1| hypothetical protein [Plasmodium fa...    54   5e-06
gi|38048679|gb|AAR10242.1| similar to Drosophila melanogaster CG...    53   1e-05
gi|33417180|gb|AAH56133.1| MGC69172 protein [Xenopus laevis]           52   2e-05
gi|16740698|gb|AAH16225.1| RIKEN cDNA 4930556P03 [Mus musculus]        52   2e-05
gi|32171233|ref|NP_859059.1| hypothetical protein LOC144233 [Hom...    52   2e-05
gi|34868174|ref|XP_343332.1| similar to RIKEN cDNA 4930556P03 [R...    52   3e-05
gi|21312918|ref|NP_083512.1| RIKEN cDNA 4930556P03 [Mus musculus...    52   3e-05
gi|47220714|emb|CAG11783.1| unnamed protein product [Tetraodon n...    48   5e-04
gi|15643837|ref|NP_228885.1| ribosomal protein L11 methyltransfe...    45   0.003
gi|48095531|ref|XP_392316.1| similar to protein-L-isoaspartate(D...    44   0.005
gi|37521085|ref|NP_924462.1| hypothetical protein glr1516 [Gloeo...    42   0.026
gi|37521087|ref|NP_924464.1| hypothetical protein glr1518 [Gloeo...    42   0.026
gi|50806781|ref|XP_428854.1| PREDICTED: similar to RIKEN cDNA 49...    42   0.034
gi|23509393|ref|NP_702060.1| hypothetical protein [Plasmodium fa...    41   0.045
gi|30018371|ref|NP_830002.1| 16S rRNA m(2)G 1207 methyltransfera...    41   0.059
gi|31225274|ref|XP_317552.1| ENSANGP00000007195 [Anopheles gambi...    40   0.10
gi|23509352|ref|NP_702019.1| hypothetical protein [Plasmodium fa...    40   0.10
gi|20092272|ref|NP_618347.1| conserved hypothetical protein [Met...    40   0.10
gi|50290047|ref|XP_447455.1| unnamed protein product [Candida gl...    40   0.13
gi|17552558|ref|NP_497990.1| predicted RNA methylase like (23.9 ...    40   0.13
gi|23508475|ref|NP_701144.1| methyltransferase, putative [Plasmo...    40   0.13
gi|479886|pir||S35570 sex-determining protein Sry - target rat >...    40   0.13
gi|6634096|emb|CAB64265.1| BIP2 protein [Drosophila melanogaster]      39   0.17
gi|24638625|ref|NP_651923.2| CG2009-PA [Drosophila melanogaster]...    39   0.17
gi|4584215|emb|CAB40628.1| Bip2 protein [Drosophila melanogaster...    39   0.17
gi|47223966|emb|CAG06143.1| unnamed protein product [Tetraodon n...    39   0.17
gi|6319508|ref|NP_009590.1| Nuclear SAM-dependent mono- and asym...    39   0.22
gi|30022804|ref|NP_834435.1| Spore germination protein IA [Bacil...    39   0.22
gi|50255596|gb|EAL18329.1| hypothetical protein CNBJ2520 [Crypto...    39   0.22
gi|42779182|ref|NP_976429.1| ybxB protein [Bacillus cereus ATCC ...    39   0.22
gi|21398063|ref|NP_654048.1| hypothetical protein predicted by G...    39   0.22
gi|49476714|ref|YP_034453.1| conserved hypothetical protein, pos...    39   0.22
gi|463148|gb|AAA40141.1| sex determining protein                       39   0.22
gi|37526150|ref|NP_929494.1| hypothetical protein [Photorhabdus ...    39   0.22
gi|39585444|emb|CAE70527.1| Hypothetical protein CBG17156 [Caeno...    39   0.22
gi|15616471|ref|NP_244777.1| biotin synthesis BioC proein [Bacil...    39   0.29
gi|8163703|gb|AAF73811.1| surface protein PspC [Streptococcus pn...    39   0.29
gi|48892609|ref|ZP_00325960.1| COG0500: SAM-dependent methyltran...    39   0.29
gi|23127147|ref|ZP_00109022.1| COG0500: SAM-dependent methyltran...    39   0.29
gi|50306073|ref|XP_452998.1| unnamed protein product [Kluyveromy...    39   0.29
gi|16555382|gb|AAL23764.1| sex-determining protein [Mus minutoides]    39   0.29
gi|463142|gb|AAA40138.1| sex determining protein                       39   0.29
gi|463144|gb|AAA40139.1| sex determining protein                       39   0.29
gi|13473166|ref|NP_104733.1| methyl transferase-like protein [Me...    39   0.29
gi|4102980|gb|AAD09328.1| virulent strain associated lipoprotein...    38   0.38
gi|46431856|gb|EAK91379.1| hypothetical protein CaO19.7818 [Cand...    38   0.38
gi|16805048|ref|NP_473077.1| hypothetical protein [Plasmodium fa...    38   0.38
gi|47570394|ref|ZP_00241034.1| 16S rRNA m(2)G 1207 methyltransfe...    38   0.38
gi|17554502|ref|NP_497888.1| putative nuclear protein, with 2 co...    38   0.38
gi|39593526|emb|CAE61818.1| Hypothetical protein CBG05788 [Caeno...    38   0.38
gi|11496756|ref|NP_045547.1| B. burgdorferi predicted coding reg...    38   0.38
gi|630734|pir||S43597 coiled-coil protein homolog R07E5.6 - Caen...    38   0.38
gi|32422567|ref|XP_331727.1| hypothetical protein [Neurospora cr...    38   0.50
gi|45358248|ref|NP_987805.1| SAM (and some other nucleotide) bin...    38   0.50
gi|46431840|gb|EAK91364.1| hypothetical protein CaO19.188 [Candi...    38   0.50
gi|50405156|ref|YP_054248.1| Fork head domain protein, putative ...    38   0.50
gi|46133767|ref|ZP_00157688.2| COG0500: SAM-dependent methyltran...    38   0.50
gi|479884|pir||S35568 sex-determining protein Sry - multimammate...    38   0.50
gi|46359907|gb|AAS88839.1| putative methionine S-methyltransfera...    38   0.50
gi|13518377|ref|NP_084736.1| Ycf2 protein [Oenothera elata subsp...    38   0.50
gi|48866524|ref|ZP_00320351.1| COG0500: SAM-dependent methyltran...    38   0.50
