Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= W02D7_5
(612 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563258|ref|NP_505145.1| Suppressor/Enhancer of Lin-12 SEL-9... 374 e-103
gi|39590340|emb|CAE66079.1| Hypothetical protein CBG11296 [Caeno... 368 e-101
gi|9790015|ref|NP_062744.1| coated vesicle membrane protein; Sid... 266 2e-70
gi|13929014|ref|NP_113910.1| coated vesicle membrane protein [Ra... 266 2e-70
gi|1352660|sp|P49020|P24_CRIGR Cop-coated vesicle membrane prote... 266 2e-70
gi|5803149|ref|NP_006806.1| coated vesicle membrane protein [Hom... 265 5e-70
gi|28277266|gb|AAH44095.1| Rnp24-prov protein [Xenopus laevis] 265 7e-70
gi|50756325|ref|XP_415112.1| PREDICTED: similar to coated vesicl... 265 7e-70
gi|47228487|emb|CAG05307.1| unnamed protein product [Tetraodon n... 259 3e-68
gi|41054687|ref|NP_955842.1| coated vesicle membrane protein; wu... 256 2e-67
gi|31228557|ref|XP_318076.1| ENSANGP00000017729 [Anopheles gambi... 245 5e-64
gi|38077845|ref|XP_203659.2| similar to Sid394p [Mus musculus] 239 2e-62
gi|26354785|dbj|BAC41019.1| unnamed protein product [Mus musculus] 228 9e-59
gi|18921123|ref|NP_572165.1| CG3564-PA [Drosophila melanogaster]... 218 5e-56
gi|48143791|ref|XP_397473.1| similar to wnt5 protein [Apis melli... 206 3e-52
gi|47524468|gb|AAT34967.1| putative coated vesicle membrane prot... 190 2e-47
gi|41193314|ref|XP_372991.1| similar to coated vesicle membrane ... 176 4e-43
gi|40056982|dbj|BAD05160.1| emp24/gp25L/p24 family protein [Dict... 152 5e-36
gi|4514557|dbj|BAA75463.1| COP-coated vesicle membrane protein P... 149 4e-35
gi|49071772|ref|XP_400175.1| hypothetical protein UM02560.1 [Ust... 148 7e-35
gi|24657476|ref|NP_611629.1| CG9308-PA [Drosophila melanogaster]... 142 5e-33
gi|26344451|dbj|BAC35876.1| unnamed protein product [Mus musculus] 130 1e-29
gi|38104059|gb|EAA50680.1| hypothetical protein MG04439.4 [Magna... 126 3e-28
gi|50260753|gb|EAL23403.1| hypothetical protein CNBA0530 [Crypto... 126 4e-28
gi|49086500|ref|XP_405291.1| hypothetical protein AN1154.2 [Aspe... 123 2e-27
gi|40056984|dbj|BAD05161.1| emp24/gp25L/p24 family protein [Dict... 120 3e-26
gi|38083573|ref|XP_128959.2| RIKEN cDNA 3930401E15 [Mus musculus] 119 6e-26
gi|12585535|sp|Q9Y3B3|YA09_HUMAN Hypothetical protein CGI-109 pr... 117 2e-25
gi|32996709|ref|NP_861974.1| CGI-109 protein [Homo sapiens] >gnl... 116 4e-25
gi|14042242|dbj|BAB55166.1| unnamed protein product [Homo sapiens] 116 4e-25
gi|45361367|ref|NP_989261.1| hypothetical protein MGC76316 [Xeno... 114 2e-24
gi|32417814|ref|XP_329385.1| hypothetical protein [Neurospora cr... 113 2e-24
gi|41581224|emb|CAE47873.1| endosomal p24b protein precursor, pu... 112 4e-24
gi|46108262|ref|XP_381189.1| hypothetical protein FG01013.1 [Gib... 111 1e-23
gi|19075520|ref|NP_588020.1| putative component of COPII-coated ... 108 1e-22
gi|47086211|ref|NP_998077.1| hypothetical protein zgc:76996 [Dan... 107 2e-22
gi|6321238|ref|NP_011315.1| Integral membrane component of endop... 106 4e-22
gi|50292311|ref|XP_448588.1| unnamed protein product [Candida gl... 105 9e-22
gi|45198683|ref|NP_985712.1| AFR165Cp [Eremothecium gossypii] >g... 104 1e-21
