Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W07B8_3
(1035 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17565164|ref|NP_503383.1| cysteine PRotease related, cathepsi... 706 0.0
gi|39588506|emb|CAE58029.1| Hypothetical protein CBG01103 [Caeno... 661 0.0
gi|17565162|ref|NP_503382.1| cathepsin B precursor family member... 489 e-137
gi|17559068|ref|NP_504682.1| cysteine PRotease related (36.5 kD)... 464 e-129
gi|39594338|emb|CAE71916.1| Hypothetical protein CBG18978 [Caeno... 456 e-127
gi|39588507|emb|CAE58030.1| Hypothetical protein CBG01104 [Caeno... 454 e-126
gi|39592147|emb|CAE75367.1| Hypothetical protein CBG23351 [Caeno... 382 e-105
gi|17561570|ref|NP_506011.1| cathepsin B family member (5M483) [... 378 e-103
gi|39592139|emb|CAE75359.1| Hypothetical protein CBG23343 [Caeno... 372 e-102
gi|32566081|ref|NP_506002.2| cysteine PRotease related (35.4 kD)... 363 5e-99
gi|7497829|pir||T20148 probable cysteine proteinase (EC 3.4.22.-... 363 5e-99
gi|17565158|ref|NP_503384.1| cathepsin precursor family member (... 351 2e-95
gi|1777779|gb|AAB40605.1| cathepsin B-like cysteine proteinase 345 7e-94
gi|39581137|emb|CAE70994.1| Hypothetical protein CBG17826 [Caeno... 345 1e-93
gi|21392648|gb|AAM51519.1| Cysteine protease related protein 6, ... 344 2e-93
gi|25146613|ref|NP_741818.1| cysteine PRotease related (42.4 kD)... 344 2e-93
gi|14582897|gb|AAK69705.1| procathepsin B [Oncorhynchus mykiss] 343 3e-93
gi|39592833|emb|CAE62447.1| Hypothetical protein CBG06539 [Caeno... 343 4e-93
gi|39579201|emb|CAE56994.1| Hypothetical protein CBG24861 [Caeno... 342 1e-92
gi|39586718|emb|CAE65760.1| Hypothetical protein CBG10849 [Caeno... 338 9e-92
gi|45361295|ref|NP_989225.1| hypothetical protein MGC75969 [Xeno... 337 3e-91
gi|39584563|emb|CAE74641.1| Hypothetical protein CBG22436 [Caeno... 336 6e-91
gi|31872149|gb|AAP59456.1| cathepsin B precursor [Araneus ventri... 335 8e-91
gi|45822203|emb|CAE47498.1| cathepsin B-like proteinase [Diabrot... 333 3e-90
gi|37788265|gb|AAO64472.1| cathepsin B precursor [Fundulus heter... 333 4e-90
gi|41055001|ref|NP_957349.1| similar to cathepsin B [Danio rerio... 333 4e-90
gi|28302291|gb|AAH46667.1| Cg10992-prov protein [Xenopus laevis] 333 5e-90
gi|34979797|gb|AAQ83887.1| cathepsin B [Branchiostoma belcheri t... 333 5e-90
gi|50540542|ref|NP_998501.1| cathepsin B [Danio rerio] >gnl|BL_O... 331 2e-89
gi|27806671|ref|NP_776456.1| cathepsin B [Bos taurus] >gnl|BL_OR... 331 2e-89
gi|1168789|sp|P07688|CATB_BOVIN Cathepsin B precursor 330 2e-89
gi|31209737|ref|XP_313835.1| ENSANGP00000003981 [Anopheles gambi... 330 2e-89
gi|28277314|gb|AAH44689.1| MGC53360 protein [Xenopus laevis] 330 4e-89
gi|6681079|ref|NP_031824.1| cathepsin B preproprotein [Mus muscu... 329 6e-89
gi|50745158|ref|XP_429301.1| PREDICTED: hypothetical protein XP_... 329 6e-89
gi|2982114|pdb|1PBH| Crystal Structure Of Human Recombinant Pro... 328 9e-89
gi|39594884|emb|CAE70752.1| Hypothetical protein CBG17499 [Caeno... 328 9e-89
gi|115711|sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin ... 328 9e-89
gi|4503139|ref|NP_001899.1| cathepsin B preproprotein; APP secre... 328 9e-89
gi|16307393|gb|AAH10240.1| Cathepsin B, preproprotein [Homo sapi... 328 2e-88
gi|30583753|gb|AAP36125.1| Homo sapiens cathepsin B [synthetic c... 328 2e-88
gi|309202|gb|AAA37494.1| mouse preprocathepsin B 327 3e-88
gi|984958|gb|AAC46877.1| cathepsin B-like proteinase 325 1e-87
gi|12018262|ref|NP_072119.1| cathepsin B preproprotein [Rattus n... 325 1e-87
gi|34874087|ref|XP_346478.1| hypothetical protein XP_346477 [Rat... 324 2e-87
gi|25988674|gb|AAN76202.1| lysosomal cysteine proteinase catheps... 324 2e-87
gi|28373366|pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bo... 322 1e-86
gi|9955277|pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine... 321 2e-86
gi|39582887|emb|CAE71663.1| Hypothetical protein CBG18635 [Caeno... 321 2e-86
gi|227293|prf||1701299A cathepsin B 321 2e-86
gi|17559066|ref|NP_506790.1| cysteine PRotease related, cathepsi... 320 3e-86
gi|14141821|gb|AAK07477.2| probable cathepsin B-like cysteine pr... 320 3e-86
gi|46195455|ref|NP_990702.1| cathepsin B [Gallus gallus] >gnl|BL... 320 3e-86
gi|18921171|ref|NP_572920.1| CG10992-PA [Drosophila melanogaster... 320 3e-86
gi|2134308|pir||S58770 cathepsin B (EC 3.4.22.1) precursor - chi... 320 3e-86
gi|1942645|pdb|1MIR|A Chain A, Rat Procathepsin B >gnl|BL_ORD_ID... 320 4e-86
gi|47217183|emb|CAG11019.1| unnamed protein product [Tetraodon n... 319 6e-86
gi|17560488|ref|NP_506310.1| cathepsin precursor family member (... 319 7e-86
gi|25153428|ref|NP_507186.2| predicted CDS, cathepsin B family m... 318 2e-85
gi|203648|gb|AAA40993.1| cathepsin (EC 3.4.22.1) 317 2e-85
gi|24158605|pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipep... 317 3e-85
gi|1127275|pdb|1CTE|A Chain A, Molecule: Cathepsin B; Ec: 3.4.22... 317 4e-85
gi|1311050|pdb|1CPJ|A Chain A, Thiol Protease Mol_id: 1; Molecul... 317 4e-85
gi|7500618|pir||T21856 probable cysteine proteinase (EC 3.4.22.-... 314 2e-84