gi|50419303|ref|XP_458176.1| unnamed protein product [Debaryomyc...    38   0.50
gi|37678845|ref|NP_933454.1| predicted O-methyltransferase [Vibr...    38   0.50
gi|38110441|gb|EAA56155.1| hypothetical protein MG01806.4 [Magna...    37   0.65
gi|21226832|ref|NP_632754.1| SAM-dependent methyltransferases [M...    37   0.65
gi|20823043|ref|XP_130148.1| similar to putative nuclear protein...    37   0.65
gi|15921717|ref|NP_377386.1| 164aa long conserved hypothetical p...    37   0.65
gi|49121568|ref|XP_412424.1| hypothetical protein AN8287.2 [Aspe...    37   0.65
gi|23478158|gb|EAA15320.1| hypothetical protein [Plasmodium yoel...    37   0.65
gi|23479854|gb|EAA16575.1| possible HNRNP arginine n-methyltrans...    37   0.65
gi|50551813|ref|XP_503381.1| hypothetical protein [Yarrowia lipo...    37   0.65
gi|45185015|ref|NP_982733.1| AAR190Wp [Eremothecium gossypii] >g...    37   0.65
gi|26251937|gb|AAH40797.1| Topoisomerase 1-binding RING finger [...    37   0.65
gi|50292141|ref|XP_448503.1| unnamed protein product [Candida gl...    37   0.65
gi|39591551|emb|CAE71127.1| Hypothetical protein CBG17981 [Caeno...    37   0.85
gi|7582274|gb|AAF64257.1| BM-001 [Homo sapiens]                        37   0.85
gi|50759500|ref|XP_417667.1| PREDICTED: similar to bone morphoge...    37   0.85
gi|8163632|gb|AAF73773.1| surface protein PspC [Streptococcus pn...    37   0.85
gi|34853049|ref|XP_342386.1| similar to hypothetical protein FLJ...    37   0.85
gi|27370731|gb|AAH37141.1| Topors protein [Mus musculus]               37   0.85
gi|479885|pir||S35569 sex-determining protein Sry - African wood...    37   0.85
gi|40644076|emb|CAE46407.1| bone morphogenetic protein-10 [Gallu...    37   0.85
gi|9945320|ref|NP_064703.1| cyclin L1; cyclin L ania-6a [Homo sa...    37   0.85
gi|45768720|gb|AAH67812.1| Cyclin L1 [Homo sapiens]                    37   0.85
gi|15919933|dbj|BAB69457.1| p53-binding protein-3 [Mus musculus]       37   0.85
gi|29336062|ref|NP_598858.2| topoisomerase 1-binding RING finger...    37   0.85
gi|37182448|gb|AAQ89026.1| CCNL1 [Homo sapiens]                        37   0.85
gi|46439737|gb|EAK99051.1| hypothetical protein CaO19.13145 [Can...    37   0.85
gi|16758476|ref|NP_446114.1| cyclin L1 [Rattus norvegicus] >gnl|...    37   0.85
gi|50303801|ref|XP_451847.1| unnamed protein product [Kluyveromy...    37   1.1
gi|16077174|ref|NP_387987.1| ybxB [Bacillus subtilis subsp. subt...    37   1.1
gi|48849943|ref|ZP_00304186.1| COG0500: SAM-dependent methyltran...    37   1.1
gi|15603023|ref|NP_246095.1| unknown [Pasteurella multocida Pm70...    37   1.1
gi|9910312|ref|NP_064321.1| cyclin L1; cyclin ania-6a [Mus muscu...    37   1.1
gi|15835722|ref|NP_300246.1| methylase [Chlamydophila pneumoniae...    37   1.1
gi|11281685|pir||B72108 conserved hypothetical protein CP0580 [i...    37   1.1
gi|18542383|gb|AAL75565.1| cyclin ania-6a [Mus musculus]               37   1.1
gi|15618111|ref|NP_224396.1| predicted methylase [Chlamydophila ...    37   1.1
gi|47226697|emb|CAG07856.1| unnamed protein product [Tetraodon n...    37   1.1
gi|6322648|ref|NP_012721.1| Putative positive regulator of manno...    37   1.1
gi|50307259|ref|XP_453608.1| unnamed protein product [Kluyveromy...    37   1.1
gi|786117|gb|AAA98076.1| nuclear protein                               37   1.1
gi|2980817|emb|CAA82046.1| MNN4 [Saccharomyces cerevisiae]             37   1.1
gi|48832060|ref|ZP_00289104.1| COG3437: Response regulator conta...    37   1.1
gi|16579865|gb|AAL26680.1| unknown [Staphylococcus aureus]             37   1.1
gi|46140515|ref|ZP_00203645.1| COG2890: Methylase of polypeptide...    37   1.1
gi|39589597|emb|CAE66832.1| Hypothetical protein CBG12202 [Caeno...    37   1.1
gi|29349137|ref|NP_812640.1| putative protoporphyrinogen oxidase...    36   1.4
gi|33518695|gb|AAQ20830.1| polylysine protein precursor [Rhodniu...    36   1.4
gi|48870033|ref|ZP_00322765.1| COG2813: 16S RNA G1207 methylase ...    36   1.4
gi|50312991|ref|XP_455895.1| unnamed protein product [Kluyveromy...    36   1.4
gi|21399750|ref|NP_655735.1| Ubie_methyltran, ubiE/COQ5 methyltr...    36   1.4
gi|49480550|ref|YP_036044.1| methyltransferase [Bacillus thuring...    36   1.4
gi|30261913|ref|NP_844290.1| hypothetical protein [Bacillus anth...    36   1.4
gi|30019939|ref|NP_831570.1| SAM-dependent methyltransferases [B...    36   1.4
gi|46107904|ref|XP_381011.1| hypothetical protein FG00835.1 [Gib...    36   1.4
gi|23478773|gb|EAA15769.1| ATPase, P-type, HAD superfamily, subf...    36   1.4
gi|20806671|ref|NP_621842.1| predicted rRNA or tRNA methylase [T...    36   1.4
gi|38104717|gb|EAA51246.1| hypothetical protein MG08768.4 [Magna...    36   1.4
gi|29840308|ref|NP_829414.1| methyltransferase, putative [Chlamy...    36   1.4
gi|28828540|gb|AAO51148.1| similar to Y55B1BR.3.p [Caenorhabditi...    36   1.4
gi|23508562|ref|NP_701231.1| hypothetical protein [Plasmodium fa...    36   1.4