gi|46432410|gb|EAK91893.1| hypothetical protein CaO19.13672 [Can... 103 3e-21
gi|50311243|ref|XP_455646.1| unnamed protein product [Kluyveromy... 103 3e-21
gi|47212722|emb|CAF90460.1| unnamed protein product [Tetraodon n... 101 1e-20
gi|50554763|ref|XP_504790.1| hypothetical protein [Yarrowia lipo... 100 2e-20
gi|49120111|ref|XP_412331.1| hypothetical protein AN8194.2 [Aspe... 99 6e-20
gi|32404976|ref|XP_323101.1| hypothetical protein ( (AL451018) c... 98 1e-19
gi|46123475|ref|XP_386291.1| hypothetical protein FG06115.1 [Gib... 96 4e-19
gi|37677661|gb|AAQ97430.1| TIRAP3b long form [Homo sapiens] >gnl... 95 1e-18
gi|50753302|ref|XP_413948.1| PREDICTED: similar to Membrane prot... 95 1e-18
gi|49075944|ref|XP_401998.1| hypothetical protein UM04383.1 [Ust... 94 2e-18
gi|38106956|gb|EAA53194.1| hypothetical protein MG07471.4 [Magna... 94 2e-18
gi|22761165|dbj|BAC11479.1| unnamed protein product [Homo sapiens] 91 2e-17
gi|6679189|ref|NP_031390.1| chromosome 15 open reading frame 22;... 91 2e-17
gi|50421847|ref|XP_459481.1| unnamed protein product [Debaryomyc... 90 4e-17
gi|47217868|emb|CAG02361.1| unnamed protein product [Tetraodon n... 88 1e-16
gi|39595716|emb|CAE67219.1| Hypothetical protein CBG12656 [Caeno... 88 1e-16
gi|17507745|ref|NP_491892.1| i-109 protein (23.3 kD) (1H139) [Ca... 88 1e-16
gi|12832872|dbj|BAB22292.1| unnamed protein product [Mus musculus] 88 1e-16
gi|33991818|gb|AAH56540.1| Wu:fb09b11 protein [Danio rerio] 87 2e-16
gi|34865444|ref|XP_217216.2| similar to integral type I protein ... 87 2e-16
gi|13384724|ref|NP_079636.1| integral type I protein [Mus muscul... 87 2e-16
gi|19483850|gb|AAH23338.1| Integral type I protein [Mus musculus] 87 2e-16
gi|40056986|dbj|BAD05162.1| emp24/gp25L/p24 family protein [Dict... 86 5e-16
gi|19114388|ref|NP_593476.1| putative COPII-coated vesicle prote... 85 9e-16
gi|50256840|gb|EAL19558.1| hypothetical protein CNBG1870 [Crypto... 84 2e-15
gi|18859819|ref|NP_572754.1| CG1967-PA [Drosophila melanogaster]... 84 2e-15
gi|31200381|ref|XP_309138.1| ENSANGP00000018750 [Anopheles gambi... 84 3e-15
gi|34879511|ref|XP_341609.1| similar to Hypothetical protein CGI... 82 6e-15
gi|47224298|emb|CAG09144.1| unnamed protein product [Tetraodon n... 82 1e-14
gi|996057|emb|CAA62380.1| gp25l2 [Homo sapiens] 79 5e-14
gi|50344924|ref|NP_001002134.1| zgc:86755 [Danio rerio] >gnl|BL_... 79 9e-14
gi|39725636|ref|NP_059980.2| gp25L2 protein [Homo sapiens] >gnl|... 78 1e-13
gi|45593301|sp|Q9BVK6|G252_HUMAN Glycoprotein 25L2 precursor 78 1e-13
gi|48106144|ref|XP_393052.1| similar to ENSANGP00000018750 [Apis... 78 1e-13
gi|17064083|gb|AAL35268.1| p25 [Homo sapiens] 78 1e-13
gi|47215087|emb|CAG04541.1| unnamed protein product [Tetraodon n... 77 3e-13
gi|3915129|sp|Q28735|TM21_RABIT Transmembrane protein Tmp21 prec... 77 3e-13
gi|21746165|ref|NP_083152.1| CGI-100-like protein [Mus musculus]... 77 3e-13
gi|18043634|gb|AAH20076.1| CGI-100-like protein [Mus musculus] 76 4e-13
gi|47550709|ref|NP_999863.1| zgc:85681; wu:fe06g04 [Danio rerio]... 76 6e-13
gi|34875848|ref|XP_214123.2| similar to CGI-100-like protein; RI... 75 1e-12
gi|45478080|gb|AAS66211.1| LRRG00120 [Rattus norvegicus] 75 1e-12
