Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W09G10_2
(507 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 k... 358 4e-98
gi|17536859|ref|NP_494586.1| predicted CDS, c-type lectin precur... 213 2e-54
gi|39580385|emb|CAE70944.1| Hypothetical protein CBG17752 [Caeno... 201 7e-51
gi|39580386|emb|CAE70945.1| Hypothetical protein CBG17754 [Caeno... 188 5e-47
gi|17558364|ref|NP_507555.1| predicted CDS, c-type lectin family... 129 2e-29
gi|17561204|ref|NP_507306.1| predicted CDS, low affinity IgE Fc ... 124 1e-27
gi|17560636|ref|NP_503568.1| c-type lectin precursor family memb... 123 1e-27
gi|17560638|ref|NP_503569.1| c-type lectin precursor family memb... 123 2e-27
gi|17566372|ref|NP_507279.1| predicted CDS, c-type lectin precur... 122 3e-27
gi|17511045|ref|NP_492872.1| c-type lectin family member (24.1 k... 122 3e-27
gi|17566390|ref|NP_507286.1| predicted CDS, c-type lectin family... 121 6e-27
gi|17511035|ref|NP_492867.1| c-type lectin precursor family memb... 119 2e-26
gi|17561202|ref|NP_507305.1| predicted CDS, low affinity IgE Fc ... 118 5e-26
gi|17536819|ref|NP_494566.1| c-type lectin family member (2D809)... 114 1e-24
gi|39580389|emb|CAE70948.1| Hypothetical protein CBG17758 [Caeno... 113 2e-24
gi|7506183|pir||T31795 hypothetical protein R02F11.2 - Caenorhab... 112 3e-24
gi|32567037|ref|NP_504286.2| protein of unknown function CX and ... 112 3e-24
gi|49035134|gb|AAB65898.3| Hypothetical protein R02F11.2 [Caenor... 112 3e-24
gi|17536861|ref|NP_494585.1| c-type lectin family member (2D867)... 111 6e-24
gi|39581940|emb|CAE73802.1| Hypothetical protein CBG21352 [Caeno... 111 8e-24
gi|7511124|pir||T27838 hypothetical protein ZK39.6 - Caenorhabdi... 110 1e-23
gi|39592416|emb|CAE63493.1| Hypothetical protein CBG07963 [Caeno... 110 1e-23
gi|17511037|ref|NP_492866.1| c-type lectin precursor family memb... 110 2e-23
gi|17536853|ref|NP_494581.1| predicted CDS, c-type lectin family... 110 2e-23
gi|17536965|ref|NP_494446.1| predicted CDS, c-type lectin precur... 108 5e-23
gi|17511033|ref|NP_492868.1| c-type lectin precursor family memb... 108 6e-23
gi|17559778|ref|NP_507556.1| killer cell like family member (5S6... 107 8e-23
gi|17560214|ref|NP_507154.1| predicted CDS, c-type lectin precur... 107 1e-22
gi|17536865|ref|NP_494582.1| c-type lectin family member (2D863)... 107 1e-22
gi|39592415|emb|CAE63492.1| Hypothetical protein CBG07961 [Caeno... 106 2e-22
gi|17511043|ref|NP_492871.1| chondroitin sulfate proteoglycan 3 ... 106 2e-22
gi|17536863|ref|NP_494583.1| c-type lectin family member (2D865)... 105 3e-22
gi|39592448|emb|CAE63525.1| Hypothetical protein CBG08004 [Caeno... 105 3e-22
gi|17509255|ref|NP_493210.1| c-type lectin family member (1N275)... 105 3e-22
gi|17536851|ref|NP_494580.1| predicted CDS, c-type lectin family... 105 4e-22
gi|38422741|emb|CAA20959.2| Hypothetical protein Y102A5C.16 [Cae... 105 5e-22
gi|17536551|ref|NP_496528.1| c-type lectin precursor family memb... 104 9e-22
gi|39581941|emb|CAE73803.1| Hypothetical protein CBG21353 [Caeno... 103 2e-21
gi|39580387|emb|CAE70946.1| Hypothetical protein CBG17755 [Caeno... 101 6e-21
gi|17511039|ref|NP_492869.1| c-type lectin precursor family memb... 101 8e-21
gi|17566178|ref|NP_507369.1| predicted CDS, c-type lectin family... 98 7e-20
gi|17536855|ref|NP_494584.1| predicted CDS, c-type lectin family... 97 1e-19
gi|17509731|ref|NP_493248.1| c-type lectin precursor family memb... 96 3e-19
gi|39592447|emb|CAE63524.1| Hypothetical protein CBG08003 [Caeno... 96 4e-19
gi|17566388|ref|NP_507288.1| c-type lectin precursor family memb... 95 6e-19
gi|39595684|emb|CAE67187.1| Hypothetical protein CBG12623 [Caeno... 94 1e-18
gi|17509735|ref|NP_493250.1| c-type lectin precursor family memb... 92 4e-18
gi|17566176|ref|NP_507370.1| predicted CDS, c-type lectin family... 91 1e-17
gi|17506689|ref|NP_493310.1| putative protein family member (1N7... 91 1e-17
gi|17536963|ref|NP_494447.1| c-type lectin precursor family memb... 90 2e-17
gi|39590393|emb|CAE66132.1| Hypothetical protein CBG11356 [Caeno... 89 4e-17
gi|17536719|ref|NP_493771.1| c-type lectin family member (2A900)... 88 7e-17
gi|17565940|ref|NP_507577.1| predicted CDS, putative protein fam... 88 9e-17
gi|17565896|ref|NP_503376.1| predicted CDS, c-type lectin family... 87 1e-16
gi|39592429|emb|CAE63506.1| Hypothetical protein CBG07983 [Caeno... 86 3e-16
gi|39580388|emb|CAE70947.1| Hypothetical protein CBG17757 [Caeno... 86 4e-16
gi|25395485|pir||C88102 protein W09G10.6 [imported] - Caenorhabd... 85 6e-16
gi|17510207|ref|NP_492857.1| c-type lectin family member (1L607)... 85 6e-16
gi|17560612|ref|NP_507185.1| predicted CDS, putative secreted or... 85 8e-16
gi|39592446|emb|CAE63523.1| Hypothetical protein CBG08002 [Caeno... 85 8e-16
gi|39580257|emb|CAE69649.1| Hypothetical protein CBG15894 [Caeno... 83 2e-15