gi|481614|pir||S38939 probable cathepsin B-like cysteine protein... 314 2e-84
gi|4325188|gb|AAD17297.1| cysteine proteinase [Ancylostoma ceyla... 312 7e-84
gi|50657025|emb|CAH04630.1| cathepsin B [Suberites domuncula] 312 9e-84
gi|21930117|gb|AAM82155.1| cysteine proteinase [Ancylostoma ceyl... 309 6e-83
gi|39588505|emb|CAE58028.1| Hypothetical protein CBG01102 [Caeno... 309 6e-83
gi|984960|gb|AAC46878.1| cathepsin B proteinase 309 8e-83
gi|7537454|gb|AAF35867.2| cathepsin B-like cysteine proteinase [... 307 2e-82
gi|1181143|emb|CAA93278.1| cysteine proteinase [Haemonchus conto... 305 9e-82
gi|5764077|emb|CAB53367.1| necpain [Necator americanus] 305 9e-82
gi|3087801|emb|CAA93277.1| cysteine proteinase [Haemonchus conto... 304 2e-81
gi|29374025|gb|AAO73003.1| cathepsin B [Fasciola gigantica] 304 2e-81
gi|22531387|emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma ... 302 7e-81
gi|18181863|emb|CAC85211.2| cathepsin B endopeptidase [Schistoso... 301 1e-80
gi|13548667|dbj|BAB40804.1| cathepsin B [Bombyx mori] 301 2e-80
gi|1169189|sp|P43157|CYSP_SCHJA Cathepsin B-like cysteine protei... 301 2e-80
gi|22531389|emb|CAD44625.1| cathepsin B1 isotype 2 [Schistosoma ... 301 2e-80
gi|118153|sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine protein... 299 6e-80
gi|118118|sp|P19092|CYS1_HAECO Cathepsin B-like cysteine protein... 296 5e-79
gi|477253|pir||A48454 cathepsin B-like cysteine proteinase (EC 3... 296 7e-79
gi|39582904|emb|CAE71680.1| Hypothetical protein CBG18654 [Caeno... 295 1e-78
gi|39582397|emb|CAE74781.1| Hypothetical protein CBG22612 [Caeno... 294 2e-78
gi|4204370|gb|AAD11445.1| cathepsin B protease [Fasciola hepatica] 294 2e-78
gi|118122|sp|P25793|CYS2_HAECO Cathepsin B-like cysteine protein... 293 4e-78
gi|478099|pir||D48435 cysteine proteinase AC-3 - nematode (Haemo... 291 2e-77
gi|7507648|pir||T24819 hypothetical protein T10H4.12 - Caenorhab... 290 5e-77
gi|30995341|gb|AAO59414.2| cathepsin B endopeptidase [Schistosom... 289 8e-77
gi|1345924|sp|P25802|CYS1_OSTOS Cathepsin B-like cysteine protei... 289 8e-77
gi|38373697|gb|AAR19103.1| cathepsin B [Uronema marinum] 286 7e-76
gi|45822211|emb|CAE47502.1| cathepsin B-like proteinase [Diabrot... 285 9e-76
gi|39582907|emb|CAE71683.1| Hypothetical protein CBG18657 [Caeno... 284 3e-75
gi|345308|pir||S31909 cathepsin B-like cysteine proteinase (EC 3... 282 8e-75
gi|29374027|gb|AAO73004.1| cathepsin B [Fasciola gigantica] 282 1e-74
gi|2944340|gb|AAC05262.1| cathepsin B-like cysteine protease GCP... 281 1e-74
gi|27526823|emb|CAD32937.1| pro-cathepsin B2 [Fasciola hepatica] 281 1e-74
gi|3912916|gb|AAC78691.1| thiol protease [Trichuris suis] 279 7e-74
gi|39592835|emb|CAE62449.1| Hypothetical protein CBG06541 [Caeno... 279 7e-74
gi|478007|pir||C48435 cysteine proteinase AC-4 - nematode (Haemo... 275 9e-73
gi|22535408|emb|CAC87118.1| cathepsin B-like protease [Nilaparva... 275 1e-72
gi|29374023|gb|AAO73002.1| cathepsin B [Fasciola gigantica] 274 2e-72
gi|19526442|gb|AAL89717.1| cathepsin B [Apriona germari] 274 3e-72
gi|44965401|gb|AAS49537.1| cathepsin B [Latimeria chalumnae] 269 9e-71
gi|17384033|emb|CAD12394.1| cysteine proteinase [Leishmania infa... 268 1e-70
gi|12005276|gb|AAG44365.1| cathepsin B-like cysteine protease [L... 268 2e-70
gi|18378947|ref|NP_563648.1| cathepsin B-like cysteine protease,... 267 3e-70
gi|1848229|gb|AAB48119.1| cathepsin B-like protease [Leishmania ... 267 3e-70
gi|12004577|gb|AAG44098.1| cathepsin B cysteine protease [Leishm... 265 1e-69
gi|728602|emb|CAA88490.1| cathepsin B-like enzyme [Leishmania me... 265 1e-69
gi|5031250|gb|AAD38132.1| vitellogenic cathepsin-B like protease... 264 3e-69
gi|31209739|ref|XP_313836.1| ENSANGP00000012227 [Anopheles gambi... 263 6e-69
gi|1008858|gb|AAA79004.1| cathepsin B-like thiol protease 261 2e-68
gi|38639325|gb|AAR25800.1| cathepsin B-like cysteine proteinase ... 261 2e-68
gi|477808|pir||B48435 cysteine proteinase AC-5 - nematode (Haemo... 261 2e-68
gi|48762493|dbj|BAD23816.1| cathepsin B-N [Tuberaphis coreana] 260 4e-68
gi|48762485|dbj|BAD23812.1| cathepsin B-N [Tuberaphis styraci] 260 4e-68
gi|28971815|dbj|BAC65419.1| cathepsin B [Pandalus borealis] 258 2e-67
gi|44965462|gb|AAS49538.1| cathepsin B [Protopterus dolloi] 256 6e-67
gi|3087803|emb|CAA93279.1| cysteine protease [Haemonchus contortus] 255 1e-66
gi|10803437|emb|CAC13131.1| putative cathepsin B.5 [Ostertagia o... 255 1e-66
gi|40643250|emb|CAC83720.1| cathepsin B [Hordeum vulgare subsp. ... 254 2e-66
gi|7435783|pir||T06413 cathepsin B-like cysteine proteinase (EC ... 254 3e-66
gi|609175|emb|CAA57522.1| cathepsin B-like cysteine proteinase [... 253 5e-66
gi|28932700|gb|AAO60044.1| midgut cysteine proteinase 1 [Rhipice... 253 5e-66
gi|18411686|ref|NP_567215.1| cathepsin B-like cysteine protease,... 252 9e-66
gi|44968648|gb|AAS49594.1| cathepsin B [Scyliorhinus canicula] 252 1e-65
gi|2129942|pir||S60479 cathepsin B-like cysteine proteinase (EC ... 251 2e-65
gi|14582576|gb|AAK69541.1| cathepsin B-like cysteine proteinase ... 251 2e-65
