Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= Y119D3B_12
(795 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17556731|ref|NP_497355.1| cyclin-like F-box and Protein of un... 523 e-147
gi|17556727|ref|NP_497359.1| predicted CDS, putative protein fam... 185 1e-45
gi|17556769|ref|NP_497366.1| predicted CDS, cyclin-like F-box an... 117 4e-25
gi|17556775|ref|NP_497363.1| predicted CDS, cyclin-like F-box an... 115 8e-25
gi|17556767|ref|NP_497365.1| predicted CDS, cyclin-like F-box an... 113 4e-24
gi|17555602|ref|NP_497448.1| cyclin-like F-box and Protein of un... 109 6e-23
gi|17556590|ref|NP_497383.1| predicted CDS, cyclin-like F-box an... 109 6e-23
gi|17556773|ref|NP_497364.1| cyclin-like F-box and Protein of un... 107 3e-22
gi|17556771|ref|NP_497367.1| predicted CDS, cyclin-like F-box an... 106 5e-22
gi|17556787|ref|NP_497370.1| cyclin-like F-box and Protein of un... 104 2e-21
gi|32565209|ref|NP_497381.2| cyclin-like F-box and Protein of un... 104 2e-21
gi|17556588|ref|NP_497384.1| cyclin-like F-box and Protein of un... 102 1e-20
gi|17556721|ref|NP_497373.1| predicted CDS, cyclin-like F-box an... 102 1e-20
gi|17556719|ref|NP_497375.1| predicted CDS, cyclin-like F-box an... 100 5e-20
gi|17555024|ref|NP_497305.1| cyclin-like F-box and Protein of un... 99 8e-20
gi|17555040|ref|NP_497302.1| cyclin-like F-box and Protein of un... 99 8e-20
gi|17559414|ref|NP_507270.1| predicted CDS, cyclin-like F-box an... 99 8e-20
gi|17556779|ref|NP_497368.1| predicted CDS, cyclin-like F-box an... 98 2e-19
gi|25148588|ref|NP_494270.2| cyclin-like F-box and Protein of un... 98 2e-19
gi|7503264|pir||T32285 hypothetical protein F42G2.4 - Caenorhabd... 98 2e-19
gi|32564782|ref|NP_872001.1| cyclin-like F-box and Protein of un... 98 2e-19
gi|17556600|ref|NP_497380.1| predicted CDS, cyclin-like F-box an... 97 3e-19
gi|17556586|ref|NP_497385.1| cyclin-like F-box and Protein of un... 97 4e-19
gi|17555038|ref|NP_497300.1| cyclin-like F-box and Protein of un... 97 4e-19
gi|17542926|ref|NP_500678.1| predicted CDS, cyclin-like F-box an... 94 3e-18
gi|17552580|ref|NP_497517.1| cyclin-like F-box and Protein of un... 94 4e-18
gi|17556733|ref|NP_497354.1| predicted CDS, cyclin-like F-box an... 94 4e-18
gi|7507718|pir||T33684 hypothetical protein T12B5.12 - Caenorhab... 93 6e-18
gi|30145758|emb|CAD89750.1| Hypothetical protein T25E12.12 [Caen... 93 7e-18
gi|17552570|ref|NP_497515.1| cyclin-like F-box and Protein of un... 92 1e-17
gi|17555022|ref|NP_497307.1| cyclin-like F-box and Protein of un... 92 1e-17
gi|17556202|ref|NP_497534.1| predicted CDS, cyclin-like F-box an... 92 2e-17
gi|17570013|ref|NP_510419.1| cyclin-like F-box and Protein of un... 91 3e-17
gi|17558050|ref|NP_503929.1| cyclin-like F-box and Protein of un... 90 6e-17
gi|17559410|ref|NP_507267.1| cyclin-like F-box and Protein of un... 89 1e-16
gi|17564298|ref|NP_507106.1| cyclin-like F-box and Protein of un... 88 2e-16
gi|32565204|ref|NP_497530.2| cyclin-like F-box and Protein of un... 88 2e-16