gi|33300606|emb|CAE17978.1| Hypothetical protein Y18D10A.24 [Cae... 83 2e-15
gi|39592428|emb|CAE63505.1| Hypothetical protein CBG07982 [Caeno... 83 2e-15
gi|17560038|ref|NP_507097.1| c-type lectin family member (5Q715)... 79 4e-14
gi|39580588|emb|CAE70484.1| Hypothetical protein CBG17079 [Caeno... 79 5e-14
gi|17559102|ref|NP_505754.1| predicted CDS, c-type lectin family... 77 1e-13
gi|39590141|emb|CAE61139.1| Hypothetical protein CBG04901 [Caeno... 76 4e-13
gi|17544386|ref|NP_502991.1| c-type lectin precursor family memb... 76 4e-13
gi|39592405|emb|CAE63482.1| Hypothetical protein CBG07950 [Caeno... 75 5e-13
gi|39590136|emb|CAE61134.1| Hypothetical protein CBG04895 [Caeno... 74 1e-12
gi|17506687|ref|NP_493309.1| predicted CDS, acyltransferase 3 fa... 74 1e-12
gi|17510251|ref|NP_492880.1| predicted CDS, c-type lectin precur... 74 2e-12
gi|39590134|emb|CAE61132.1| Hypothetical protein CBG04893 [Caeno... 73 3e-12
gi|39580384|emb|CAE70943.1| Hypothetical protein CBG17751 [Caeno... 72 4e-12
gi|39585190|emb|CAE57433.1| Hypothetical protein CBG00394 [Caeno... 72 4e-12
gi|17560662|ref|NP_507006.1| c-type lectin family member (5Q453)... 72 5e-12
gi|39591539|emb|CAE71115.1| Hypothetical protein CBG17968 [Caeno... 71 1e-11
gi|39590137|emb|CAE61135.1| Hypothetical protein CBG04896 [Caeno... 70 1e-11
gi|39590138|emb|CAE61136.1| Hypothetical protein CBG04897 [Caeno... 69 6e-11
gi|39590135|emb|CAE61133.1| Hypothetical protein CBG04894 [Caeno... 68 7e-11
gi|39591537|emb|CAE71113.1| Hypothetical protein CBG17966 [Caeno... 68 1e-10
gi|39590099|emb|CAE61097.1| Hypothetical protein CBG04852 [Caeno... 65 5e-10
gi|39591538|emb|CAE71114.1| Hypothetical protein CBG17967 [Caeno... 65 8e-10
gi|17566546|ref|NP_507913.1| c-type lectin precursor family memb... 65 8e-10
gi|17509827|ref|NP_493289.1| c-type lectin precursor family memb... 64 2e-09
gi|17553182|ref|NP_498002.1| c-type lectin family member (3F932)... 63 2e-09
gi|39585189|emb|CAE57432.1| Hypothetical protein CBG00393 [Caeno... 62 4e-09
gi|7804476|dbj|BAA95671.1| C-type lectin [Cyprinus carpio] 62 5e-09
gi|17539148|ref|NP_501134.1| c-type lectin family member (4H948)... 60 2e-08
gi|17511041|ref|NP_492870.1| putative secreted or extracellular ... 60 2e-08
gi|39590143|emb|CAE61141.1| Hypothetical protein CBG04903 [Caeno... 59 3e-08
gi|17538258|ref|NP_501369.1| mannose receptor C type family memb... 59 3e-08
gi|39587489|emb|CAE58427.1| Hypothetical protein CBG01558 [Caeno... 59 4e-08
gi|17544394|ref|NP_502996.1| c-type lectin family member (4R777)... 59 6e-08
gi|17539324|ref|NP_503089.1| putative protein family member, wit... 58 8e-08
gi|17508839|ref|NP_491247.1| mannose receptor C type family memb... 58 1e-07
gi|27356854|gb|AAL89535.1| putative CD209L1 protein [Pan troglod... 57 1e-07
gi|34870124|ref|XP_344065.1| similar to SIGNR3 [Rattus norvegicus] 57 2e-07
gi|17540278|ref|NP_502932.1| predicted CDS, c-type lectin family... 57 2e-07
gi|17506693|ref|NP_493312.1| putative protein family member (1N7... 57 2e-07
gi|17553180|ref|NP_498001.1| predicted CDS, c-type lectin family... 57 2e-07
gi|25777769|gb|AAN75588.1| SIGNR1 alpha [Mus musculus] 57 2e-07
gi|39589078|emb|CAE57810.1| Hypothetical protein CBG00834 [Caeno... 57 2e-07
gi|46395882|sp|Q8HYC0|209L_PANTR CD209 antigen-like protein 1 >g... 57 2e-07
gi|39583048|emb|CAE71827.1| Hypothetical protein CBG18868 [Caeno... 57 2e-07
gi|17566100|ref|NP_507868.1| c-type lectin family member (5U452)... 57 2e-07
gi|17544382|ref|NP_502990.1| predicted CDS, c-type lectin family... 56 3e-07
gi|17538262|ref|NP_501371.1| mannose receptor C type precursor f... 56 3e-07
gi|34870066|ref|XP_221788.2| similar to SIGNR1 alpha [Rattus nor... 55 5e-07
gi|25777767|gb|AAN75587.1| SIGNR1 alpha [Mus musculus] 55 5e-07
gi|39579641|emb|CAE56640.1| Hypothetical protein CBG24401 [Caeno... 55 5e-07
gi|37813574|gb|AAR04559.1| L-SIGN variant [Homo sapiens] 55 5e-07
gi|46395878|sp|Q8HY06|209L_GORGO CD209 antigen-like protein 1 >g... 55 5e-07
gi|38089047|ref|XP_110691.2| RIKEN cDNA 4930572L20 [Mus musculus... 55 6e-07
gi|39590140|emb|CAE61138.1| Hypothetical protein CBG04899 [Caeno... 55 6e-07
gi|18698684|ref|NP_081248.1| CD209b antigen [Mus musculus] >gnl|... 55 6e-07
gi|25777775|gb|AAN75591.1| SIGNR1 alpha [Mus musculus] 55 6e-07
gi|25777765|gb|AAN75586.1| SIGNR1 alpha [Mus musculus] 55 6e-07
gi|25777783|gb|AAN75595.1| SIGNR1 [Mus musculus] >gnl|BL_ORD_ID|... 55 6e-07
gi|25777777|gb|AAN75592.1| SIGNR1 beta [Mus musculus] >gnl|BL_OR... 55 6e-07
gi|19263791|gb|AAH25069.1| 4930572L20Rik protein [Mus musculus] 55 6e-07
gi|15383614|gb|AAK91863.1| sDC-SIGN2 type I isoform [Homo sapiens] 55 6e-07
gi|50513581|pdb|1SL6|A Chain A, Crystal Structure Of A Fragment ... 55 6e-07
gi|17543488|ref|NP_500445.1| c-type lectin family member (65.9 k... 55 6e-07
gi|13383470|gb|AAK20998.1| L-SIGN [Homo sapiens] 55 6e-07
gi|47607497|ref|NP_999841.1| CD209 antigen-like isoform 2; proba... 55 6e-07