gi|48762476|dbj|BAD23809.1| cathepsin B-S [Tuberaphis styraci] 250 4e-65
gi|6165885|gb|AAF04727.1| cathepsin B-like cysteine proteinase [... 249 9e-65
gi|999909|pdb|1HUC|B Chain B, Cathepsin B (E.C.3.4.22.1) >gnl|BL... 248 2e-64
gi|30678927|ref|NP_849281.1| cathepsin B-like cysteine protease,... 247 4e-64
gi|181178|gb|AAA52125.1| lysosomal proteinase cathepsin B 247 4e-64
gi|3087799|emb|CAA93276.1| cysteine proteinase [Haemonchus conto... 246 5e-64
gi|3088522|gb|AAD03404.1| cathepsin B-like protease precursor [T... 246 8e-64
gi|48425700|pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In C... 244 2e-63
gi|2317912|gb|AAC24376.1| cathepsin B-like cysteine proteinase [... 244 2e-63
gi|1644295|emb|CAB03627.1| cysteine proteinase [Haemonchus conto... 243 4e-63
gi|7435782|pir||T06466 cathepsin B-like cysteine proteinase (EC ... 243 5e-63
gi|3087797|emb|CAA93275.1| cysteine proteinase [Haemonchus conto... 243 7e-63
gi|3929733|emb|CAA77178.1| cathepsin B [Homo sapiens] 242 9e-63
gi|3929817|emb|CAA77181.1| cathepsin B [Mus musculus] 242 9e-63
gi|48762491|dbj|BAD23815.1| cathepsin B-S [Tuberaphis coreana] 237 4e-61
gi|18378945|ref|NP_563647.1| cathepsin B-like cysteine protease,... 236 5e-61
gi|31209729|ref|XP_313831.1| ENSANGP00000012222 [Anopheles gambi... 231 3e-59
gi|10803443|emb|CAC13134.1| putative cathepsin B.8 [Ostertagia o... 230 3e-59
gi|21700775|gb|AAL60053.1| cysteine proteinase [Toxoplasma gondii] 226 9e-58
gi|10803452|emb|CAB97365.2| putative cathepsin B.2 [Ostertagia o... 224 3e-57
gi|40557577|gb|AAR88085.1| cathepsin B-like cysteine protease [T... 224 3e-57
gi|508264|gb|AAA96833.1| cysteine protease 220 5e-56
gi|29840882|gb|AAP05883.1| similar to GenBank Accession Number X... 209 6e-53
gi|21695|emb|CAA46812.1| cathepsin B [Triticum aestivum] 208 2e-52
gi|15723276|gb|AAL06326.1| cathepsin B-like protease [Trypanosom... 204 2e-51
gi|10803441|emb|CAC13133.1| putative cathepsin B.7 [Ostertagia o... 204 3e-51
gi|15723280|gb|AAL06328.1| cathepsin B-like protease [Trypanosom... 204 3e-51
gi|10803454|emb|CAB97366.2| putative cathepsin B.3 [Ostertagia o... 203 6e-51
gi|15723274|gb|AAL06325.1| cathepsin B-like protease [Trypanosom... 202 1e-50
gi|38074689|ref|XP_140905.2| similar to Cathepsin B precursor (C... 199 9e-50
gi|28974200|gb|AAO61484.1| cathepsin B [Sterkiella histriomuscorum] 198 2e-49
gi|15723272|gb|AAL06324.1| cathepsin B-like protease [Trypanosom... 198 2e-49
gi|10803450|emb|CAB97364.2| putative cathepsin B.1 [Ostertagia o... 197 3e-49
gi|15150360|gb|AAK85411.1| cathepsin B-like protease [Trypanosom... 197 3e-49
gi|729283|sp|Q06544|CYS3_OSTOS Cathepsin B-like cysteine protein... 195 2e-48
gi|10803439|emb|CAC13132.1| putative cathepsin B.6 [Ostertagia o... 192 8e-48
gi|13469701|gb|AAK27318.1| cysteine proteinase [Clonorchis sinen... 184 3e-45
gi|10803435|emb|CAC13130.1| putative cathepsin B.4 [Ostertagia o... 184 4e-45
gi|4099305|gb|AAD00577.1| cysteine proteinase [Clonorchis sinensis] 182 1e-44
gi|603044|gb|AAA96832.1| cysteine protease homolog 181 2e-44
gi|29249541|gb|EAA41050.1| GLP_447_16146_15244 [Giardia lamblia ... 180 4e-44
gi|32129434|sp|P92132|CAL2_GIALA Cathepsin B-like CP2 precursor ... 178 2e-43
gi|496968|gb|AAA96831.1| cysteine protease homologue 177 3e-43
gi|32129435|sp|P92133|CAL3_GIALA Cathepsin B-like CP3 precursor ... 177 3e-43
gi|39592834|emb|CAE62448.1| Hypothetical protein CBG06540 [Caeno... 176 1e-42
gi|17510377|ref|NP_490763.1| cathepsin B family member (48.2 kD)... 176 1e-42
gi|12330246|gb|AAG52660.1| cysteine proteinase [Metagonimus yoko... 176 1e-42
gi|12658201|gb|AAK01061.1| cysteine proteinase [Metagonimus yoko... 174 2e-42
gi|39585894|emb|CAE61308.1| Hypothetical protein CBG05143 [Caeno... 174 4e-42
gi|39595196|emb|CAE60233.1| Hypothetical protein CBG03805 [Caeno... 172 9e-42
gi|29245813|gb|EAA37433.1| GLP_442_4888_3992 [Giardia lamblia AT... 172 9e-42
gi|552159|gb|AAA29434.1| cathepsin B-like cysteine protease 172 1e-41
gi|39581138|emb|CAE70995.1| Hypothetical protein CBG17827 [Caeno... 172 1e-41
gi|552158|gb|AAA29433.1| cathepsin B-like cysteine protease 172 1e-41
gi|17506871|ref|NP_492593.1| tubulointerstitial nephritis antige... 171 3e-41
gi|741376|prf||2007265A cathepsin B 169 1e-40
gi|312266|emb|CAA51531.1| cathepsin B-like enzyme [Gallus gallus] 168 2e-40
gi|6562772|emb|CAB62590.1| putative cathepsin B-like protease [P... 167 3e-40
gi|12330244|gb|AAG52659.1| cysteine proteinase [Metagonimus yoko... 164 3e-39
gi|162813|gb|AAA30434.1| cathepsin B 157 4e-37
gi|39581140|emb|CAE70997.1| Hypothetical protein CBG17829 [Caeno... 155 1e-36
gi|29248841|gb|EAA40365.1| GLP_567_6496_7413 [Giardia lamblia AT... 154 4e-36
gi|29245436|gb|EAA37074.1| GLP_113_4299_5381 [Giardia lamblia AT... 150 5e-35
gi|16758354|ref|NP_446034.1| lipocalin 7; glucocorticoid-inducib... 150 5e-35
gi|13543125|gb|AAH05738.1| Lcn7 protein [Mus musculus] >gnl|BL_O... 150 6e-35
gi|12963691|ref|NP_075965.1| lipocalin 7; androgen-regulated gen... 150 6e-35
gi|48762481|dbj|BAD23810.1| cathepsin B-S [Tuberaphis taiwana] 150 6e-35