gi|17567983|ref|NP_508358.1| predicted CDS, cyclin-like F-box an... 87 3e-16
gi|17552578|ref|NP_497512.1| predicted CDS, cyclin-like F-box an... 87 4e-16
gi|32565399|ref|NP_497446.2| cyclin-like F-box and Protein of un... 87 4e-16
gi|29570408|gb|AAO91685.1| Hypothetical protein Y22D7AR.9 [Caeno... 87 4e-16
gi|17566472|ref|NP_507898.1| cyclin-like F-box and Protein of un... 86 7e-16
gi|17551458|ref|NP_508314.1| cyclin-like F-box and Protein of un... 86 9e-16
gi|32567140|ref|NP_503905.2| predicted CDS, cyclin-like F-box an... 86 1e-15
gi|17555028|ref|NP_497303.1| cyclin-like F-box and Protein of un... 86 1e-15
gi|17566384|ref|NP_507285.1| predicted CDS, cyclin-like F-box an... 86 1e-15
gi|7508625|pir||T28991 hypothetical protein T28A11.21 - Caenorha... 86 1e-15
gi|17536139|ref|NP_494084.1| predicted CDS, cyclin-like F-box an... 85 2e-15
gi|17555026|ref|NP_497304.1| cyclin-like F-box and Protein of un... 84 3e-15
gi|17552576|ref|NP_497513.1| cyclin-like F-box and Protein of un... 84 3e-15
gi|17566374|ref|NP_507280.1| cyclin-like F-box and Protein of un... 83 8e-15
gi|17556204|ref|NP_497535.1| predicted CDS, cyclin-like F-box an... 82 2e-14
gi|32566510|ref|NP_508355.2| predicted CDS, cyclin-like F-box an... 82 2e-14
gi|17556594|ref|NP_497378.1| predicted CDS, cyclin-like F-box an... 81 3e-14
gi|17556598|ref|NP_497382.1| predicted CDS, cyclin-like F-box an... 81 3e-14
gi|17556781|ref|NP_497369.1| cyclin-like F-box and Protein of un... 80 4e-14
gi|17561360|ref|NP_506948.1| cyclin-like F-box and Protein of un... 80 4e-14
gi|34555909|emb|CAB07340.2| Hypothetical protein F10A3.2 [Caenor... 80 5e-14
gi|32565381|ref|NP_497299.2| cyclin-like F-box and Protein of un... 78 2e-13
gi|17556192|ref|NP_497531.1| predicted CDS, cyclin-like F-box an... 78 2e-13
gi|7507726|pir||T33677 hypothetical protein T12B5.8 - Caenorhabd... 78 2e-13
gi|17550772|ref|NP_510807.1| cyclin-like F-box and Protein of un... 78 2e-13
gi|17555032|ref|NP_497296.1| transposase family member (3B552) [... 78 2e-13
gi|17555200|ref|NP_497526.1| putative protein family member (3D3... 77 3e-13
gi|17561154|ref|NP_507392.1| cyclin-like F-box and Protein of un... 76 7e-13
gi|17556578|ref|NP_497390.1| predicted CDS, cyclin-like F-box an... 75 1e-12
gi|7504166|pir||T33613 hypothetical protein F54D10.2 - Caenorhab... 75 1e-12
gi|32564758|ref|NP_494660.2| putative cytoplasmic protein family... 75 1e-12
gi|17552410|ref|NP_497143.1| predicted CDS, cyclin-like F-box an... 75 2e-12
gi|17559464|ref|NP_507065.1| predicted CDS, cyclin-like F-box an... 74 3e-12
gi|7510795|pir||T27599 hypothetical protein ZC47.9 - Caenorhabdi... 74 3e-12
gi|17556717|ref|NP_497376.1| predicted CDS, cyclin-like F-box an... 74 4e-12
gi|17567995|ref|NP_508366.1| cyclin-like F-box and Protein of un... 74 4e-12
gi|17566392|ref|NP_507290.1| cyclin-like F-box and Protein of un... 74 4e-12
gi|17566080|ref|NP_507530.1| cyclin-like F-box and Protein of un... 74 5e-12
gi|17542918|ref|NP_500676.1| u6 small nuclear RNA (4F695) [Caeno... 74 5e-12