gi|16660122|gb|AAL27540.1| SIGNR1 TM-less isoform [Mus musculus] 55 6e-07
gi|15383618|gb|AAK91865.1| sDC-SIGN2 type III isoform [Homo sapi... 55 6e-07
gi|46395849|sp|Q8CJ91|209B_MOUSE CD209 antigen-like protein B (D... 55 6e-07
gi|18158893|pdb|1K9J|A Chain A, Complex Of Dc-Signr And Glcnac2m... 55 6e-07
gi|25777773|gb|AAN75590.1| SIGNR1 alpha [Mus musculus] 55 6e-07
gi|42542390|ref|NP_055072.3| CD209 antigen-like isoform 1; proba... 55 6e-07
gi|25777787|gb|AAN75597.1| SIGNR1 [Mus musculus] 55 8e-07
gi|17510429|ref|NP_493430.1| predicted CDS, c-type lectin family... 55 8e-07
gi|17540466|ref|NP_500450.1| c-type lectin family member (65.9 k... 54 1e-06
gi|17559100|ref|NP_505753.1| putative protein family member (5L2... 53 2e-06
gi|46395881|sp|Q8HY12|209L_HYLLA CD209 antigen-like protein 1 >g... 53 2e-06
gi|37782432|gb|AAP34462.1| LP2698 [Homo sapiens] 53 3e-06
gi|46395880|sp|Q8HY11|209L_HYLSY CD209 antigen-like protein 1 >g... 53 3e-06
gi|46395879|sp|Q8HY10|209L_HYLCO CD209 antigen-like protein 1 >g... 53 3e-06
gi|25777763|gb|AAN75585.1| SIGNR1 [Mus musculus] 52 4e-06
gi|38348296|ref|NP_940894.1| liver and lymph node sinusoidal end... 52 4e-06
gi|17553034|ref|NP_497946.1| c-type lectin precursor family memb... 52 5e-06
gi|17539326|ref|NP_503090.1| versican family member, possibly N-... 52 5e-06
gi|17506151|ref|NP_493484.1| predicted CDS, putative protein fam... 52 7e-06
gi|16660119|gb|AAL27539.1| DC-SIGN neck-less isoform [Mus musculus] 52 7e-06
gi|7497627|pir||T20046 hypothetical protein C49A1.9 - Caenorhabd... 52 7e-06
gi|17510431|ref|NP_493431.1| putative endoplasmic reticulum prot... 51 9e-06
gi|26000685|gb|AAN75192.1| C-type lectin [Carassius auratus] 51 1e-05
gi|18777736|ref|NP_570974.1| CD209d antigen [Mus musculus] >gnl|... 51 1e-05
gi|17017253|gb|AAL33584.1| SIGNR3 [Mus musculus] 51 1e-05
gi|17565950|ref|NP_507582.1| predicted CDS, putative protein fam... 51 1e-05
gi|12084797|gb|AAG13848.2| probable mannose binding C-type lecti... 51 1e-05
gi|18777739|ref|NP_570975.1| Cd209e antigen [Mus musculus] >gnl|... 50 2e-05
gi|15281075|gb|AAK91847.1| mDC-SIGN1A type II isoform [Homo sapi... 50 2e-05
gi|39580171|emb|CAE56379.1| Hypothetical protein CBG24059 [Caeno... 50 2e-05
gi|17507421|ref|NP_493450.1| putative protein family member (1O6... 50 2e-05
gi|34870118|ref|XP_221808.2| similar to DC-SIGN [Rattus norvegicus] 50 2e-05
gi|18875404|ref|NP_573501.1| CD209a antigen [Mus musculus] >gnl|... 50 2e-05
gi|17542442|ref|NP_501639.1| putative protein (4K93) [Caenorhabd... 50 3e-05
gi|25777771|gb|AAN75589.1| SIGNR1 alpha [Mus musculus] 50 3e-05
gi|28628336|gb|AAO43605.1| serum lectin isoform 1 precursor [Sal... 49 4e-05
gi|28628334|gb|AAO43604.1| serum lectin isoform 5 precursor [Sal... 49 4e-05
gi|28628342|gb|AAO43608.1| serum lectin isoform 4 precursor [Sal... 49 5e-05
gi|39591912|emb|CAE75132.1| Hypothetical protein CBG23060 [Caeno... 49 5e-05
gi|39579666|emb|CAE56464.1| Hypothetical protein CBG24174 [Caeno... 49 5e-05
gi|17562684|ref|NP_507837.1| putative protein family member (5U2... 49 5e-05
gi|34870070|ref|XP_213687.2| similar to SIGNR1 [Rattus norvegicus] 49 6e-05
gi|17559816|ref|NP_505795.1| c-type lectin precursor family memb... 49 6e-05
gi|47219898|emb|CAF97168.1| unnamed protein product [Tetraodon n... 49 6e-05
gi|17566540|ref|NP_507917.1| predicted CDS, putative protein fam... 48 8e-05
gi|34870122|ref|XP_221790.2| similar to SIGNR4 [Rattus norvegicus] 48 8e-05
gi|17559330|ref|NP_504977.1| c-type lectin precursor family memb... 48 8e-05
gi|28628338|gb|AAO43606.1| serum lectin isoform 2 precursor [Sal... 48 8e-05
gi|27356928|gb|AAL89544.1| putative CD209 protein [Pan troglodytes] 48 1e-04
gi|15281085|gb|AAK91852.1| sDC-SIGN1A type III isoform [Homo sap... 47 1e-04
gi|15281093|gb|AAK91856.1| sDC-SIGN1B type II isoform [Homo sapi... 47 1e-04
gi|15281083|gb|AAK91851.1| sDC-SIGN1A TYPE II isoform [Homo sapi... 47 1e-04
gi|15281091|gb|AAK91855.1| sDC-SIGN1B type I isoform [Homo sapiens] 47 1e-04
gi|15281081|gb|AAK91850.1| sDC-SIGN1A type I isoform [Homo sapiens] 47 1e-04
gi|15281089|gb|AAK91854.1| mDC-SIGN1B type I isoform [Homo sapiens] 47 1e-04
gi|15420782|gb|AAK97458.1| dendritic cell-specific ICAM-3 grabbi... 47 1e-04
gi|10863957|ref|NP_066978.1| CD209 antigen; dendritic cell-speci... 47 1e-04
gi|50513579|pdb|1SL4|A Chain A, Crystal Structure Of Dc-Sign Car... 47 1e-04
gi|46395871|sp|Q8HXZ7|C209_PANTR CD209 antigen (Dendritic cell-s... 47 1e-04
gi|15281077|gb|AAK91848.1| mDC-SIGN1A type III isoform [Homo sap... 47 1e-04
gi|50513580|pdb|1SL5|A Chain A, Crystal Structure Of Dc-Sign Car... 47 1e-04
gi|17558760|ref|NP_504967.1| predicted CDS, putative cytoplasmic... 47 1e-04
gi|18158883|pdb|1K9I|A Chain A, Complex Of Dc-Sign And Glcnac2ma... 47 1e-04
gi|21361116|ref|NP_004376.2| chondroitin sulfate proteoglycan 2 ... 47 2e-04