gi|16768502|gb|AAL28470.1| GM06507p [Drosophila melanogaster] 149 1e-34
gi|24657813|ref|NP_726176.1| CG3074-PA [Drosophila melanogaster]... 148 2e-34
gi|2330009|gb|AAB66719.1| cysteine protease [Giardia muris] 147 4e-34
gi|11545918|ref|NP_071447.1| P3ECSL; glucocorticoid-inducible pr... 147 4e-34
gi|12958837|gb|AAK09441.1| cathepsin b-like precursor protein [A... 147 4e-34
gi|50744850|ref|XP_419905.1| PREDICTED: similar to tubulointerst... 145 2e-33
gi|29248113|gb|EAA39655.1| GLP_217_11853_10927 [Giardia lamblia ... 144 3e-33
gi|32129433|sp|P92131|CAL1_GIALA Cathepsin B-like CP1 precursor ... 143 6e-33
gi|29246290|gb|EAA37893.1| GLP_449_32565_31567 [Giardia lamblia ... 142 1e-32
gi|29248531|gb|EAA40062.1| GLP_162_1114_2025 [Giardia lamblia AT... 142 2e-32
gi|11691656|emb|CAC18646.1| cathepsin B-like protease 1 [Giardia... 142 2e-32
gi|1763659|gb|AAB58258.1| cysteine protease [Giardia intestinalis] 142 2e-32
gi|47271446|ref|NP_055279.2| tubulointerstitial nephritis antige... 141 2e-32
gi|11360328|pir||JC7189 tubulointerstitial nephritis antigen - h... 141 3e-32
gi|47212965|emb|CAF93376.1| unnamed protein product [Tetraodon n... 141 3e-32
gi|47550737|ref|NP_999887.1| cathepsin C; ik:tdsubc_1h2 [Danio r... 140 6e-32
gi|22653678|sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precurso... 140 6e-32
gi|1584943|prf||2123443A cathepsin C 140 6e-32
gi|30038325|dbj|BAC75711.1| cathepsin C [Bos taurus] 138 2e-31
gi|33417162|gb|AAH56109.1| Ctsc-prov protein [Xenopus laevis] 138 2e-31
gi|4929827|gb|AAD34171.1| tubulo-interstitial nephritis antigen ... 138 2e-31
gi|31981314|ref|NP_036163.2| tubulointerstitial nephritis antige... 138 2e-31
gi|1582221|prf||2118248A prepro-cathepsin C 137 3e-31
gi|17933069|gb|AAL48191.1| cathepsin C [Homo sapiens] 137 3e-31
gi|4503141|ref|NP_001805.1| cathepsin C isoform a preproprotein;... 137 3e-31
gi|17933071|gb|AAL48192.1| cathepsin C [Homo sapiens] 137 4e-31
gi|33327024|gb|AAQ08887.1| cathepsin C [Homo sapiens] 137 4e-31
gi|2499875|sp|Q26563|CATC_SCHMA Cathepsin C precursor >gnl|BL_OR... 137 4e-31
gi|34098755|sp|Q9UJW2|TNAG_HUMAN Tubulointerstitial nephritis an... 137 5e-31
gi|2599293|gb|AAC32040.1| preprocathepsin C [Schistosoma japonicum] 137 5e-31
gi|34864376|ref|XP_236424.2| similar to tubulo-interstitial neph... 135 2e-30
gi|45708820|gb|AAH67941.1| LOC407938 protein [Xenopus tropicalis] 134 3e-30
gi|3023454|sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor... 134 3e-30
gi|31560607|ref|NP_034112.2| cathepsin C preproprotein; dipeptid... 134 3e-30
gi|38048307|gb|AAR10056.1| similar to Drosophila melanogaster CG... 134 4e-30
gi|17933077|gb|AAL48195.1| cathepsin C [Homo sapiens] 133 6e-30
gi|8393218|ref|NP_058793.1| cathepsin C; Cathepsin C (dipeptidyl... 133 6e-30
gi|115716|sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (D... 133 6e-30
gi|24987409|pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsi... 133 6e-30
gi|48762489|dbj|BAD23814.1| cathepsin B-N [Tuberaphis takenouchii] 133 8e-30
gi|1363085|pir||A57480 tubulointerstitial nephritis antigen prec... 133 8e-30
gi|37905530|gb|AAO64478.1| cathepsin C precursor [Fundulus heter... 128 2e-28
gi|1763661|gb|AAB58259.1| cysteine protease [Giardia intestinalis] 128 2e-28
gi|31198479|ref|XP_308187.1| ENSANGP00000020785 [Anopheles gambi... 128 2e-28
gi|50731191|ref|XP_417207.1| PREDICTED: similar to Dipeptidyl-pe... 127 4e-28
gi|48762483|dbj|BAD23811.1| cathepsin B-S [Tuberaphis takenouchii] 126 7e-28
gi|159950|gb|AAA29435.1| cathepsin B-like cysteine protease 126 7e-28
gi|48762487|dbj|BAD23813.1| cathepsin B-N [Tuberaphis taiwana] 125 1e-27
gi|28804799|dbj|BAC57943.1| cathepsin C [Marsupenaeus japonicus] 122 1e-26
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno... 121 2e-26
gi|38639319|gb|AAR25797.1| cathepsin B-like cysteine proteinase ... 120 4e-26
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 119 9e-26
gi|48126064|ref|XP_393283.1| similar to GM06507p [Apis mellifera] 119 9e-26
gi|12832450|dbj|BAB22112.1| unnamed protein product [Mus musculus] 115 1e-24
gi|6562770|emb|CAB62589.1| putative cathepsin B-like protease [P... 115 2e-24
gi|6562768|emb|CAB62588.1| putative cathepsin B-like protease [P... 115 2e-24
gi|17569349|ref|NP_509408.1| cysteine proteinase AALP (43.7 kD) ... 114 4e-24
gi|29247428|gb|EAA38990.1| GLP_542_3431_1206 [Giardia lamblia AT... 112 1e-23
gi|29249287|gb|EAA40802.1| GLP_29_33036_32140 [Giardia lamblia A... 111 2e-23
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 111 3e-23
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 111 3e-23
gi|3650498|gb|AAC61477.1| cathepsin X precursor [Homo sapiens] 109 1e-22
gi|3719219|gb|AAC63141.1| preprocathepsin P [Homo sapiens] 108 2e-22
gi|22538442|ref|NP_001327.2| cathepsin Z preproprotein; cathepsi... 108 2e-22
gi|3294548|gb|AAC39839.1| cathepsin Z precursor; CTSZ [Homo sapi... 108 2e-22
gi|7245728|pdb|1DEU|A Chain A, Crystal Structure Of Human Procat... 108 2e-22
gi|7546545|pdb|1EF7|A Chain A, Crystal Structure Of Human Cathep... 108 2e-22