gi|17556785|ref|NP_497371.1| predicted CDS, cyclin-like F-box an... 74 5e-12
gi|17558196|ref|NP_506704.1| predicted CDS, cyclin-like F-box an... 73 6e-12
gi|17552766|ref|NP_497124.1| cyclin-like F-box and Protein of un... 72 1e-11
gi|7510786|pir||T27590 hypothetical protein ZC47.13 - Caenorhabd... 72 2e-11
gi|17556783|ref|NP_497372.1| predicted CDS, cyclin-like F-box an... 71 2e-11
gi|17555584|ref|NP_497449.1| predicted CDS, protein of unknown f... 71 2e-11
gi|17561150|ref|NP_507390.1| cyclin-like F-box and Protein of un... 70 7e-11
gi|17551460|ref|NP_508315.1| putative protein family member (XC3... 70 7e-11
gi|7510785|pir||T27601 hypothetical protein ZC47.12 - Caenorhabd... 69 9e-11
gi|17565400|ref|NP_507536.1| cyclin-like F-box and Protein of un... 69 1e-10
gi|32566983|ref|NP_507232.2| protein of unknown function DUF38 a... 69 1e-10
gi|7508443|pir||T25281 hypothetical protein T25E12.11 - Caenorha... 69 1e-10
gi|32565389|ref|NP_497353.2| predicted CDS, cyclin-like F-box an... 69 1e-10
gi|17564010|ref|NP_506827.1| cyclin-like F-box and Protein of un... 68 3e-10
gi|17561146|ref|NP_507388.1| cyclin-like F-box and Protein of un... 67 3e-10
gi|17556602|ref|NP_497387.1| predicted CDS, protein of unknown f... 67 4e-10
gi|17555928|ref|NP_499435.1| putative cytoplasmic protein family... 67 4e-10
gi|7507552|pir||T24767 hypothetical protein T09F5.11 - Caenorhab... 67 6e-10
gi|17560982|ref|NP_507061.1| protein of unknown function DUF38 a... 67 6e-10
gi|17564170|ref|NP_506746.1| cyclin-like F-box and Protein of un... 67 6e-10
gi|17556737|ref|NP_497352.1| predicted CDS, cyclin-like F-box an... 67 6e-10
gi|17561690|ref|NP_507468.1| cyclin-like F-box and Protein of un... 66 7e-10
gi|17566466|ref|NP_507893.1| cyclin-like F-box and Protein of un... 65 1e-09
gi|17561582|ref|NP_507460.1| cyclin-like F-box and Protein of un... 65 2e-09
gi|49035158|gb|AAT48621.1| Hypothetical protein F42G2.4b [Caenor... 64 3e-09
gi|49035157|gb|AAT48620.1| Hypothetical protein F42G2.4a [Caenor... 64 3e-09
gi|32565379|ref|NP_497298.2| predicted CDS, putative cytoplasmic... 64 4e-09
gi|7507723|pir||T33676 hypothetical protein T12B5.5 - Caenorhabd... 64 4e-09
gi|17556518|ref|NP_499593.1| predicted CDS, cyclin-like F-box an... 64 4e-09
gi|17556755|ref|NP_497358.1| cyclin-like F-box and Protein of un... 64 5e-09
gi|17532193|ref|NP_496869.1| cyclin-like F-box and Protein of un... 64 5e-09
gi|47606781|sp|Q09336|YOF9_CAEEL Hypothetical protein ZK1290.9 i... 64 5e-09
gi|17552568|ref|NP_497516.1| predicted CDS, cyclin-like F-box an... 63 6e-09
gi|17560420|ref|NP_503290.1| predicted CDS, putative cytoplasmic... 63 6e-09
gi|17561148|ref|NP_507389.1| cyclin-like F-box and Protein of un... 62 1e-08
gi|17555204|ref|NP_497524.1| predicted CDS, cyclin-like F-box an... 62 1e-08
gi|32697987|emb|CAE11303.1| Hypothetical protein F28F8.8 [Caenor... 62 2e-08
gi|17565402|ref|NP_507537.1| cyclin-like F-box and Protein of un... 61 3e-08
gi|17565404|ref|NP_507538.1| predicted CDS, cyclin-like F-box an... 60 4e-08