gi|387017|gb|AAA36437.1| chondroitin sulfate proteoglycan core p... 47 2e-04
gi|833853|gb|AAA67565.1| versican V2 core protein precursor 47 2e-04
gi|50732399|ref|XP_418617.1| PREDICTED: similar to Macrophage ma... 47 2e-04
gi|1008913|dbj|BAA06801.1| proteoglycan PG-M(V3) [Homo sapiens] 47 2e-04
gi|23498706|emb|CAD28397.1| putative mannose-binding C-type lect... 47 2e-04
gi|34364950|emb|CAE46022.1| hypothetical protein [Homo sapiens] 47 2e-04
gi|482656|pir||A60979 versican precursor - human >gnl|BL_ORD_ID|... 47 2e-04
gi|28628340|gb|AAO43607.1| serum lectin isoform 3 precursor [Sal... 47 2e-04
gi|17531917|ref|NP_494490.1| putative protein family member (2D5... 47 2e-04
gi|25777781|gb|AAN75594.1| SIGNR1 gamma [Mus musculus] 47 2e-04
gi|27356910|gb|AAL89542.1| putative CD209 protein [Pongo pygmaeus] 47 2e-04
gi|46395873|sp|Q8HY00|C209_PONPY CD209 antigen (Dendritic cell-s... 47 2e-04
gi|2073142|dbj|BAA19861.1| Incilarin A [Incilaria fruhstorferi] 47 2e-04
gi|27356930|gb|AAL89545.1| putative CD209 protein [Pan troglodytes] 47 2e-04
gi|38569737|gb|AAR24388.1| mannose receptor C1 [Sus scrofa] 46 3e-04
gi|3253302|gb|AAC24359.1| versican V1 splice-variant precursor [... 46 3e-04
gi|30794358|ref|NP_851378.1| versican; chondroitin sulfate prote... 46 3e-04
gi|4758084|ref|NP_004377.1| chondroitin sulfate proteoglycan 3 (... 46 3e-04
gi|7513547|pir||T14274 versican precursor, splice form V2 - bovi... 46 3e-04
gi|3253306|gb|AAC24361.1| versican V3 splice-variant precursor [... 46 3e-04
gi|34870126|ref|XP_221778.2| similar to DC-SIGN [Rattus norvegicus] 46 3e-04
gi|3288885|gb|AAC25581.1| PGCN_HUMAN, PARTIAL CDS; 245 KD EARLY ... 46 3e-04
gi|45382043|ref|NP_990071.1| neurocan core protein precursor [Ga... 46 3e-04
gi|17559566|ref|NP_507660.1| predicted CDS, c-type lectin family... 46 4e-04
gi|19424220|ref|NP_598234.1| Fc receptor, IgE, low affinity II, ... 45 5e-04
gi|2137709|pir||A55535 versican precursor - mouse >gnl|BL_ORD_ID... 45 7e-04
gi|13236929|gb|AAB28791.2| low affinity IgE Fc receptor isoform ... 45 7e-04
gi|46048882|ref|NP_990118.1| proteoglycan [Gallus gallus] >gnl|B... 45 7e-04
gi|1008921|dbj|BAA06802.1| proteoglycan PG-M(V3) [Mus musculus] 45 7e-04
gi|21431626|sp||Q9ERB4_2 [Segment 2 of 2] Versican core protein ... 45 7e-04
gi|18476520|gb|AAL58516.1| Fc epsilon receptor II subtype b vari... 45 7e-04
gi|18476522|gb|AAL58517.1| Fc epsilon receptor II subtype b vari... 45 7e-04
gi|2497660|sp|Q62059|PGCV_MOUSE Versican core protein precursor ... 45 7e-04
gi|17558764|ref|NP_504965.1| predicted CDS, putative protein fam... 45 7e-04
gi|7305051|ref|NP_038545.1| Fc receptor, IgE, low affinity II, a... 45 7e-04
gi|34853015|ref|XP_215451.2| similar to Versican core protein pr... 45 7e-04
gi|3309591|gb|AAC26116.1| versican V3 isoform precursor [Rattus ... 45 7e-04
gi|560482|emb|CAA45532.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 45 7e-04
gi|560484|emb|CAA45533.1| Fc-E receptor II (Fc-ERII/CD23) [Mus m... 45 7e-04
gi|46395872|sp|Q8HXZ8|C209_GORGO CD209 antigen (Dendritic cell-s... 45 7e-04
gi|505285|emb|CAA42787.1| proteoglycan [Gallus gallus] 45 7e-04
gi|13236930|gb|AAB28792.2| low affinity IgE Fc receptor isoform ... 45 7e-04
gi|13236931|gb|AAB28793.2| low affinity IgE Fc receptor isoform ... 45 7e-04
gi|46395660|sp|P60883|C209_CERAE CD209 antigen (Dendritic cell-s... 45 9e-04
gi|18652791|gb|AAK74185.1| type II membrane protein CD209 [Macac... 45 9e-04
gi|16118475|gb|AAL14438.1| dendritic cell-specific ICAM-3 grabbi... 45 9e-04
gi|46395877|sp|Q8HY04|C209_PAPHA CD209 antigen (Dendritic cell-s... 45 9e-04
gi|17559564|ref|NP_507661.1| predicted CDS, c-type lectin precur... 45 9e-04
gi|46395874|sp|Q8HY01|C209_HYLCO CD209 antigen (Dendritic cell-s... 45 9e-04
gi|46395876|sp|Q8HY03|C209_HYLLA CD209 antigen (Dendritic cell-s... 45 9e-04
gi|1083928|pir||JP0075 lectin CEL-IV, C-type - Cucumaria echinat... 44 0.001
gi|46395942|sp|Q95LC6|C209_MACNE CD209 antigen (Dendritic cell-s... 44 0.001
gi|47218445|emb|CAG03717.1| unnamed protein product [Tetraodon n... 44 0.001
gi|13277204|emb|CAC34376.1| LECC1 protein [Aphrocallistes vastus] 44 0.001
gi|39593626|emb|CAE61918.1| Hypothetical protein CBG05914 [Caeno... 44 0.001
gi|18485494|ref|NP_569716.1| collectin sub-family member 12 [Mus... 44 0.001
gi|23498707|emb|CAD28398.1| putative mannose-binding C-type lect... 44 0.001
gi|19070849|gb|AAL84004.1| CD23 [Rattus norvegicus] 44 0.001
gi|46395941|sp|Q95J96|C209_MACMU CD209 antigen (Dendritic cell-s... 44 0.001
gi|15420784|gb|AAK97459.1| dendritic cell-specific ICAM-3 grabbi... 44 0.001
gi|23498708|emb|CAD28399.1| putative mannose-binding C-type lect... 44 0.001
gi|26335321|dbj|BAC31361.1| unnamed protein product [Mus musculus] 44 0.002
gi|25392184|pir||JC7595 scavenger receptor with C-type lectin ty... 44 0.002