gi|452268|emb|CAA80451.1| cathepsin B-like protease [Fasciola he... 108 2e-22
gi|46948158|gb|AAT07061.1| cathepsin Z-like cysteine proteinase ... 108 3e-22
gi|14349351|gb|AAC38832.2| cysteine protease [Leishmania donovan... 108 3e-22
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 107 4e-22
gi|7494569|pir||T37284 cysteine proteinase (EC 3.4.22.-) - Caeno... 107 6e-22
gi|14290553|gb|AAH09048.1| LCN7 protein [Homo sapiens] 107 6e-22
gi|14042811|dbj|BAB55403.1| unnamed protein product [Homo sapiens] 107 6e-22
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica] 107 6e-22
gi|34328540|ref|NP_899159.1| cathepsin Y [Rattus norvegicus] >gn... 106 1e-21
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica] 105 1e-21
gi|37788267|gb|AAO64473.1| cathepsin H precursor [Fundulus heter... 105 1e-21
gi|9635308|ref|NP_059206.1| ORF58 [Xestia c-nigrum granulovirus]... 105 1e-21
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 105 2e-21
gi|47227517|emb|CAG04665.1| unnamed protein product [Tetraodon n... 105 2e-21
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 105 2e-21
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath... 105 2e-21
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 105 2e-21
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 105 2e-21
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 105 2e-21
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 104 3e-21
gi|9630063|ref|NP_046281.1| cathepsin [Orgyia pseudotsugata mult... 104 3e-21
gi|11968166|ref|NP_071720.1| cathepsin Z preproprotein; cathepsi... 104 3e-21
gi|478768|pir||S29245 cysteine proteinase (EC 3.4.22.-) precurso... 104 3e-21
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 104 4e-21
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 104 4e-21
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 103 5e-21
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov... 103 5e-21
gi|39584558|emb|CAE74636.1| Hypothetical protein CBG22431 [Caeno... 103 5e-21
gi|18402225|ref|NP_566633.1| cysteine proteinase, putative / thi... 103 5e-21
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 103 5e-21
gi|1730100|sp|P36400|LCPB_LEIME Cysteine proteinase B precursor ... 103 5e-21
gi|11066226|gb|AAG28507.1| cathepsin Z [Mus musculus] 103 6e-21
gi|452264|emb|CAA80449.1| cathepsin B-like protease [Fasciola he... 103 6e-21
gi|14348750|emb|CAC41275.1| CPB2 protein [Leishmania mexicana] 103 6e-21
gi|11863537|emb|CAC18798.1| cathepsin Z [Cricetulus griseus] 103 6e-21
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 103 8e-21
gi|50758927|ref|XP_417483.1| PREDICTED: similar to cathepsin Y [... 103 8e-21
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 103 8e-21
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 103 8e-21
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 102 1e-20
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 102 1e-20
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 102 1e-20
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 102 1e-20
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 102 1e-20
gi|34809309|gb|AAQ82649.1| cysteine protease [Tritrichomonas foe... 102 1e-20
gi|15824691|gb|AAL09443.1| cysteine protease [Leishmania donovani] 102 1e-20
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 102 1e-20
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 102 1e-20
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 102 1e-20
gi|1749812|emb|CAA90237.1| cysteine proteinase LmCPB1 [Leishmani... 102 1e-20
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 102 1e-20
gi|29150712|gb|AAO64444.1| cathepsin Z-like cysteine proteinase ... 102 1e-20
gi|39588844|emb|CAE69474.1| Hypothetical protein CBG15672 [Caeno... 102 1e-20
gi|4809232|gb|AAD30154.1| cathepsin Z1 preproprotein [Toxocara c... 102 2e-20
gi|39581574|emb|CAE58359.1| Hypothetical protein CBG01480 [Caeno... 102 2e-20
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 102 2e-20
gi|10441624|gb|AAG17127.1| cathepsin L-like cysteine proteinase ... 102 2e-20
gi|15320768|ref|NP_203280.1| V-CATH [Epiphyas postvittana nucleo... 102 2e-20
gi|2780176|emb|CAA71085.1| cystein proteinase [Leishmania mexicana] 102 2e-20
gi|29708|emb|CAA30428.1| cathepsin H [Homo sapiens] 101 2e-20
gi|15419587|gb|AAK97078.1| encystation-specific protease [Giardi... 101 2e-20
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 101 2e-20
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 101 2e-20
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 101 2e-20
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 101 3e-20
gi|1141743|gb|AAB04162.1| putative cysteine proteinase 101 3e-20
gi|33333708|gb|AAQ11972.1| putative gut cathepsin L-like cystein... 100 4e-20
gi|33333696|gb|AAQ11966.1| putative gut cathepsin L-like cystein... 100 4e-20
gi|50657031|emb|CAH04633.1| cathepsin X/O [Suberites domuncula] 100 4e-20
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b... 100 4e-20
gi|10336513|dbj|BAB13759.1| cysteine proteinase [Astragalus sini... 100 4e-20