gi|17566468|ref|NP_507895.1| cyclin-like F-box and Protein of un... 60 4e-08
gi|17566474|ref|NP_507897.1| cyclin-like F-box and Protein of un... 60 4e-08
gi|17566470|ref|NP_507896.1| feminization Of Germline FOG-2, cyc... 60 5e-08
gi|17560668|ref|NP_507008.1| cyclin-like F-box and Protein of un... 60 7e-08
gi|17556715|ref|NP_497377.1| predicted CDS, cyclin-like F-box an... 59 1e-07
gi|17556584|ref|NP_497386.1| cyclin-like F-box and Protein of un... 59 2e-07
gi|17543930|ref|NP_502739.1| cyclin-like F-box and Protein of un... 58 2e-07
gi|17558538|ref|NP_507448.1| predicted CDS, cyclin-like F-box an... 57 3e-07
gi|17558540|ref|NP_507447.1| cyclin-like F-box and Protein of un... 57 3e-07
gi|17556753|ref|NP_497356.1| predicted CDS, cyclin-like F-box an... 57 3e-07
gi|17556757|ref|NP_497360.1| predicted CDS, cyclin-like F-box an... 57 3e-07
gi|7510788|pir||T27598 hypothetical protein ZC47.2 - Caenorhabdi... 57 3e-07
gi|17510235|ref|NP_493038.1| cyclin-like F-box and Protein of un... 57 5e-07
gi|7510784|pir||T27600 hypothetical protein ZC47.10 - Caenorhabd... 56 1e-06
gi|32698040|emb|CAA21741.2| Hypothetical protein Y47H9C.10 [Caen... 55 1e-06
gi|17566382|ref|NP_507284.1| predicted CDS, putative cytoplasmic... 55 2e-06
gi|17566376|ref|NP_507281.1| cyclin-like F-box and Protein of un... 55 2e-06
gi|17557506|ref|NP_504892.1| cyclin-like F-box and Protein of un... 55 2e-06
gi|17557722|ref|NP_507510.1| predicted CDS, cyclin-like F-box an... 54 4e-06
gi|17565954|ref|NP_507584.1| cyclin-like F-box and Protein of un... 54 4e-06
gi|17565420|ref|NP_507573.1| cyclin-like F-box and Protein of un... 54 5e-06
gi|17510245|ref|NP_493040.1| cyclin-like F-box and Protein of un... 54 5e-06
gi|17543932|ref|NP_502738.1| predicted CDS, putative cytoplasmic... 54 5e-06
gi|17562698|ref|NP_507832.1| predicted CDS, cyclin-like F-box an... 54 5e-06
gi|17510243|ref|NP_493039.1| cyclin-like F-box and Protein of un... 53 7e-06
gi|7510151|pir||T27120 hypothetical protein Y53C10A.8 - Caenorha... 53 7e-06
gi|17558544|ref|NP_507445.1| predicted CDS, cyclin-like F-box an... 52 1e-05
gi|17566368|ref|NP_507277.1| cyclin-like F-box and Protein of un... 52 1e-05
gi|17531633|ref|NP_494010.1| cyclin-like F-box and Protein of un... 52 1e-05
gi|17558528|ref|NP_507449.1| predicted CDS, cyclin-like F-box an... 51 2e-05
gi|17565394|ref|NP_506838.1| cyclin-like F-box and Protein of un... 51 2e-05
gi|17564868|ref|NP_504615.1| predicted CDS, cyclin-like F-box an... 50 6e-05
gi|17531635|ref|NP_494012.1| cyclin-like F-box and Protein of un... 50 6e-05
gi|17555198|ref|NP_497527.1| putative cytoplasmic protein family... 49 1e-04
gi|17557368|ref|NP_506876.1| putative cytoskeletal protein famil... 48 3e-04
gi|17566462|ref|NP_507892.1| cyclin-like F-box and Protein of un... 47 4e-04
gi|17555196|ref|NP_497523.1| predicted CDS, putative mitochondri... 47 4e-04
gi|38176015|gb|AAC68786.2| Hypothetical protein F54D10.6 [Caenor... 47 6e-04