gi|3282093|emb|CAA07516.1| hypothetical protein [Thermotoga neap...    36   1.4
gi|1771204|emb|CAA68045.1| methyltransferase [Lactococcus lactis]      36   1.4
gi|23469758|ref|ZP_00125092.1| COG0500: SAM-dependent methyltran...    36   1.4
gi|38605120|sp|O86951|PRMA_THENE Ribosomal protein L11 methyltra...    36   1.4
gi|8468621|gb|AAF75554.1| mature parasite-infected erythrocyte s...    36   1.9
gi|50287893|ref|XP_446376.1| unnamed protein product [Candida gl...    36   1.9
gi|50740353|ref|XP_429844.1| PREDICTED: hypothetical protein XP_...    36   1.9
gi|23613032|ref|NP_703354.1| Mature parasite-infected erythrocyt...    36   1.9
gi|23097566|ref|NP_691032.1| hypothetical protein OB0111 [Oceano...    36   1.9
gi|50752550|ref|XP_422826.1| PREDICTED: similar to cyclin L1; cy...    36   1.9
gi|42733510|dbj|BAD11352.1| BRI1-KD interacting protein 124 [Ory...    36   1.9
gi|1144491|gb|AAC48498.1| cardiac triadin isoform 3 >gnl|BL_ORD_...    36   1.9
gi|16272069|ref|NP_438269.1| hypothetical protein HI0095 [Haemop...    36   1.9
gi|22972827|ref|ZP_00019683.1| hypothetical protein [Chloroflexu...    36   1.9
gi|32405744|ref|XP_323485.1| hypothetical protein [Neurospora cr...    36   1.9
gi|23510067|ref|NP_702733.1| hypothetical protein [Plasmodium fa...    36   1.9
gi|17531187|ref|NP_496041.1| putative nuclear protein, with a co...    36   1.9
gi|27383093|ref|NP_774622.1| bll7982 [Bradyrhizobium japonicum U...    36   1.9
gi|34867140|ref|XP_342820.1| similar to p53-binding protein-3 [R...    36   1.9
gi|45916450|ref|ZP_00195361.2| COG0500: SAM-dependent methyltran...    36   1.9
gi|48892728|ref|ZP_00326061.1| COG0500: SAM-dependent methyltran...    36   1.9
gi|50401093|sp|Q8W519|MMT1_MAIZE Methionine S-methyltransferase ...    36   1.9
gi|23129131|ref|ZP_00110964.1| COG0500: SAM-dependent methyltran...    36   1.9
gi|46117866|ref|ZP_00174357.2| COG0500: SAM-dependent methyltran...    36   1.9
gi|8134743|sp|Q28820|TRDN_RABIT Triadin >gnl|BL_ORD_ID|1941517 g...    36   1.9
gi|323126|pir||A45605 mature-parasite-infected erythrocyte surfa...    36   1.9
gi|160409|gb|AAA29651.1| mature-parasite-infected erythrocyte su...    36   1.9
gi|49080724|ref|XP_403848.1| hypothetical protein UM06233.1 [Ust...    36   1.9
gi|47206643|emb|CAF91366.1| unnamed protein product [Tetraodon n...    36   1.9
gi|479883|pir||S35567 sex-determining protein Sry - shrew mouse ...    36   1.9
gi|46227943|gb|EAK88863.1| drosophila CG6013 like HMG domain con...    36   1.9
gi|46135462|ref|ZP_00162909.2| COG0500: SAM-dependent methyltran...    36   1.9
gi|50290295|ref|XP_447579.1| unnamed protein product [Candida gl...    36   1.9
gi|30721677|gb|AAP33688.1| phoshoprotein 300 [Plasmodium falcipa...    36   1.9
gi|23613154|ref|NP_703476.1| hypothetical protein [Plasmodium fa...    36   1.9
gi|26990482|ref|NP_745907.1| conserved hypothetical protein [Pse...    36   1.9
gi|50761024|ref|XP_418209.1| PREDICTED: similar to myeloid/lymph...    31   2.2
gi|17554100|ref|NP_499837.1| predicted CDS, major sperm protein ...    35   2.5
gi|15612687|ref|NP_240990.1| BH0124~unknown conserved protein [B...    35   2.5
gi|34763569|ref|ZP_00144504.1| METHYLTRANSFERASE [Fusobacterium ...    35   2.5
gi|49235408|ref|ZP_00329477.1| COG2226: Methylase involved in ub...    35   2.5
gi|28211651|ref|NP_782595.1| ribosomal protein L11 methyltransfe...    35   2.5
gi|27363996|ref|NP_759524.1| Predicted O-methyltransferase [Vibr...    35   2.5
gi|50553374|ref|XP_504098.1| hypothetical protein [Yarrowia lipo...    35   2.5
gi|50422621|ref|XP_459882.1| unnamed protein product [Debaryomyc...    35   2.5
gi|49235974|ref|ZP_00330037.1| COG2264: Ribosomal protein L11 me...    35   2.5
gi|48838297|ref|ZP_00295243.1| COG0500: SAM-dependent methyltran...    35   2.5
gi|19074574|ref|NP_586080.1| similarity to ribosomal protein L5 ...    35   2.5
gi|32415257|ref|XP_328108.1| hypothetical protein ( related to p...    35   2.5
gi|17562552|ref|NP_503823.1| predicted CDS, bll2645 like family ...    35   2.5
gi|45198846|ref|NP_985875.1| AFR328Cp [Eremothecium gossypii] >g...    35   2.5
gi|39587112|emb|CAE57579.1| Hypothetical protein CBG00558 [Caeno...    35   2.5
gi|46109630|ref|XP_381873.1| hypothetical protein FG01697.1 [Gib...    35   2.5
gi|3024638|sp|Q62565|SRY_MUSSI Sex-determining region Y protein ...    35   2.5
gi|12084699|pdb|1G6Q|1 Chain 1, Crystal Structure Of Yeast Argin...    35   2.5
gi|23487851|gb|EAA21161.1| putative peptidyl prolyl cis-trans is...    35   2.5
gi|50422103|ref|XP_459613.1| unnamed protein product [Debaryomyc...    35   2.5
gi|479882|pir||S35566 sex-determining protein Sry - western wild...    35   2.5
gi|39595358|emb|CAE60395.1| Hypothetical protein CBG03997 [Caeno...    35   2.5
gi|15896660|ref|NP_350009.1| S-adenosylmethionine-dependent meth...    35   2.5
gi|11346371|pir||T47235 sex determining protein [imported] - wes...    35   2.5