gi|1680720|gb|AAC47348.1| cysteine protease precursor [Onchocerc... 100 4e-20
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 100 4e-20
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 100 4e-20
gi|29245258|gb|EAA36907.1| GLP_41_8294_9919 [Giardia lamblia ATC... 100 5e-20
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 100 5e-20
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 100 5e-20
gi|81542|pir||S02728 actinidain (EC 3.4.22.14) precursor (clone ... 100 5e-20
gi|23344736|gb|AAN28681.1| cathepsin B [Theromyzon tessulatum] 100 7e-20
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 100 7e-20
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 100 7e-20
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 100 7e-20
gi|39592995|emb|CAE62609.1| Hypothetical protein CBG06727 [Caeno... 100 7e-20
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa] 100 7e-20
gi|7489849|pir||T10518 fruit bromelain (EC 3.4.22.33) FB1035 pre... 100 7e-20
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica] 100 9e-20
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 100 9e-20
gi|1809288|gb|AAC47721.1| secreted cathepsin L 2 [Fasciola hepat... 100 9e-20
gi|12744965|gb|AAK06862.1| actinidin protease [Actinidia chinensis] 100 9e-20
gi|7489850|pir||T10516 fruit bromelain (EC 3.4.22.33) FB22 precu... 100 9e-20
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde... 100 9e-20
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 100 9e-20
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 100 9e-20
gi|42744610|gb|AAH66625.1| Zgc:66267 protein [Danio rerio] 99 1e-19
gi|41055337|ref|NP_956720.1| hypothetical protein MGC66267 [Dani... 99 1e-19
gi|46561115|gb|AAT00789.1| cathepsin Z precursor [Onchocerca vol... 99 1e-19
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays] 99 1e-19
gi|2144501|pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi ... 99 2e-19
gi|34146988|gb|AAB65956.2| Hypothetical protein F41E6.6 [Caenorh... 99 2e-19
gi|2351107|dbj|BAA21929.1| bromelain [Ananas comosus] 99 2e-19
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 99 2e-19
gi|7435827|pir||T10501 fruit bromelain (EC 3.4.22.33) FB13 precu... 99 2e-19
gi|442619|pdb|1AEC| Actinidin (E.C.3.4.22.14) Complex With The ... 99 2e-19
gi|454890|emb|CAA54438.1| cysteine proteinase, putative [Trichom... 98 3e-19
gi|37907340|gb|AAO64476.1| cathepsin Z precursor [Fundulus heter... 98 3e-19
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr... 98 3e-19
gi|30387350|ref|NP_848429.1| cathepsin [Choristoneura fumiferana... 98 3e-19
gi|14276828|gb|AAK58415.1| cysteine protease precursor [Blomia t... 98 3e-19
gi|17562680|ref|NP_506318.1| cathepsin Z precursor (53.2 kD) (5N... 98 3e-19
gi|24654434|ref|NP_725686.1| CG4847-PD [Drosophila melanogaster]... 98 4e-19
gi|7435828|pir||T10503 fruit bromelain (EC 3.4.22.33) FB18 precu... 98 4e-19
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo... 98 4e-19
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 98 4e-19
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 98 4e-19
gi|12597541|ref|NP_075125.1| cathepsin [Heliocoverpa armigera nu... 98 4e-19
gi|19922450|ref|NP_611221.1| CG4847-PA [Drosophila melanogaster]... 98 4e-19
gi|37963625|gb|AAP94048.2| cathepsin-L-like midgut cysteine prot... 97 5e-19
gi|203341|gb|AAA63484.1| cathepsin H 97 5e-19
gi|10798509|emb|CAC12805.1| procathepsin L3 [Fasciola hepatica] 97 5e-19
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 97 5e-19
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 97 5e-19
gi|14602252|ref|NP_148795.1| ORF11 cathepsin [Cydia pomonella gr... 97 5e-19
gi|39595452|emb|CAE60490.1| Hypothetical protein CBG04105 [Caeno... 97 5e-19
gi|44844204|emb|CAF32698.1| cysteine proteinase [Leishmania infa... 97 5e-19
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 97 6e-19
gi|47939805|gb|AAH72275.1| MGC82409 protein [Xenopus laevis] 97 6e-19
gi|17566486|ref|NP_507904.1| cathepsin H family member (5U698) [... 97 6e-19
gi|230417|pdb|2ACT| Actinidin (Sulfhydryl Proteinase) (E.C. Num... 97 6e-19
gi|37780049|gb|AAP32197.1| cysteine protease 10 [Trifolium repens] 97 8e-19
gi|37077647|sp|Q91CL9|CATV_NPVAP Viral cathepsin (V-cath) (Cyste... 97 8e-19
gi|19747207|gb|AAL96762.1| Tcc1l8.8 [Trypanosoma cruzi] 97 8e-19
gi|577617|gb|AAC37213.1| cysteine proteinase 97 8e-19
gi|16506723|gb|AAL23917.1| cathepsin L [Fasciola gigantica] 96 1e-18
gi|113285|sp|P00785|ACTN_ACTCH Actinidain precursor (Actinidin) ... 96 1e-18
gi|17560860|ref|NP_505215.1| cysteine proteinase PWCP1 precursor... 96 1e-18
gi|47222865|emb|CAF96532.1| unnamed protein product [Tetraodon n... 96 1e-18
gi|33873837|gb|AAH25419.1| Unknown (protein for IMAGE:3929674) [... 96 1e-18
gi|18138384|ref|NP_542680.1| cathepsin [Helicoverpa zea single n... 96 1e-18
gi|29246183|gb|EAA37790.1| GLP_549_24108_24914 [Giardia lamblia ... 96 1e-18
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota] 96 1e-18
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 96 1e-18
gi|23480960|gb|EAA17381.1| cathepsin c precursor [Plasmodium yoe... 96 2e-18