gi|17555044|ref|NP_497301.1| predicted CDS, putative cytoplasmic... 47 6e-04
gi|17556194|ref|NP_497529.1| predicted CDS, cyclin-like F-box an... 47 6e-04
gi|17538572|ref|NP_502631.1| cyclin-like F-box and Protein of un... 47 6e-04
gi|14530343|emb|CAB07161.2| Hypothetical protein C06H5.1 [Caenor... 46 8e-04
gi|7495580|pir||T19028 hypothetical protein C06H5.1 - Caenorhabd... 46 8e-04
gi|17560388|ref|NP_507384.1| cyclin-like F-box and Protein of un... 46 8e-04
gi|17510067|ref|NP_493019.1| putative protein family member (1M4... 46 8e-04
gi|45430252|gb|AAC68937.2| Hypothetical protein T12B5.13 [Caenor... 46 8e-04
gi|17543752|ref|NP_502778.1| predicted CDS, protein of unknown f... 45 0.002
gi|17557360|ref|NP_506881.1| cyclin-like F-box and Protein of un... 44 0.003
gi|17531631|ref|NP_494009.1| cyclin-like F-box and Protein of un... 44 0.004
gi|32699249|gb|AAB70963.2| Hypothetical protein C08E3.5 [Caenorh... 44 0.004
gi|39579997|emb|CAE56313.1| Hypothetical protein CBG23976 [Caeno... 43 0.007
gi|17505364|ref|NP_492787.1| cyclin-like F-box and Protein of un... 43 0.009
gi|17560312|ref|NP_506871.1| cyclin-like F-box and Protein of un... 42 0.012
gi|17531639|ref|NP_494014.1| putative cytoplasmic protein family... 42 0.012
gi|17543462|ref|NP_502641.1| cyclin-like F-box and Protein of un... 42 0.015
gi|17550870|ref|NP_508309.1| cyclin-like F-box and Protein of un... 42 0.020
gi|7495522|pir||T19004 hypothetical protein C06C3.9 - Caenorhabd... 42 0.020
gi|7510783|pir||T27592 hypothetical protein ZC47.1 - Caenorhabdi... 40 0.057
gi|17540364|ref|NP_500327.1| putative cytoplasmic protein family... 40 0.057
gi|17559466|ref|NP_507066.1| cyclin-like F-box family member (5Q... 40 0.075
gi|17561590|ref|NP_507465.1| predicted CDS, cyclin-like F-box an... 39 0.098
gi|17560392|ref|NP_507385.1| predicted CDS, cyclin-like F-box an... 38 0.22
gi|17570497|ref|NP_508070.1| putative protein (XA759) [Caenorhab... 38 0.22
gi|17555202|ref|NP_497525.1| predicted CDS, putative cytoplasmic... 38 0.22
gi|17560964|ref|NP_504516.1| cyclin-like F-box and Protein of un... 38 0.28
gi|17531895|ref|NP_495070.1| putative protein family member (2F8... 37 0.37
gi|17531637|ref|NP_494013.1| cyclin-like F-box and Protein of un... 37 0.48
gi|32697988|emb|CAB03015.2| Hypothetical protein F28F8.4 [Caenor... 37 0.48
gi|50727060|gb|AAT81200.1| Hypothetical protein F14D2.13 [Caenor... 37 0.63
gi|32564766|ref|NP_871999.1| cyclin-like F-box and BTB/POZ domai... 37 0.63
gi|7499081|pir||T32791 hypothetical protein F14D2.8 - Caenorhabd... 37 0.63
gi|17566364|ref|NP_507275.1| cyclin-like F-box and Protein of un... 36 0.83
gi|7496779|pir||T19604 hypothetical protein C31C9.4 - Caenorhabd... 36 0.83
gi|17565406|ref|NP_507539.1| predicted CDS, cyclin-like F-box an... 36 1.1
gi|17534375|ref|NP_494659.1| cyclin-like F-box and Protein of un... 36 1.1
gi|34556089|emb|CAB54324.2| Hypothetical protein Y113G7B.1 [Caen... 36 1.1
gi|17532195|ref|NP_496870.1| predicted CDS, cyclin-like F-box an... 36 1.1