gi|37524269|ref|NP_927613.1| hypothetical protein [Photorhabdus ...    35   2.5
gi|3024637|sp|Q62563|SRY_MUSSP Sex-determining region Y protein ...    35   2.5
gi|50401177|sp|Q9MBC2|MMT1_HORVU Methionine S-methyltransferase ...    35   2.5
gi|16263976|ref|NP_436768.1| HYPOTHETICAL PROTEIN SMb20238 [Sino...    35   2.5
gi|39589800|emb|CAE67035.1| Hypothetical protein CBG12437 [Caeno...    35   3.2
gi|48895254|ref|ZP_00328238.1| COG0500: SAM-dependent methyltran...    35   3.2
gi|8163642|gb|AAF73778.1| surface protein PspC [Streptococcus pn...    35   3.2
gi|33239722|ref|NP_874664.1| Predicted SAM-dependent methyltrans...    35   3.2
gi|50553268|ref|XP_504044.1| hypothetical protein [Yarrowia lipo...    35   3.2
gi|33865682|ref|NP_897241.1| conserved hypothetical protein [Syn...    35   3.2
gi|21362996|sp|P82179|TRDN_CANFA Triadin >gnl|BL_ORD_ID|310205 g...    35   3.2
gi|46315993|ref|ZP_00216573.1| COG2264: Ribosomal protein L11 me...    35   3.2
gi|37523046|ref|NP_926423.1| hypothetical protein gll3477 [Gloeo...    35   3.2
gi|21399358|ref|NP_655343.1| Ubie_methyltran, ubiE/COQ5 methyltr...    35   3.2
gi|15673708|ref|NP_267882.1| hypothetical protein L165684 [Lacto...    35   3.2
gi|39581616|emb|CAE58401.1| Hypothetical protein CBG01530 [Caeno...    35   3.2
gi|28564139|gb|AAO32448.1| MNN4 [Saccharomyces bayanus]                35   3.2
gi|31195653|ref|XP_306774.1| ENSANGP00000000289 [Anopheles gambi...    35   3.2
gi|20089604|ref|NP_615679.1| conserved hypothetical protein [Met...    35   3.2
gi|50401195|sp|Q9SWR3|MMT1_WOLBI Methionine S-methyltransferase ...    35   3.2
gi|48855652|ref|ZP_00309810.1| COG2890: Methylase of polypeptide...    35   4.2
gi|49090466|ref|XP_406694.1| hypothetical protein AN2557.2 [Aspe...    35   4.2
gi|1160355|gb|AAB00542.1| UNC-89                                       35   4.2
gi|2623347|gb|AAC53431.1| sex determining protein [Mus musculus ...    35   4.2
gi|30316450|gb|AAF72518.3| LDC4 [Homo sapiens]                         35   4.2
gi|25141314|ref|NP_491290.2| UNCoordinated locomotion UNC-89, PH...    35   4.2
gi|15668459|ref|NP_247257.1| conserved hypothetical protein [Met...    35   4.2
gi|2623369|gb|AAC53442.1| sex determining protein [Mus musculus ...    35   4.2
gi|23612496|ref|NP_704057.1| sin3 associated polypeptide p18-lik...    35   4.2
gi|2623367|gb|AAC53441.1| sex determining protein [Mus musculus ...    35   4.2
gi|23491178|gb|EAA22776.1| Arabidopsis thaliana BRAHMA ortholog ...    35   4.2
gi|20135927|dbj|BAA92862.2| TRP-1 [Burkholderia glumae]                35   4.2
gi|2623379|gb|AAC53447.1| sex determining protein [Mus musculus ...    35   4.2
gi|460123|gb|AAB60446.1| Sry >gnl|BL_ORD_ID|1784943 gi|2623359|g...    35   4.2
gi|21539657|ref|NP_598745.1| RIKEN cDNA 2310008M14 [Mus musculus...    35   4.2
gi|38080839|ref|XP_358982.1| similar to endonuclease/reverse tra...    35   4.2
gi|2623363|gb|AAC53439.1| sex determining protein [Mus musculus ...    35   4.2
gi|15606087|ref|NP_213464.1| hypothetical protein aq_674 [Aquife...    35   4.2
gi|15218117|ref|NP_172981.1| tetratricopeptide repeat (TPR)-cont...    35   4.2
gi|31544466|ref|NP_853044.1| conserved hypothetical [Mycoplasma ...    35   4.2
gi|47225554|emb|CAG12037.1| unnamed protein product [Tetraodon n...    35   4.2
gi|23619526|ref|NP_705488.1| guanylyl cyclase [Plasmodium falcip...    35   4.2
gi|50591676|ref|ZP_00332980.1| COG2890: Methylase of polypeptide...    35   4.2
gi|39579835|emb|CAE56844.1| Hypothetical protein CBG24671 [Caeno...    35   4.2
gi|46229415|gb|EAK90233.1| membrane protein with multiple cystei...    35   4.2
gi|34535151|dbj|BAC87222.1| unnamed protein product [Homo sapiens]     35   4.2
gi|31792321|ref|NP_854814.1| PROBABLE PYRUVATE, PHOSPHATE DIKINA...    35   4.2
gi|7106892|gb|AAF36171.1| HSPC251 [Homo sapiens]                       35   4.2
gi|15608267|ref|NP_215643.1| ppdK [Mycobacterium tuberculosis H3...    35   4.2
gi|45506151|ref|ZP_00158511.1| COG1002: Type II restriction enzy...    35   4.2
gi|8163646|gb|AAF73780.1| surface protein PspC [Streptococcus pn...    35   4.2
gi|15840565|ref|NP_335602.1| pyruvate,phosphate dikinase, putati...    35   4.2
gi|8163678|gb|AAF73797.1| surface protein PspC [Streptococcus pn...    35   4.2
gi|2271479|gb|AAC53450.1| sex determining protein [Mus musculus ...    35   4.2
gi|47203898|emb|CAG14755.1| unnamed protein product [Tetraodon n...    35   4.2
gi|7511618|pir||T29757 protein UNC-89 - Caenorhabditis elegans         35   4.2
gi|25518034|pir||B86287 F9L1.23 protein - Arabidopsis thaliana >...    35   4.2
gi|21361576|ref|NP_057589.2| putative S1 RNA binding domain prot...    35   4.2
gi|27380543|ref|NP_772072.1| blr5432 [Bradyrhizobium japonicum U...    35   4.2
gi|48837374|ref|ZP_00294369.1| COG2813: 16S RNA G1207 methylase ...    35   4.2
gi|2623357|gb|AAC53436.1| sex determining protein [Mus musculus ...    35   4.2