gi|37780043|gb|AAP32194.1| cysteine protease 1 [Trifolium repens] 95 2e-18
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 95 2e-18
gi|47270758|gb|AAB54210.2| Cathepsin z protein 1 [Caenorhabditis... 95 2e-18
gi|17507081|ref|NP_491023.1| cathepsin Z (1D256) [Caenorhabditis... 95 2e-18
gi|8468607|gb|AAF75547.1| cruzipain [Trypanosoma cruzi] 95 2e-18
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota] 95 3e-18
gi|15617524|ref|NP_258322.1| cathepsin-like cysteine proteinase ... 95 3e-18
gi|6449324|gb|AAF08932.1| tubulointerstitial nephritis antigen i... 95 3e-18
gi|2351557|gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] 95 3e-18
gi|118157|sp|P25779|CYSP_TRYCR Cruzipain precursor (Major cystei... 94 4e-18
gi|11464864|gb|AAG35357.1| cruzipain [Trypanosoma cruzi] 94 4e-18
gi|2624670|pdb|1AIM| Cruzain Inhibited By Benzoyl-Tyrosine-Alan... 94 4e-18
gi|2624650|pdb|2AIM| Cruzain Inhibited With Benzoyl-Arginine-Al... 94 5e-18
gi|18408616|ref|NP_566901.1| cysteine proteinase, putative [Arab... 94 7e-18
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens] 94 7e-18
gi|38683695|gb|AAR26872.1| FirrV-1-A48 precursor [Feldmannia irr... 94 7e-18
gi|27372529|gb|AAO03565.1| cysteine protease 8 [Entamoeba histol... 94 7e-18
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag... 93 1e-17
gi|7435824|pir||T07851 ananain (EC 3.4.22.31) precursor AN11 - p... 93 1e-17
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 93 1e-17
gi|945081|gb|AAC49361.1| P21 93 1e-17
gi|323055|pir||A45629 cysteine proteinase cruzipain (EC 3.4.22.-... 93 1e-17
gi|118155|sp|P22497|CYSP_THEPA Cysteine proteinase precursor >gn... 92 1e-17
gi|161879|gb|AAA98600.1| cathepsin L-like cysteine protease 92 1e-17
gi|1581746|prf||2117247B Cys protease:ISOTYPE=2 92 1e-17
gi|1136308|gb|AAB41119.1| cruzipain 92 1e-17
gi|8468605|gb|AAF75546.1| cruzipain [Trypanosoma cruzi] 92 2e-17
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n... 92 2e-17
gi|5081735|gb|AAD39513.1| cathepsin L-like protease precursor [A... 92 2e-17
gi|11875976|emb|CAC18865.1| cysteine protease [Leishmania major] 92 2e-17
gi|7435822|pir||T07840 ananain (EC 3.4.22.31) AN8 precursor - pi... 92 2e-17
gi|13124026|sp|Q9WGE0|CATV_NPVHC Viral cathepsin (V-cath) (Cyste... 92 2e-17
gi|37651368|ref|NP_932731.1| cathepsin [Choristoneura fumiferana... 92 2e-17
gi|23577865|ref|NP_703114.1| viral cathepsin [Rachiplusia ou mul... 92 2e-17
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [... 92 3e-17
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho... 92 3e-17
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ... 92 3e-17
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0... 92 3e-17
gi|9627870|ref|NP_054157.1| viral cathepsin-like protein [Autogr... 92 3e-17
gi|4902840|emb|CAB43538.1| cysteine proteinase A [Leishmania major] 91 3e-17
gi|13432122|sp|P80884|ANAN_ANACO Ananain precursor >gnl|BL_ORD_I... 91 3e-17
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]... 91 3e-17
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]... 91 3e-17
gi|30141021|dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus] 91 3e-17
gi|1085687|pir||S53027 cathepsin L (EC 3.4.22.15) precursor - pe... 91 4e-17
gi|1834307|dbj|BAA09820.1| cysteine proteinase [Spirometra erina... 91 4e-17
gi|1581745|prf||2117247A Cys protease:ISOTYPE=1 91 6e-17
gi|1581747|prf||2117247C Cys protease:ISOTYPE=3 91 6e-17
gi|945054|gb|AAA74445.1| cathepsin B-like protease 91 6e-17
gi|20147096|gb|AAM09951.1| 49 kDa cysteine proteinase Cysp1 [Cry... 91 6e-17
gi|15128493|dbj|BAB62718.1| plerocercoid growth factor/cysteine ... 90 7e-17
gi|1666270|emb|CAA49713.1| envelope glycoprotein [Autographa cal... 90 7e-17
gi|2765358|emb|CAA74241.1| cathepsin L [Litopenaeus vannamei] 90 7e-17
gi|4972585|gb|AAD34707.1| cysteine proteinase [Paragonimus weste... 90 1e-16
gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 0... 90 1e-16
gi|30142040|gb|AAN34825.1| cysteine proteinase [Leishmania mexic... 90 1e-16
gi|1706259|sp|P35591|CYS1_LEIPI Cysteine proteinase 1 precursor ... 89 1e-16
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori] 89 1e-16
gi|1093503|prf||2104214A Cys protease 89 1e-16
gi|1483570|emb|CAA68066.1| cathepsin l [Litopenaeus vannamei] 89 1e-16
gi|37655265|gb|AAQ96835.1| cysteine proteinase [Glycine max] 89 1e-16
gi|37905511|gb|AAO64477.1| cathepsin S precursor [Fundulus heter... 89 2e-16
gi|126021|sp|P25775|LCPA_LEIME Cysteine proteinase A precursor >... 89 2e-16
gi|1498185|dbj|BAA06738.1| cysteine proteinase-1 precursor [Dros... 89 2e-16
gi|2146900|pir||S67481 cathepsin L-like cysteine proteinase (EC ... 89 2e-16
gi|30575714|gb|AAP33049.1| cysteine proteinase 1 [Clonorchis sin... 88 3e-16
gi|17384029|emb|CAD12392.1| cysteine proteinase [Leishmania infa... 88 3e-16
gi|47230018|emb|CAG10432.1| unnamed protein product [Tetraodon n... 88 3e-16
gi|25289998|pir||JC7787 carrot seed cysteine proteinase (EC 3.4.... 88 3e-16
gi|33622213|ref|NP_891858.1| cathepsin [Cryptophlebia leucotreta... 88 4e-16