gi|17557362|ref|NP_506880.1| cyclin-like F-box and Protein of un... 35 1.8
gi|17557364|ref|NP_506879.1| cyclin-like F-box and Protein of un... 35 1.8
gi|30145722|emb|CAD89725.1| Hypothetical protein B0391.6 [Caenor... 35 1.8
gi|38350641|gb|AAR18430.1| putative salivary protein [Culex pipi... 35 2.4
gi|7494907|pir||T18734 hypothetical protein B0391.6 - Caenorhabd... 35 2.4
gi|7496285|pir||T19394 hypothetical protein C18D4.8 - Caenorhabd... 34 3.1
gi|32566897|ref|NP_507444.2| cyclin-like F-box and Protein of un... 34 3.1
gi|17568453|ref|NP_510502.1| cyclin-like F-box and Protein of un... 34 4.1
gi|48870294|ref|ZP_00323019.1| COG0564: Pseudouridylate synthase... 34 4.1
gi|17567997|ref|NP_508361.1| predicted CDS, cyclin-like F-box an... 34 4.1
gi|23612896|ref|NP_704435.1| hypothetical protein [Plasmodium fa... 34 4.1
gi|23957777|ref|NP_473326.2| hypothetical protein [Plasmodium fa... 34 4.1
gi|17554046|ref|NP_499211.1| cyclin-like F-box (3L38) [Caenorhab... 33 5.4
gi|46141894|ref|ZP_00204074.1| COG3420: Nitrous oxidase accessor... 33 5.4
gi|482230|pir||S41025 hypothetical protein K03H1.2 - Caenorhabdi... 33 5.4
gi|17509607|ref|NP_491152.1| cyclin-like F-box and Protein of un... 33 5.4
gi|50838814|ref|NP_001002869.1| DEAD (Asp-Glu-Ala-Asp) box polyp... 33 7.0
gi|47825001|gb|AAT38773.1| putative late blight resistance prote... 33 7.0
gi|27762934|gb|AAO20505.1| envelope glycoprotein [Human immunode... 33 9.1
gi|49035143|gb|AAB66190.2| Hypothetical protein T07D3.1 [Caenorh... 33 9.1
gi|18310372|ref|NP_562306.1| ATP-dependent protease La [Clostrid... 33 9.1
gi|46227459|gb|EAK88394.1| protein phosphatase regulator like he... 33 9.1
gi|17536079|ref|NP_493845.1| putative cytoplasmic protein family... 33 9.1
>gi|17556731|ref|NP_497355.1| cyclin-like F-box and Protein of
unknown function DUF38 family member (3C341)
[Caenorhabditis elegans]
gi|13786493|gb|AAK29720.2| Hypothetical protein Y119D3B.6
[Caenorhabditis elegans]
Length = 264
Score = 523 bits (1346), Expect = e-147
Identities = 264/264 (100%), Positives = 264/264 (100%)
Frame = +1
Query: 1 MVELGALPIEIVNEIIEKLKPVHRLTLRDVSRNFRAAVDNVGIDCEKVEIVLKPDNIVNL 180
MVELGALPIEIVNEIIEKLKPVHRLTLRDVSRNFRAAVDNVGIDCEKVEIVLKPDNIVNL
Sbjct: 1 MVELGALPIEIVNEIIEKLKPVHRLTLRDVSRNFRAAVDNVGIDCEKVEIVLKPDNIVNL 60
Query: 181 SVDGDDASNHDLDVILKARLAHLSVSFDTENKENRRIHSESLASTLKNLENCTTRSLLLK 360
SVDGDDASNHDLDVILKARLAHLSVSFDTENKENRRIHSESLASTLKNLENCTTRSLLLK
Sbjct: 61 SVDGDDASNHDLDVILKARLAHLSVSFDTENKENRRIHSESLASTLKNLENCTTRSLLLK 120
Query: 361 DLSCHEILLLLPFFNVLGEISIDGITCIDQLREVGQRSQWSKVTSLISRVWIKDMTILKH 540
DLSCHEILLLLPFFNVLGEISIDGITCIDQLREVGQRSQWSKVTSLISRVWIKDMTILKH
Sbjct: 121 DLSCHEILLLLPFFNVLGEISIDGITCIDQLREVGQRSQWSKVTSLISRVWIKDMTILKH 180
Query: 541 LFHLNRFYVKAKSIPVESAIKIRDILLNNATFQNCVIRIAEWKTGIPEIAKVFQPDYTDG 720
LFHLNRFYVKAKSIPVESAIKIRDILLNNATFQNCVIRIAEWKTGIPEIAKVFQPDYTDG
Sbjct: 181 LFHLNRFYVKAKSIPVESAIKIRDILLNNATFQNCVIRIAEWKTGIPEIAKVFQPDYTDG 240
Query: 721 NLIRYRNSFTISFTSHSLCIRRNE 792
NLIRYRNSFTISFTSHSLCIRRNE
Sbjct: 241 NLIRYRNSFTISFTSHSLCIRRNE 264