gi|33875741|gb|AAH00685.1| PS1D protein [Homo sapiens]                 35   4.2
gi|463150|gb|AAA40142.1| sex determining protein                       35   4.2
gi|2623355|gb|AAC53435.1| sex determining protein [Mus musculus ...    35   4.2
gi|23613246|ref|NP_703568.1| hypothetical protein [Plasmodium fa...    35   4.2
gi|48836922|ref|ZP_00293917.1| COG0500: SAM-dependent methyltran...    35   4.2
gi|23125274|ref|ZP_00107214.1| COG0500: SAM-dependent methyltran...    35   4.2
gi|31746683|gb|AAP68958.1| Uncoordinated protein 89, isoform b [...    35   4.2
gi|9366858|emb|CAB95620.1| arginine N-methyltransferase, probabl...    35   4.2
gi|2623371|gb|AAC53443.1| sex determining protein [Mus musculus ...    35   4.2
gi|47225989|emb|CAG04363.1| unnamed protein product [Tetraodon n...    34   5.5
gi|7486979|pir||T10649 hypothetical protein T13K14.230 - Arabido...    34   5.5
gi|7486585|pir||T04938 hypothetical protein F7J7.10 - Arabidopsi...    34   5.5
gi|32699229|gb|AAB88314.2| Hypothetical protein C24D10.1 [Caenor...    34   5.5
gi|19704666|ref|NP_604228.1| Methyltransferase [Fusobacterium nu...    34   5.5
gi|7487898|pir||T01037 hypothetical protein YUP8H12R.20 - Arabid...    34   5.5
gi|46431084|gb|EAK90733.1| hypothetical protein CaO19.631 [Candi...    34   5.5
gi|23488356|gb|EAA21288.1| KED, putative [Plasmodium yoelii yoelii]    34   5.5
gi|48131561|ref|XP_393324.1| similar to ENSANGP00000012301 [Apis...    34   5.5
gi|50292733|ref|XP_448799.1| unnamed protein product [Candida gl...    34   5.5
gi|38106564|gb|EAA52855.1| hypothetical protein MG05983.4 [Magna...    34   5.5
gi|21554636|gb|AAM63641.1| unknown [Arabidopsis thaliana]              34   5.5
gi|18412298|ref|NP_565201.1| expressed protein [Arabidopsis thal...    34   5.5
gi|19698963|gb|AAL91217.1| unknown protein [Arabidopsis thaliana...    34   5.5
gi|15644412|ref|NP_229464.1| conserved hypothetical protein [The...    34   5.5
gi|30685297|ref|NP_193839.3| BRCT domain-containing protein / zi...    34   5.5
gi|23478415|gb|EAA15508.1| CCAAT-box DNA binding protein subunit...    34   5.5
gi|48057660|gb|AAT39959.1| hypothetical protein [Solanum demissu...    34   5.5
gi|15897476|ref|NP_342081.1| Ribosomal protein L11 methyltransfe...    34   5.5
gi|23490496|gb|EAA22259.1| hypothetical protein [Plasmodium yoel...    34   5.5
gi|15237618|ref|NP_201220.1| methylase family protein [Arabidops...    34   5.5
gi|48733293|ref|ZP_00267036.1| COG0500: SAM-dependent methyltran...    34   5.5
gi|23509309|ref|NP_701976.1| hypothetical protein [Plasmodium fa...    34   5.5
gi|23509171|ref|NP_701839.1| dimethyladenosine transferase, puta...    34   5.5
gi|37531718|ref|NP_920161.1| unknown protein [Oryza sativa (japo...    34   5.5
gi|38106000|gb|EAA52361.1| hypothetical protein MG05053.4 [Magna...    34   5.5
gi|15229884|ref|NP_187157.1| SAR DNA-binding protein, putative [...    34   5.5
gi|47230109|emb|CAG10523.1| unnamed protein product [Tetraodon n...    34   5.5
gi|30019592|ref|NP_831223.1| SAM-dependent methyltransferase [Ba...    34   5.5
gi|49076228|ref|XP_402114.1| hypothetical protein UM04499.1 [Ust...    34   5.5
gi|16804997|ref|NP_473026.1| hypothetical protein [Plasmodium fa...    34   5.5
gi|39584941|emb|CAE64365.1| Hypothetical protein CBG09052 [Caeno...    34   5.5
gi|17538734|ref|NP_500733.1| tyrosine specific protein phosphata...    34   5.5
gi|15240558|ref|NP_199792.1| methionine S-methyltransferase [Ara...    34   5.5
gi|20807438|ref|NP_622609.1| Ribosomal protein L11 methylase [Th...    34   5.5
gi|25369776|pir||T52306 methionine S-methyltransferase (EC 2.1.1...    34   5.5
gi|21227980|ref|NP_633902.1| methyltransferase [Methanosarcina m...    34   5.5
gi|50119218|ref|YP_048385.1| ribosomal protein L11 methyltransfe...    34   5.5
gi|3044185|gb|AAC13303.1| mature parasite-infected erythrocyte s...    34   5.5
gi|6118368|gb|AAF04099.1| polymorphic antigen [Plasmodium falcip...    34   7.2
gi|558071|gb|AAC47831.1| polymorphic antigen [Plasmodium falcipa...    34   7.2
gi|15900857|ref|NP_345461.1| O-methyltransferase [Streptococcus ...    34   7.2
gi|6321719|ref|NP_011796.1| Protein with a role in maturation of...    34   7.2
gi|29833105|ref|NP_827739.1| hypothetical protein SAV6563 [Strep...    34   7.2
gi|23127625|ref|ZP_00109490.1| COG0500: SAM-dependent methyltran...    34   7.2
gi|46914918|emb|CAG21693.1| putative ribosomal protein L11 methy...    34   7.2
gi|20380361|gb|AAH27547.1| 2810410A08Rik protein [Mus musculus]        34   7.2
gi|23484285|gb|EAA19671.1| Ran-binding protein [Plasmodium yoeli...    34   7.2
gi|23508148|ref|NP_700818.1| merozoite surface protein 3 [Plasmo...    34   7.2
gi|50257590|gb|EAL20295.1| hypothetical protein CNBF1070 [Crypto...    34   7.2
gi|20071722|gb|AAH26368.1| Ncoa6ip protein [Mus musculus]              34   7.2
gi|16330344|ref|NP_441072.1| hypothetical protein [Synechocystis...    34   7.2