gi|28375485|emb|CAD66561.1| unnamed protein product [Homo sapiens] 75 1e-12
gi|34873639|ref|XP_341490.1| similar to gp25L2 protein [Rattus n... 75 1e-12
gi|26368202|dbj|BAB26802.2| unnamed protein product [Mus musculu... 75 1e-12
gi|3915893|sp|P49755|TM21_HUMAN Transmembrane protein Tmp21 prec... 75 1e-12
gi|40555903|gb|AAH64755.1| Transmembrane trafficking protein [Mu... 75 1e-12
gi|16758214|ref|NP_445919.1| integral membrane protein Tmp21-I (... 75 1e-12
gi|21312062|ref|NP_081051.1| transmembrane trafficking protein [... 75 1e-12
gi|3915137|sp|Q63584|TM21_RAT Transmembrane protein Tmp21 precur... 75 1e-12
gi|28573140|ref|NP_788616.1| CG33104-PA [Drosophila melanogaster... 75 1e-12
gi|1177628|emb|CAA62944.1| P24B protein precursor [Saccharomyces... 74 2e-12
gi|33457308|ref|NP_872353.2| putative NFkB activating protein HN... 74 2e-12
gi|50546777|ref|XP_500858.1| hypothetical protein [Yarrowia lipo... 74 2e-12
gi|3915123|sp|O35587|TM21_MESAU Transmembrane protein Tmp21 prec... 74 2e-12
gi|40255041|ref|NP_006818.2| transmembrane trafficking protein [... 74 2e-12
gi|48474619|sp|Q99KF1|G252_MOUSE Glycoprotein 25L2 precursor >gn... 74 2e-12
gi|3915133|sp|Q90515|TM21_FUGRU Transmembrane protein Tmp21 prec... 74 2e-12
gi|6689664|emb|CAB65517.1| p24 delta1 putative cargo receptor [X... 74 3e-12
gi|27882172|gb|AAH43860.1| Unknown (protein for IMAGE:4889436) [... 73 5e-12
gi|12585534|sp|Q9Y3A6|CA00_HUMAN Protein CGI-100 precursor (UNQ3... 72 6e-12
gi|50427137|ref|XP_462180.1| unnamed protein product [Debaryomyc... 72 6e-12
gi|30017578|gb|AAP13000.1| putative cop-coated vesicle membrane ... 72 6e-12
gi|27697481|ref|XP_223611.1| similar to RIKEN cDNA 1110014L17 [R... 72 8e-12
gi|50284745|ref|XP_444800.1| unnamed protein product [Candida gl... 72 8e-12
gi|19923442|ref|NP_057124.2| CGI-100 protein [Homo sapiens] >gnl... 72 1e-11
gi|50418821|ref|XP_457931.1| unnamed protein product [Debaryomyc... 72 1e-11
gi|27694691|gb|AAH43780.1| LOC398475 protein [Xenopus laevis] 72 1e-11
gi|48734810|gb|AAH71412.1| Unknown (protein for IMAGE:6898419) [... 72 1e-11
gi|1063411|emb|CAA62103.1| unnamed protein product [Xenopus laevis] 71 1e-11
gi|32484216|gb|AAH54154.1| Tmp21 protein [Xenopus laevis] 71 2e-11
gi|19527236|ref|NP_598781.1| RIKEN cDNA 1110014L17 [Mus musculus... 70 2e-11
gi|46436516|gb|EAK95877.1| hypothetical protein CaO19.3558 [Cand... 70 2e-11
gi|49257880|gb|AAH74441.1| Unknown (protein for MGC:84702) [Xeno... 70 3e-11
gi|40056988|dbj|BAD05163.1| emp24/gp25L/p24 family protein [Dict... 70 3e-11
gi|50748504|ref|XP_421277.1| PREDICTED: similar to Zgc:85681 pro... 70 4e-11
gi|32484308|gb|AAH54179.1| MGC64308 protein [Xenopus laevis] 70 4e-11
gi|15231496|ref|NP_187425.1| emp24/gp25L/p24 family protein [Ara... 69 5e-11
gi|21595553|gb|AAM66112.1| putative coated vesicle membrane prot... 69 5e-11
gi|23619091|ref|NP_705053.1| cop-coated vesicle membrane protein... 69 7e-11
gi|22761732|dbj|BAC11674.1| unnamed protein product [Homo sapiens] 68 1e-10
gi|26336202|dbj|BAC31786.1| unnamed protein product [Mus musculus] 68 1e-10
gi|41055361|ref|NP_956697.1| CGI-100 protein [Danio rerio] >gnl|... 68 2e-10