gi|21901969|dbj|BAC05523.1| collectin placenta 1 [Mus musculus] ... 44 0.002
gi|38174510|gb|AAH60789.1| Collectin sub-family member 12, isofo... 44 0.002
gi|10120636|pdb|1EGG|A Chain A, Structure Of A C-Type Carbohydra... 44 0.002
gi|39588191|emb|CAE68116.1| Hypothetical protein CBG13759 [Caeno... 44 0.002
gi|12644429|sp|Q28343|PGCA_CANFA Aggrecan core protein precursor... 44 0.002
gi|4505245|ref|NP_002429.1| mannose receptor C type 1 precursor;... 44 0.002
gi|6174903|sp|P13608|PGCA_BOVIN Aggrecan core protein precursor ... 44 0.002
gi|30354370|gb|AAH52032.1| Brevican [Mus musculus] 43 0.003
gi|18641360|ref|NP_569057.1| collectin sub-family member 12 isof... 43 0.003
gi|1143285|gb|AAA87847.1| brevican core protein 43 0.003
gi|6671618|ref|NP_031555.1| brevican [Mus musculus] >gnl|BL_ORD_... 43 0.003
gi|211652|gb|AAA48719.1| proteoglycan core protein [Gallus gallus] 43 0.003
gi|46395875|sp|Q8HY02|C209_HYLSY CD209 antigen (Dendritic cell-s... 43 0.003
gi|50732401|ref|XP_418618.1| PREDICTED: similar to Macrophage ma... 43 0.003
gi|27806731|ref|NP_776421.1| chondroitin sulfate proteoglycan BE... 43 0.003
gi|19584340|emb|CAD28466.1| hypothetical protein [Homo sapiens] 43 0.003
gi|34877879|ref|XP_341575.1| similar to collectin placenta 1 [Ra... 43 0.003
gi|39590447|emb|CAE66187.1| Hypothetical protein CBG11425 [Caeno... 43 0.003
gi|39585191|emb|CAE57434.1| Hypothetical protein CBG00395 [Caeno... 43 0.003
gi|1083074|pir||A39808 proteoglycan core protein, cartilage - bo... 43 0.003
gi|37953324|gb|AAP44494.1| aggrecan [Bos taurus] 43 0.003
gi|39583006|emb|CAE71785.1| Hypothetical protein CBG18789 [Caeno... 43 0.003
gi|27806761|ref|NP_776406.1| aggrecan 1 (chondroitin sulfate pro... 43 0.003
gi|47213064|emb|CAF91578.1| unnamed protein product [Tetraodon n... 43 0.003
gi|27691552|ref|XP_221781.1| similar to SIGNR2 [Rattus norvegicus] 42 0.004
gi|50737082|ref|XP_419148.1| PREDICTED: similar to collectin sub... 42 0.004
gi|17553030|ref|NP_497945.1| c-type lectin family member (3F723)... 42 0.004
gi|13876737|gb|AAK43585.1| C-type lectin-like protein 2 [Bungaru... 42 0.004
gi|18157520|dbj|BAB83835.1| supported by GENSCAN and partially h... 42 0.004
gi|32469212|dbj|BAC78902.1| C-type lectin [Echidna delicatula] 42 0.004
gi|18777733|ref|NP_570973.1| CD209c antigen [Mus musculus] >gnl|... 42 0.004
gi|11990616|ref|NP_071526.1| aggrecan 1; aggrecan, structural pr... 42 0.006
gi|2506815|sp|P55068|PGCB_RAT Brevican core protein precursor (B... 42 0.006
gi|129887|sp|P07897|PGCA_RAT Aggrecan core protein precursor (Ca... 42 0.006
gi|17506147|ref|NP_493487.1| predicted CDS, putative protein fam... 42 0.006
gi|6671523|ref|NP_031450.1| aggrecan 1; aggrecan, structural pro... 42 0.006
gi|45384426|ref|NP_990286.1| chondroitin sulfate proteoglycan co... 42 0.006
gi|2506814|sp|P07898|PGCA_CHICK Aggrecan core protein precursor ... 42 0.006
gi|39587015|emb|CAE62950.1| Hypothetical protein CBG07163 [Caeno... 42 0.006
gi|39582517|emb|CAE65604.1| Hypothetical protein CBG10625 [Caeno... 42 0.006
gi|211655|gb|AAA48720.1| proteoglycan core protein 42 0.006
gi|47225069|emb|CAF97484.1| unnamed protein product [Tetraodon n... 42 0.006
gi|14318638|gb|AAH09117.1| Brevican, isoform 1 [Homo sapiens] >g... 42 0.006
gi|18605564|gb|AAH22938.1| Brevican, isoform 1 [Homo sapiens] 42 0.006
gi|11276914|pir||T46256 brevican - human (fragment) >gnl|BL_ORD_... 42 0.006
gi|38372935|ref|NP_068767.3| brevican isoform 1; chondroitin sul... 42 0.006
gi|206105|gb|AAA41836.1| proteoglycan 42 0.006
gi|3695055|gb|AAC62622.1| gp200-MR6 [Homo sapiens] 42 0.007
gi|4505053|ref|NP_002340.1| lymphocyte antigen 75 [Homo sapiens]... 42 0.007
gi|32330807|gb|AAP79899.1| DEC-205/DCL-1 fusion protein variant ... 42 0.007
gi|50750998|ref|XP_422224.1| PREDICTED: similar to regenerating ... 42 0.007
gi|290002|gb|AAA49200.1| antifreeze protein >gnl|BL_ORD_ID|11388... 42 0.007
gi|39580256|emb|CAE69648.1| Hypothetical protein CBG15893 [Caeno... 42 0.007
gi|2134244|pir||JC5058 bitiscetin alpha chain - puff adder >gnl|... 42 0.007
gi|32307817|gb|AAN85434.1| DEC-205/DCL-1 fusion protein variant ... 42 0.007
gi|17507129|ref|NP_493188.1| predicted CDS, c-type lectin precur... 41 0.010
gi|39580589|emb|CAE70485.1| Hypothetical protein CBG17082 [Caeno... 41 0.010
gi|47228554|emb|CAG05374.1| unnamed protein product [Tetraodon n... 41 0.010
gi|13277206|emb|CAC34377.1| LECC2 protein [Aphrocallistes vastus] 41 0.010
gi|23498705|emb|CAD28396.1| putative mannose-binding C-type lect... 41 0.010
gi|45382743|ref|NP_990815.1| hepatic lectin [Gallus gallus] >gnl... 41 0.010
gi|17557544|ref|NP_505863.1| putative protein family member (5L7... 41 0.010
gi|47550825|ref|NP_999853.1| dermacan [Danio rerio] >gnl|BL_ORD_... 41 0.013
gi|46395899|sp|Q8MIS5|209P_MACMU CD209 antigen-like protein 2 >g... 40 0.016
gi|47217439|emb|CAG10208.1| unnamed protein product [Tetraodon n... 40 0.016