gi|37526574|ref|NP_929918.1| ProP effector [Photorhabdus lumines...    34   7.2
gi|24373982|ref|NP_718025.1| methyltransferase, putative [Shewan...    34   7.2
gi|50233914|ref|NP_473430.2| nuclear receptor coactivator 6 inte...    34   7.2
gi|15127914|gb|AAK84355.1| PIMT [Mus musculus]                         34   7.2
gi|20090652|ref|NP_616727.1| conserved hypothetical protein [Met...    34   7.2
gi|15642177|ref|NP_231809.1| hemK protein [Vibrio cholerae O1 bi...    34   7.2
gi|17027112|gb|AAL34086.1| merozoite surface protein 3 [syntheti...    34   7.2
gi|38103954|gb|EAA50587.1| hypothetical protein MG04346.4 [Magna...    34   7.2
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w...    34   7.2
gi|15806532|ref|NP_295244.1| ribosomal protein L11 methyltransfe...    34   7.2
gi|38074805|ref|XP_130324.2| RIKEN cDNA 2810410A08 [Mus musculus]      34   7.2
gi|38111644|gb|EAA57192.1| hypothetical protein MG08161.4 [Magna...    34   7.2
gi|15375031|gb|AAK94780.1| merozoite surface protein 3 precursor...    34   7.2
gi|46226717|gb|EAK87696.1| large low complexity coiled coil prot...    34   7.2
gi|28828913|gb|AAO51499.1| similar to Y87G2A.4.p [Caenorhabditis...    34   7.2
gi|48846335|ref|ZP_00300599.1| COG2264: Ribosomal protein L11 me...    34   7.2
gi|47939273|gb|AAH71252.1| Unknown (protein for MGC:78286) [Mus ...    34   7.2
gi|507791|gb|AAC09378.1| polymorphic antigen [Plasmodium falcipa...    34   7.2
gi|17506567|ref|NP_492293.1| putative nuclear protein (1J16) [Ca...    34   7.2
gi|38104190|gb|EAA50798.1| hypothetical protein MG04557.4 [Magna...    34   7.2
gi|20130239|ref|NP_611665.1| CG10955-PA [Drosophila melanogaster...    34   7.2
gi|23473844|ref|ZP_00129139.1| COG3897: Predicted methyltransfer...    33   9.4
gi|13384904|ref|NP_079761.1| ribosomal protein, mitochondrial, S...    33   9.4
gi|23508707|ref|NP_701375.1| hypothetical protein [Plasmodium fa...    33   9.4
gi|44829555|ref|NP_013996.2| protein possibly involved in protei...    33   9.4
gi|39581087|emb|CAE73165.1| Hypothetical protein CBG20561 [Caeno...    33   9.4
gi|46227524|gb|EAK88459.1| hypothetical protein cgd1_1260 [Crypt...    33   9.4
gi|20092711|ref|NP_618786.1| ubiE/COQ5 methyltransferase [Methan...    33   9.4
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr...    33   9.4
gi|37361880|gb|AAQ91053.1| LRRGT00097 [Rattus norvegicus]              33   9.4
gi|14521102|ref|NP_126577.1| menaquinone biosynthesis methlytran...    33   9.4
gi|41152134|ref|NP_957062.1| hypothetical protein MGC73268 [Dani...    33   9.4
gi|17540204|ref|NP_500767.1| MSP-domain protein like family memb...    33   9.4
gi|121952|sp|P02256|H1_PARAN Histone H1, gonadal >gnl|BL_ORD_ID|...    33   9.4
gi|38102653|gb|EAA49468.1| hypothetical protein MG01126.4 [Magna...    33   9.4
gi|17539850|ref|NP_500539.1| absent small homeotic discs 1 like ...    33   9.4
gi|34859138|ref|XP_219296.2| similar to proliferation potential-...    33   9.4
gi|46119490|ref|ZP_00176692.2| COG0500: SAM-dependent methyltran...    33   9.4
gi|23098706|ref|NP_692172.1| hypothetical protein OB1251 [Oceano...    33   9.4
gi|15225073|ref|NP_181464.1| OTU-like cysteine protease family p...    33   9.4
gi|6320594|ref|NP_010674.1| Mms and UV Sensitive; Mus81p and Rad...    33   9.4
gi|7656928|ref|NP_055297.1| bone morphogenetic protein 10 prepro...    33   9.4
gi|34497626|ref|NP_901841.1| probable adenine-specific methylase...    33   9.4
gi|46575670|gb|AAH69080.1| Bone morphogenetic protein 10, prepro...    33   9.4
gi|6469845|gb|AAF13455.1| unknown [Streptococcus pneumoniae]           33   9.4
gi|17228267|ref|NP_484815.1| hypothetical protein [Nostoc sp. PC...    33   9.4
gi|2497215|sp|Q03525|YM8H_YEAST Hypothetical 16.2 kDa protein in...    33   9.4
gi|42567476|ref|NP_195415.3| expressed protein [Arabidopsis thal...    33   9.4
gi|23612987|ref|NP_704526.1| hypothetical protein [Plasmodium fa...    33   9.4
gi|32399111|emb|CAD98351.1| hypothetical predicted protein, unkn...    33   9.4
gi|17231019|ref|NP_487567.1| similar to ubiquinone/menaquinone b...    33   9.4
gi|46138407|ref|XP_390894.1| hypothetical protein FG10718.1 [Gib...    33   9.4
gi|23117855|ref|ZP_00101690.1| COG0500: SAM-dependent methyltran...    33   9.4
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru...    33   9.4
gi|23593325|ref|NP_703171.1| hypothetical protein [Plasmodium fa...    33   9.4
gi|23509641|ref|NP_702308.1| hypothetical protein [Plasmodium fa...    33   9.4
gi|29653699|ref|NP_819391.1| 3-demethylubiquinone-9 3-methyltran...    33   9.4
gi|37521990|ref|NP_925367.1| hypothetical protein gll2421 [Gloeo...    33   9.4
gi|15669118|ref|NP_247923.1| protoporphyrinogen oxidase (hemK) [...    33   9.4
gi|39586313|emb|CAE66724.1| Hypothetical protein CBG12070 [Caeno...    33   9.4
gi|141450|sp|P20187|YT37_STRFR Hypothetical 37.1 kDa protein in ...    33   9.4
gi|50556082|ref|XP_505449.1| hypothetical protein [Yarrowia lipo...    33   9.4