gi|38014481|gb|AAH60424.1| MGC68723 protein [Xenopus laevis] 88 4e-16
gi|1353726|gb|AAB01769.1| cysteine proteinase homolog 88 4e-16
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab... 87 5e-16
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec... 87 5e-16
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab... 87 5e-16
gi|1272388|gb|AAB17051.1| cysteine protease 87 5e-16
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist... 87 8e-16
gi|4557501|ref|NP_001325.1| cathepsin O preproprotein [Homo sapi... 86 1e-15
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice... 86 1e-15
gi|9631045|ref|NP_047715.1| cathepsin-like proteinase [Lymantria... 86 1e-15
gi|13242547|ref|NP_077560.1| EsV-1-75 [Ectocarpus siliculosus vi... 86 1e-15
gi|38346003|emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa (japon... 86 2e-15
gi|6467382|gb|AAF13146.1| cathepsin F precursor [Homo sapiens] 85 2e-15
gi|6630972|gb|AAF19630.1| cysteine proteinase precursor [Myxine ... 85 2e-15
gi|23508365|ref|NP_701034.1| hypothetical protein [Plasmodium fa... 85 2e-15
gi|6650705|gb|AAF21977.1| thiolproteinase SmTP1 [Sarcocystis muris] 85 3e-15
gi|11265612|pir||T47471 cysteine proteinase (EC 3.4.22.-) F18N11... 84 5e-15
gi|13124011|sp|Q9YWK4|CATV_NPVBS Viral cathepsin (V-cath) (Cyste... 84 5e-15
gi|18401420|ref|NP_565649.1| cysteine proteinase, putative [Arab... 84 7e-15
gi|1345573|emb|CAA40073.1| endopeptidase (EP-C1) [Phaseolus vulg... 84 7e-15
gi|7435774|pir||S22502 cysteine proteinase (EC 3.4.22.-) - kidne... 84 7e-15
gi|544129|sp|P25803|CYSP_PHAVU Vignain precursor (Bean endopepti... 84 7e-15
gi|50753298|ref|XP_413946.1| PREDICTED: similar to RASGRF1 prote... 83 9e-15
gi|19880041|gb|AAM00234.1| cathepsin B-like cysteine proteinase ... 83 9e-15
>gi|17565164|ref|NP_503383.1| cysteine PRotease related, cathepsin
B-like (37.4 kD) (cpr-5) [Caenorhabditis elegans]
gi|1169086|sp|P43509|CPR5_CAEEL Cathepsin B-like cysteine proteinase
5 precursor (Cysteine protease related 5)
gi|7511543|pir||T37277 probable cathepsin B (EC 3.4.22.1) cpr-5 -
Caenorhabditis elegans
gi|671713|gb|AAA98786.1| cathepsin B-like cysteine proteinase
[Caenorhabditis elegans]
gi|675502|gb|AAA98784.1| cathepsin B-like cysteine proteinase
gi|2291226|gb|AAB65346.1| Hypothetical protein W07B8.5
[Caenorhabditis elegans]
Length = 344
Score = 706 bits (1822), Expect = 0.0
Identities = 330/344 (95%), Positives = 330/344 (95%)
Frame = -1
Query: 1035 MWKXXXXXXXXXXXXXXIPGHREAPALTGQALIDYVNSAQKLWTAGHQVIPKEKITKKLM 856
MWK IPGHREAPALTGQALIDYVNSAQKLWTAGHQVIPKEKITKKLM
Sbjct: 1 MWKLSAILLVAAASAVVIPGHREAPALTGQALIDYVNSAQKLWTAGHQVIPKEKITKKLM 60
Query: 855 DVKYLVPHKDEDIVATEVSDAIPDHFDARDQWPNCMSINNIRDQSDCGSCWAFAAAEAIS 676
DVKYLVPHKDEDIVATEVSDAIPDHFDARDQWPNCMSINNIRDQSDCGSCWAFAAAEAIS
Sbjct: 61 DVKYLVPHKDEDIVATEVSDAIPDHFDARDQWPNCMSINNIRDQSDCGSCWAFAAAEAIS 120
Query: 675 DRTCIASNGAVNTLLSSEDLLSCCTGMFSCGNGCEGGYPIQAWKWWVKHGLVTGGSYETQ 496
DRTCIASNGAVNTLLSSEDLLSCCTGMFSCGNGCEGGYPIQAWKWWVKHGLVTGGSYETQ
Sbjct: 121 DRTCIASNGAVNTLLSSEDLLSCCTGMFSCGNGCEGGYPIQAWKWWVKHGLVTGGSYETQ 180
Query: 495 FGCKPYSIAPCGETVNGVKWPACPEDTEPTPKCVDSCTSKNNYATPYLQDKHFGSTAYAV 316
FGCKPYSIAPCGETVNGVKWPACPEDTEPTPKCVDSCTSKNNYATPYLQDKHFGSTAYAV
Sbjct: 181 FGCKPYSIAPCGETVNGVKWPACPEDTEPTPKCVDSCTSKNNYATPYLQDKHFGSTAYAV 240
Query: 315 GKKVEQIQTEILTNGPIEVAFTVYEDFYQYTTGVYVHTAGASLGGHAVKILGWGVDNGTP 136
GKKVEQIQTEILTNGPIEVAFTVYEDFYQYTTGVYVHTAGASLGGHAVKILGWGVDNGTP
Sbjct: 241 GKKVEQIQTEILTNGPIEVAFTVYEDFYQYTTGVYVHTAGASLGGHAVKILGWGVDNGTP 300
Query: 135 YWLVANSWNVAWGEKGYFRIIRGLNECGIEHSAVAGIPDLARHN 4
YWLVANSWNVAWGEKGYFRIIRGLNECGIEHSAVAGIPDLARHN
Sbjct: 301 YWLVANSWNVAWGEKGYFRIIRGLNECGIEHSAVAGIPDLARHN 344
>gi|39588506|emb|CAE58029.1| Hypothetical protein CBG01103
[Caenorhabditis briggsae]
Length = 345
Score = 661 bits (1705), Expect = 0.0
Identities = 302/326 (92%), Positives = 314/326 (95%)
Frame = -1
Query: 981 PGHREAPALTGQALIDYVNSAQKLWTAGHQVIPKEKITKKLMDVKYLVPHKDEDIVATEV 802
P HREAP LTGQALIDYVNSAQKLWTAGHQVIPKEKITKKLMDVKYLVPHKDEDIVATEV
Sbjct: 20 PNHREAPVLTGQALIDYVNSAQKLWTAGHQVIPKEKITKKLMDVKYLVPHKDEDIVATEV 79
Query: 801 SDAIPDHFDARDQWPNCMSINNIRDQSDCGSCWAFAAAEAISDRTCIASNGAVNTLLSSE 622
DAIPDHFDARDQWP+C+SINNIRDQSDCGSCWAFAAAEAISDRTCIASNGAVNTLLSS+
Sbjct: 80 FDAIPDHFDARDQWPSCVSINNIRDQSDCGSCWAFAAAEAISDRTCIASNGAVNTLLSSQ 139
Query: 621 DLLSCCTGMFSCGNGCEGGYPIQAWKWWVKHGLVTGGSYETQFGCKPYSIAPCGETVNGV 442
DLLSCCTG+ SCGNGCEGGYPIQAWKWWVKHGLVTGGSYE+QFGCKPYSIAPCG+TVNGV
Sbjct: 140 DLLSCCTGLLSCGNGCEGGYPIQAWKWWVKHGLVTGGSYESQFGCKPYSIAPCGQTVNGV 199
Query: 441 KWPACPEDTEPTPKCVDSCTSKNNYATPYLQDKHFGSTAYAVGKKVEQIQTEILTNGPIE 262
WP CP+DTEPTPKCV++CTS N Y TPYLQDKHFG+TAYAVGKKVEQIQTEIL NGP+E
Sbjct: 200 TWPKCPDDTEPTPKCVEACTSNNTYPTPYLQDKHFGATAYAVGKKVEQIQTEILKNGPVE 259
Query: 261 VAFTVYEDFYQYTTGVYVHTAGASLGGHAVKILGWGVDNGTPYWLVANSWNVAWGEKGYF 82
VAFTVYEDFYQYTTGVYVHT+GASLGGHAVKILGWGVDNGTPYWLVANSWNV WGEKGYF
Sbjct: 260 VAFTVYEDFYQYTTGVYVHTSGASLGGHAVKILGWGVDNGTPYWLVANSWNVNWGEKGYF 319
Query: 81 RIIRGLNECGIEHSAVAGIPDLARHN 4
RIIRGLNECGIEHSAVAGIPDL RHN
Sbjct: 320 RIIRGLNECGIEHSAVAGIPDLTRHN 345