gi|47228322|emb|CAG07717.1| unnamed protein product [Tetraodon n... 40 0.016
gi|47216228|emb|CAG01262.1| unnamed protein product [Tetraodon n... 40 0.016
gi|17553354|ref|NP_497168.1| predicted CDS, C type lectin (3A790... 40 0.016
gi|47227540|emb|CAG04688.1| unnamed protein product [Tetraodon n... 40 0.022
gi|126180|sp|P16581|LEM2_HUMAN E-selectin precursor (Endothelial... 40 0.022
gi|4506871|ref|NP_000441.1| selectin E precursor; leukocyte endo... 40 0.022
gi|34534123|dbj|BAC86914.1| unnamed protein product [Homo sapiens] 40 0.028
gi|42659385|ref|XP_049349.11| KIAA0534 protein [Homo sapiens] >g... 40 0.028
gi|33243092|gb|AAQ01216.1| C-type lectin CTL-27 [Echis ocellatus] 40 0.028
gi|17531337|ref|NP_493698.1| c-type lectin precursor family memb... 40 0.028
gi|462500|sp|P33730|LEM2_CANFA E-selectin precursor (Endothelial... 40 0.028
gi|20521073|dbj|BAA25460.2| KIAA0534 protein [Homo sapiens] 40 0.028
gi|7513006|pir||T00266 hypothetical protein KIAA0534 - human (fr... 40 0.028
gi|6678744|ref|NP_032552.1| killer cell lectin-like receptor sub... 39 0.037
gi|47226732|emb|CAG07891.1| unnamed protein product [Tetraodon n... 39 0.037
gi|34146972|gb|AAB37037.2| Hypothetical protein F52E1.2 [Caenorh... 39 0.037
gi|33300312|emb|CAE17891.1| Hypothetical protein M199.6 [Caenorh... 39 0.037
gi|39584131|emb|CAE61506.1| Hypothetical protein CBG05405 [Caeno... 39 0.037
gi|39581152|emb|CAE71009.1| Hypothetical protein CBG17848 [Caeno... 39 0.037
gi|6678934|ref|NP_032652.1| mannose receptor, C type 2; novel le... 39 0.048
gi|47551241|ref|NP_999805.1| C-type lectin domain protein; SpC-l... 39 0.048
gi|32264366|gb|AAP78681.1| MBCTL2 [Monosiga brevicollis] 39 0.048
gi|2073144|dbj|BAA19862.1| Incilarin B [Incilaria fruhstorferi] 39 0.048
gi|2326381|emb|CAA62217.1| C-type lectin [Botryllus schlosseri] 39 0.048
gi|17563062|ref|NP_506460.1| predicted CDS, putative protein fam... 39 0.048
gi|45259478|dbj|BAD12391.1| aggrecan [Danio rerio] 39 0.048
gi|39590308|emb|CAE66047.1| Hypothetical protein CBG11247 [Caeno... 39 0.063
gi|31127172|gb|AAH52782.1| Unknown (protein for IMAGE:3371321) [... 39 0.063
gi|28374182|gb|AAH46292.1| Similar to RIKEN cDNA 1810029C22 gene... 39 0.063
gi|37360054|dbj|BAC98005.1| mKIAA0709 protein [Mus musculus] 39 0.063
gi|38089049|ref|XP_284386.2| RIKEN cDNA 1810029C22 [Mus musculus] 39 0.063
gi|39581281|emb|CAE60027.1| Hypothetical protein CBG03533 [Caeno... 39 0.063
gi|20196239|dbj|BAB47156.2| skin mucus 31.7 kDa lectin AJL-2 [An... 39 0.063
gi|47523602|ref|NP_999433.1| E-selectin [Sus scrofa] >gnl|BL_ORD... 38 0.082
gi|2136497|pir||JC5092 E-selectin - pig >gnl|BL_ORD_ID|1017740 g... 38 0.082
gi|1346436|sp|P98110|LEM2_PIG E-selectin precursor (Endothelial ... 38 0.082
gi|6680734|ref|NP_031519.1| asialoglycoprotein receptor 2 [Mus m... 38 0.082
gi|9965313|gb|AAG10039.1| E-selectin [Canis familiaris] 38 0.082
gi|48375116|gb|AAT42221.1| mannan-binding C-type lectin [Stichop... 38 0.082
gi|7657333|ref|NP_055173.1| C-type lectin, superfamily member 9;... 38 0.082
gi|33243086|gb|AAQ01213.1| C-type lectin CTL-3 [Echis carinatus ... 38 0.082
gi|15281079|gb|AAK91849.1| mDC-SIGN1A type IV isoform [Homo sapi... 38 0.082
gi|37779184|gb|AAP03438.1| dendritic cell-specific ICAM-3 grabbi... 38 0.11
gi|50750964|ref|XP_422207.1| PREDICTED: similar to cell adhesion... 38 0.11
gi|17559402|ref|NP_506589.1| c-type lectin and CUB domain contai... 38 0.11
gi|10641064|dbj|BAB16306.1| C-type lectin TC14-3 [Polyandrocarpa... 38 0.11
gi|17565266|ref|NP_507666.1| predicted CDS, c-type lectin family... 38 0.11
gi|34864835|ref|XP_217657.2| similar to bA338L11.1 (novel CUB do... 38 0.11
gi|39587016|emb|CAE62951.1| Hypothetical protein CBG07164 [Caeno... 38 0.11
gi|37779191|gb|AAP03439.1| dendritic cell-specific ICAM-3 grabbi... 38 0.11
gi|938265|emb|CAA45972.1| natural killer cell receptor-P1 [Mus m... 37 0.14
gi|7305245|ref|NP_038853.1| lymphocyte antigen 75 [Mus musculus]... 37 0.14
gi|15028452|gb|AAK81722.1| DEC-205 [Mus musculus] 37 0.14
gi|32697984|emb|CAB02800.2| Hypothetical protein C29F3.4 [Caenor... 37 0.14
gi|17559556|ref|NP_507665.1| predicted CDS, c-type lectin family... 37 0.14
gi|26340010|dbj|BAC33668.1| unnamed protein product [Mus musculus] 37 0.14
gi|39592589|emb|CAE63666.1| Hypothetical protein CBG08168 [Caeno... 37 0.18
gi|181168|gb|AAA35726.1| proteoglycan core protein 37 0.18
gi|25756916|pir||A39086 aggrecan precursor, cartilage long splic... 37 0.18
gi|129886|sp|P16112|PGCA_HUMAN Aggrecan core protein precursor (... 37 0.18
gi|6995994|ref|NP_037359.1| aggrecan 1 isoform 2 precursor; Aggr... 37 0.18
gi|47227138|emb|CAG00500.1| unnamed protein product [Tetraodon n... 37 0.18
gi|4501991|ref|NP_001126.1| aggrecan 1 isoform 1 precursor; Aggr... 37 0.18
gi|30249|emb|CAA35463.1| cartilage specific proteoglycan (600 AA... 37 0.18