>gi|17536953|ref|NP_496573.1| related to bicoid interacting protein
            (2M394) [Caenorhabditis elegans]
 gi|7509432|pir||T26511 hypothetical protein Y17G7B.18a -
            Caenorhabditis elegans
 gi|3947613|emb|CAA19465.1| Hypothetical protein Y17G7B.18a
            [Caenorhabditis elegans]
          Length = 378

 Score =  744 bits (1921), Expect = 0.0
 Identities = 365/378 (96%), Positives = 365/378 (96%)
 Frame = -1

Query: 1137 MSSHRRGSFRGRKRFYRDTFAPGGSKTDPXXXXXXXXXXXXXEKKRLGLLDPTTERSKKR 958
            MSSHRRGSFRGRKRFYRDTFAPGGSKTDP             EKKRLGLLDPTTERSKKR
Sbjct: 1    MSSHRRGSFRGRKRFYRDTFAPGGSKTDPLNIEIELTENPEEEKKRLGLLDPTTERSKKR 60

Query: 957  KVEKDEKSEKPAENSPFKKNQYNSPRKDSRRPPQLSKEEKSAAENRKQKTEYFNKKYRYG 778
            KVEKDEKSEKPAENSPFKKNQYNSPRKDSRRPPQLSKEEKSAAENRKQKTEYFNKKYRYG
Sbjct: 61   KVEKDEKSEKPAENSPFKKNQYNSPRKDSRRPPQLSKEEKSAAENRKQKTEYFNKKYRYG 120