gi|39591989|emb|CAE75209.1| Hypothetical protein CBG23156 [Caeno... 37 0.24
gi|5174485|ref|NP_006030.1| mannose receptor, C type 2; endocyti... 37 0.24
gi|4835878|gb|AAD30280.1| endocytic receptor Endo180 [Homo sapiens] 37 0.24
gi|17564476|ref|NP_507252.1| c-type lectin family member (5R320)... 37 0.24
gi|17532827|ref|NP_495020.1| putative protein family member (2F6... 37 0.24
gi|20916262|ref|XP_133092.1| RIKEN cDNA 2310020F24 [Mus musculus] 37 0.24
gi|17559398|ref|NP_506588.1| CUB domain and c-type lectin precur... 37 0.24
gi|4337050|gb|AAD18055.1| fibrinogen clotting inhibitor A chain ... 37 0.24
gi|40788335|dbj|BAA31684.2| KIAA0709 protein [Homo sapiens] 37 0.24
gi|16975299|pdb|1G1T|A Chain A, Crystal Structure Of E-Selectin ... 37 0.24
gi|640384|pdb|1ESL| E-Selectin (Lectin And Egf Domains, Residue... 37 0.24
gi|625318|pir||LNRC1 lectin BRA3-1 precursor - barnacle (Megabal... 37 0.24
gi|625317|pir||LNRC3 lectin BRA3-2 precursor - barnacle (Megabal... 37 0.24
gi|1730116|sp|P07439|LEC3_MEGRO Lectin BRA-3 precursor >gnl|BL_O... 37 0.24
gi|50749835|ref|XP_421777.1| PREDICTED: similar to attractin-lik... 37 0.24
gi|34555889|emb|CAB63316.2| Hypothetical protein T20B3.13 [Caeno... 37 0.24
gi|39581670|emb|CAE57178.1| Hypothetical protein CBG00017 [Caeno... 37 0.24
gi|225342|prf||1301209A lectin 37 0.24
gi|1514645|emb|CAA42701.1| cartilage aggregating proteoglycan [S... 36 0.31
gi|15928688|gb|AAH14811.1| Macrophage galactose N-acetyl-galacto... 36 0.31
gi|34922594|sp|Q920P9|LY75_MESAU Lymphocyte antigen 75 precursor... 36 0.31
gi|6754688|ref|NP_034926.1| macrophage galactose N-acetyl-galact... 36 0.31
gi|17559570|ref|NP_507658.1| predicted CDS, putative secreted or... 36 0.31
gi|17559336|ref|NP_504976.1| predicted CDS, tetranectin like pre... 36 0.31
gi|32450274|gb|AAH53817.1| MGC64513 protein [Xenopus laevis] 36 0.31
gi|17561482|ref|NP_503676.1| c-type lectin precursor family memb... 36 0.31
gi|10641067|dbj|BAB16307.1| C-type lectin TC14-4 [Polyandrocarpa... 36 0.31
gi|1078939|pir||JX0349 acrosomal major protein M6 - blue mussel ... 36 0.41
gi|17561852|ref|NP_506804.1| predicted CDS, c-type lectin family... 36 0.41
gi|126126|sp|P16108|LECC_POLMI Lectin >gnl|BL_ORD_ID|951175 gi|1... 36 0.41
gi|10641056|dbj|BAB16304.1| C-type lectin TC14-1 [Polyandrocarpa... 36 0.41
gi|34013698|gb|AAQ56012.1| lectin protein type I [Hippocampus co... 36 0.41
gi|20385163|gb|AAM21196.1| C-type mannose-binding lectin [Oncorh... 36 0.41
gi|33243074|gb|AAQ01207.1| C-type lectin CTL-2 [Bitis arietans] 36 0.41
gi|6755452|ref|NP_035475.1| selectin, endothelial cell [Mus musc... 36 0.41
gi|1655437|dbj|BAA13567.1| TC14-1 [Polyandrocarpa misakiensis] 36 0.41
gi|266458|sp|Q00690|LEM2_MOUSE E-selectin precursor (Endothelial... 36 0.41
gi|34870128|ref|XP_344066.1| similar to 4930572L20Rik protein [R... 35 0.53
gi|28981404|gb|AAH48780.1| Similar to phospholipase A2, group IB... 35 0.53
gi|17559568|ref|NP_507659.1| predicted CDS, putative protein fam... 35 0.53
gi|34870062|ref|XP_221810.2| similar to CD209 antigen; dendritic... 35 0.53
gi|27372091|gb|AAN87893.1| LECAM-1 [Sigmodon hispidus] 35 0.53
gi|7509603|pir||T26655 hypothetical protein Y38E10A.e - Caenorha... 35 0.53
gi|48476214|gb|AAT44382.1| REJ3CRD [Allocentrotus fragilis] 35 0.53
gi|6679365|ref|NP_032893.1| phospholipase A2, group IB, pancreas... 35 0.53
gi|17224989|gb|AAL37197.1| C lectin-related protein C [Mus muscu... 35 0.69
gi|38089051|ref|XP_284376.2| RIKEN cDNA 2310066I10 [Mus musculus] 35 0.69
gi|17565062|ref|NP_507830.1| proteoglycan precursor family membe... 35 0.69
gi|17558310|ref|NP_506808.1| c-type lectin precursor family memb... 35 0.69
gi|26341560|dbj|BAC34442.1| unnamed protein product [Mus musculus] 35 0.69
gi|31322514|gb|AAP22987.1| mannose receptor precursor-like isofo... 35 0.69
gi|31322510|gb|AAP22985.1| mannose receptor precursor-like isofo... 35 0.69
gi|50510519|dbj|BAD32245.1| mKIAA0534 protein [Mus musculus] 35 0.69
gi|31322506|gb|AAP22983.1| mannose receptor precursor-like isofo... 35 0.69
gi|38503140|sp|Q95LG1|LEM2_HORSE E-selectin precursor (Endotheli... 35 0.69
gi|31322508|gb|AAP22984.1| mannose receptor precursor-like isofo... 35 0.69
gi|29476801|gb|AAH50020.1| Atrnl protein [Mus musculus] 35 0.69
gi|31559797|ref|NP_853527.1| mannose receptor-like [Mus musculus... 35 0.69
gi|27806407|ref|NP_776606.1| selectin E [endothelial adhesion mo... 35 0.69
gi|17537005|ref|NP_496688.1| predicted CDS, c-type lectin and CU... 35 0.69
gi|20833065|ref|XP_132898.1| similar to killer cell lectin-like ... 35 0.90
gi|50803192|ref|XP_428659.1| PREDICTED: similar to C-type lectin... 35 0.90
gi|34013702|gb|AAQ56014.1| lectin protein type III [Hippocampus ... 35 0.90
gi|17508069|ref|NP_493489.1| c-type lectin family member (1O843)... 35 0.90
gi|39579554|emb|CAE56072.1| Hypothetical protein CBG23650 [Caeno... 35 0.90
gi|47606635|gb|AAT36301.1| puroindoline a mutant [Aegilops biunc... 35 0.90
gi|9507081|ref|NP_062050.1| selectin, lymphocyte [Rattus norvegi... 35 0.90
gi|400181|sp|P30836|LEM1_RAT L-selectin precursor (Lymph node ho... 35 0.90
gi|17567355|ref|NP_508551.1| wnt inhibitory family member (244.8... 35 0.90
gi|1478014|gb|AAB36401.1| ECLV IX/X-bp alpha subunit=coagulation... 35 0.90
gi|38085039|ref|XP_355810.1| similar to dendritic cell immuno-ac... 34 1.2
gi|32469210|dbj|BAC78901.1| C-type lectin [Gymnothorax flavimarg... 34 1.2
gi|17535525|ref|NP_493859.1| c-type lectin and CUB domain contai... 34 1.2
gi|38176036|gb|AAB66231.2| Hypothetical protein R07C3.1 [Caenorh... 34 1.2
gi|8392926|ref|NP_058885.1| asialoglycoprotein receptor 2; rat h... 34 1.2
gi|45580692|ref|NP_987099.1| C-type lectin, superfamily member 7... 34 1.2
gi|31228731|ref|XP_318102.1| ENSANGP00000003548 [Anopheles gambi... 34 1.2
gi|554190|gb|AAA75651.1| lymphocyte homing receptor 34 1.2
gi|17541836|ref|NP_500560.1| c-type lectin precursor family memb... 34 1.2
gi|39588702|emb|CAE58226.1| Hypothetical protein CBG01323 [Caeno... 34 1.2
gi|37181558|gb|AAQ88590.1| CLECSF11 [Homo sapiens] 34 1.2
gi|18466806|ref|NP_569708.1| C-type lectin, superfamily member 7... 34 1.2
gi|32452984|gb|AAC48075.2| Hypothetical protein R08C7.6 [Caenorh... 34 1.2
gi|34870060|ref|XP_341024.1| similar to CD209 antigen; dendritic... 34 1.5
gi|39579486|emb|CAE56876.1| Hypothetical protein CBG24712 [Caeno... 34 1.5
gi|50757054|ref|XP_415365.1| PREDICTED: similar to C-type lectin... 34 1.5
gi|7672290|emb|CAB89541.1| puroindoline-a [Triticum monococcum] ... 34 1.5
gi|13235619|emb|CAC33793.1| puroindoline a [Triticum monococcum] 34 1.5
gi|16923242|gb|AAL29943.1| scarf2a [Girardia tigrina] 34 1.5
gi|48476220|gb|AAT44385.1| REJ3CRD [Strongylocentrotus francisca... 34 1.5
gi|17562694|ref|NP_507835.1| putative protein (5U249) [Caenorhab... 34 1.5
gi|34979184|gb|AAQ83725.1| dendritic cell-associated lectin 2 [H... 34 1.5
gi|16151619|dbj|BAB69891.1| mannose-binding lectin [Halocynthia ... 33 2.0
gi|84258|pir||A23475 G surface protein - Paramecium primaurelia 33 2.0
gi|17557350|ref|NP_506271.1| c-type lectin and CUB domain contai... 33 2.0
gi|120627|sp|P13837|G156_PARPR G surface protein, allelic form 1... 33 2.0
gi|47215901|emb|CAG12293.1| unnamed protein product [Tetraodon n... 33 2.0
gi|547847|sp|Q02988|LECA_PLEWA Lectin precursor >gnl|BL_ORD_ID|8... 33 2.0
gi|120628|sp|P17053|G168_PARPR G surface protein, allelic form 1... 33 2.0
gi|21952495|gb|AAM82594.1| hordoindoline A-12 [Hordeum vulgare] ... 33 2.0
gi|20378937|gb|AAM21049.1| hordoindoline A-9 [Hordeum vulgare] 33 2.0
gi|6981524|ref|NP_037246.1| selectin, platelet; Selectin platele... 33 2.0
gi|39589890|emb|CAE60888.1| Hypothetical protein CBG04603 [Caeno... 33 2.0
gi|47606633|gb|AAT36300.1| puroindoline a mutant [Aegilops colum... 33 2.0
gi|47210804|emb|CAF89796.1| unnamed protein product [Tetraodon n... 33 2.0
gi|17535979|ref|NP_494826.1| phospholipase a2 receptor precursor... 33 2.0
gi|6755454|ref|NP_035476.1| selectin, lymphocyte [Mus musculus] ... 33 2.0
gi|28394504|gb|AAO38235.1| C-type lectin domain [Pseudopleuronec... 33 2.0
gi|50760588|ref|XP_418071.1| PREDICTED: similar to mannose recep... 33 2.6
gi|47230594|emb|CAF99787.1| unnamed protein product [Tetraodon n... 33 2.6
gi|39589889|emb|CAE60887.1| Hypothetical protein CBG04602 [Caeno... 33 2.6
gi|126136|sp|P08290|LECI_RAT Asialoglycoprotein receptor R2/3 (H... 33 2.6
gi|206649|gb|AAA42038.1| asialoglycoprotein receptor (RHL2) 33 2.6
gi|50757074|ref|XP_415370.1| PREDICTED: similar to MHC Rfp-Y cla... 33 2.6
gi|27901450|emb|CAD61336.1| C-type lectin [Gallus gallus] 33 2.6
gi|18997111|gb|AAL83297.1| hordoindoline A-2 [Hordeum vulgare su... 33 2.6
gi|50512699|gb|AAT77680.1| C-type lectin [Chlamys farreri] 33 2.6
gi|47606621|gb|AAT36294.1| puroindoline a mutant [Aegilops kotsc... 33 2.6
>gi|17536817|ref|NP_494567.1| c-type lectin family member (18.2 kD)
(2D811) [Caenorhabditis elegans]
gi|25345652|pir||B88102 protein W09G10.5 [imported] -
Caenorhabditis elegans
gi|2315669|gb|AAB66113.1| Hypothetical protein W09G10.5
[Caenorhabditis elegans]
Length = 168
Score = 358 bits (918), Expect = 4e-98
Identities = 168/168 (100%), Positives = 168/168 (100%)
Frame = +1
Query: 1 MLQKYSIIVLCCSAVLARVPVAKNCPTGWTWFLRSRGGWCMKVFTEALNQPSAEAKCKAA 180
MLQKYSIIVLCCSAVLARVPVAKNCPTGWTWFLRSRGGWCMKVFTEALNQPSAEAKCKAA
Sbjct: 1 MLQKYSIIVLCCSAVLARVPVAKNCPTGWTWFLRSRGGWCMKVFTEALNQPSAEAKCKAA 60
Query: 181 EAVLAGIQNKEEVAWMSKELTGTMWIGTKRTPPCMNSGVTKQCSQITSYYWTDGSTVGVQ 360
EAVLAGIQNKEEVAWMSKELTGTMWIGTKRTPPCMNSGVTKQCSQITSYYWTDGSTVGVQ
Sbjct: 61 EAVLAGIQNKEEVAWMSKELTGTMWIGTKRTPPCMNSGVTKQCSQITSYYWTDGSTVGVQ 120
Query: 361 GFYWNSGEPNNQGGQGCAKLITSSSVLDDVACTTELTNGYVCGKIATF 504
GFYWNSGEPNNQGGQGCAKLITSSSVLDDVACTTELTNGYVCGKIATF
Sbjct: 121 GFYWNSGEPNNQGGQGCAKLITSSSVLDDVACTTELTNGYVCGKIATF 168