Query: 777  NFDRYYGIRLNPGESDKRLSVFQKDWFEHKQALDIGCNAGFLTLSIAKDFSPRRIIGIDI 598
            NFDRYYGIRLNPGESDKRLSVFQKDWFEHKQALDIGCNAGFLTLSIAKDFSPRRIIGIDI
Sbjct: 121  NFDRYYGIRLNPGESDKRLSVFQKDWFEHKQALDIGCNAGFLTLSIAKDFSPRRIIGIDI 180

Query: 597  DEHLIGVARKNIRHYCDHETEVSGKFPASFGVQFGTVSQRNEAPRSFSTKFPDNIWFKKE 418
            DEHLIGVARKNIRHYCDHETEVSGKFPASFGVQFGTVSQRNEAPRSFSTKFPDNIWFKKE
Sbjct: 181  DEHLIGVARKNIRHYCDHETEVSGKFPASFGVQFGTVSQRNEAPRSFSTKFPDNIWFKKE 240

Query: 417  NYVLESDEMLDMIQPEFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLIIEPQ 238
            NYVLESDEMLDMIQPEFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLIIEPQ
Sbjct: 241  NYVLESDEMLDMIQPEFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLIIEPQ 300

Query: 237  AFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIETVGFESVEKLGVVGAKSKGFERPID 58
            AFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIETVGFESVEKLGVVGAKSKGFERPID
Sbjct: 301  AFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIETVGFESVEKLGVVGAKSKGFERPID 360

Query: 57   VYLKPLHPKTDAIPLGYI 4
            VYLKPLHPKTDAIPLGYI
Sbjct: 361  VYLKPLHPKTDAIPLGYI 378


>gi|17536951|ref|NP_496572.1| related to bicoid interacting protein
            (2M394) [Caenorhabditis elegans]
 gi|7509433|pir||T26512 hypothetical protein Y17G7B.18b -
            Caenorhabditis elegans
 gi|3947614|emb|CAA19466.1| Hypothetical protein Y17G7B.18b
            [Caenorhabditis elegans]
          Length = 381

 Score =  739 bits (1907), Expect = 0.0
 Identities = 365/381 (95%), Positives = 365/381 (95%), Gaps = 3/381 (0%)
 Frame = -1

Query: 1137 MSSHRRGSFRGRKRFYRDTFAPGGSKTDPXXXXXXXXXXXXXEKKRLGLLDPTTERSKKR 958
            MSSHRRGSFRGRKRFYRDTFAPGGSKTDP             EKKRLGLLDPTTERSKKR
Sbjct: 1    MSSHRRGSFRGRKRFYRDTFAPGGSKTDPLNIEIELTENPEEEKKRLGLLDPTTERSKKR 60

Query: 957  KVEKDEKSEKPAENSPFKK---NQYNSPRKDSRRPPQLSKEEKSAAENRKQKTEYFNKKY 787
            KVEKDEKSEKPAENSPFKK   NQYNSPRKDSRRPPQLSKEEKSAAENRKQKTEYFNKKY
Sbjct: 61   KVEKDEKSEKPAENSPFKKLQKNQYNSPRKDSRRPPQLSKEEKSAAENRKQKTEYFNKKY 120

Query: 786  RYGNFDRYYGIRLNPGESDKRLSVFQKDWFEHKQALDIGCNAGFLTLSIAKDFSPRRIIG 607
            RYGNFDRYYGIRLNPGESDKRLSVFQKDWFEHKQALDIGCNAGFLTLSIAKDFSPRRIIG
Sbjct: 121  RYGNFDRYYGIRLNPGESDKRLSVFQKDWFEHKQALDIGCNAGFLTLSIAKDFSPRRIIG 180

Query: 606  IDIDEHLIGVARKNIRHYCDHETEVSGKFPASFGVQFGTVSQRNEAPRSFSTKFPDNIWF 427
            IDIDEHLIGVARKNIRHYCDHETEVSGKFPASFGVQFGTVSQRNEAPRSFSTKFPDNIWF
Sbjct: 181  IDIDEHLIGVARKNIRHYCDHETEVSGKFPASFGVQFGTVSQRNEAPRSFSTKFPDNIWF 240

Query: 426  KKENYVLESDEMLDMIQPEFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLII 247
            KKENYVLESDEMLDMIQPEFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLII
Sbjct: 241  KKENYVLESDEMLDMIQPEFDVILALSITKWIHLNWGDDGMRRFFRRAYAQLHPGGRLII 300

Query: 246  EPQAFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIETVGFESVEKLGVVGAKSKGFER 67
            EPQAFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIETVGFESVEKLGVVGAKSKGFER
Sbjct: 301  EPQAFDSYKKRAKMSEELKANYSKIEFKPEDFEMWLIETVGFESVEKLGVVGAKSKGFER 360

Query: 66   PIDVYLKPLHPKTDAIPLGYI 4
            PIDVYLKPLHPKTDAIPLGYI
Sbjct: 361  PIDVYLKPLHPKTDAIPLGYI 381




[DB home][top]