gi|50751312|ref|XP_422339.1| PREDICTED: similar to Protein CGI-1... 68 2e-10
gi|47207636|emb|CAF90889.1| unnamed protein product [Tetraodon n... 67 3e-10
gi|42565125|ref|NP_188924.3| emp24/gp25L/p24 protein-related [Ar... 66 5e-10
gi|6321902|ref|NP_011978.1| Protein with similarity to Emp24p an... 65 1e-09
gi|17566114|ref|NP_507861.1| associated Golgi apparatus (24.5 kD... 65 1e-09
gi|50258738|gb|EAL21423.1| hypothetical protein CNBD1180 [Crypto... 65 1e-09
gi|28573133|ref|NP_788617.1| CG33105-PA [Drosophila melanogaster... 64 2e-09
gi|39579851|emb|CAE56730.1| Hypothetical protein CBG24517 [Caeno... 64 2e-09
gi|39592002|emb|CAE75222.1| Hypothetical protein CBG23171 [Caeno... 63 4e-09
gi|17561130|ref|NP_505879.1| emp24/gp25L/p24 family (23.7 kD) (5... 63 4e-09
gi|5803040|ref|NP_006849.1| interleukin 1 receptor-like 1 ligand... 63 5e-09
gi|34859644|ref|XP_219027.2| similar to CGI-100-like protein; RI... 62 7e-09
gi|11596068|emb|CAC18511.1| dJ976O13.1 (CGI-100 protein) [Homo s... 62 8e-09
gi|1223892|gb|AAC52472.1| putative T1/ST2 receptor binding prote... 62 1e-08
gi|34860419|ref|XP_235922.2| similar to putative T1/ST2 receptor... 62 1e-08
gi|47210661|emb|CAF95180.1| unnamed protein product [Tetraodon n... 61 1e-08
gi|50289753|ref|XP_447308.1| unnamed protein product [Candida gl... 61 2e-08
gi|28571872|ref|NP_651323.3| CG11785-PA [Drosophila melanogaster... 60 2e-08
gi|42761389|dbj|BAD11657.1| coated vesicle membrane protein-like... 60 2e-08
gi|48139561|ref|XP_393466.1| similar to LD30746p [Apis mellifera] 60 3e-08
gi|13879585|gb|AAH06774.1| 1110014C03Rik protein [Mus musculus] 60 3e-08
gi|24584952|ref|NP_724105.1| CG31787-PA [Drosophila melanogaster... 60 4e-08
gi|40882539|gb|AAR96181.1| AT29354p [Drosophila melanogaster] 60 4e-08
gi|29840985|gb|AAP05986.1| similar to NM_075460 Y60A3A [Schistos... 59 6e-08
gi|49094244|ref|XP_408583.1| hypothetical protein AN4446.2 [Aspe... 59 6e-08
gi|15228372|ref|NP_187689.1| emp24/gp25L/p24 family protein [Ara... 59 6e-08
gi|38111568|gb|EAA57127.1| hypothetical protein MG08096.4 [Magna... 59 7e-08
gi|50302895|ref|XP_451385.1| unnamed protein product [Kluyveromy... 58 1e-07
gi|17541356|ref|NP_502288.1| t1 ST2 receptor binding protein lik... 58 1e-07
gi|45187899|ref|NP_984122.1| ADR026Wp [Eremothecium gossypii] >g... 58 1e-07
gi|39593881|emb|CAE62174.1| Hypothetical protein CBG06221 [Caeno... 58 2e-07
gi|15217563|ref|NP_172429.1| emp24/gp25L/p24 family protein [Ara... 58 2e-07
gi|120633|sp|P27869|G25L_CANFA Glycoprotein 25L precursor (GP25L... 58 2e-07
gi|47211082|emb|CAF95198.1| unnamed protein product [Tetraodon n... 57 2e-07
gi|31229887|ref|XP_318301.1| ENSANGP00000022113 [Anopheles gambi... 57 2e-07
gi|50420031|ref|XP_458548.1| unnamed protein product [Debaryomyc... 57 3e-07
gi|50747364|ref|XP_420848.1| PREDICTED: similar to glycoprotein ... 57 3e-07
gi|50309809|ref|XP_454918.1| unnamed protein product [Kluyveromy... 57 3e-07
gi|50416900|gb|AAH78377.1| Unknown (protein for MGC:92038) [Dani... 57 3e-07
gi|6319312|ref|NP_009395.1| Protein that forms a heterotrimeric ... 57 3e-07
gi|31242371|ref|XP_321616.1| ENSANGP00000011765 [Anopheles gambi... 57 4e-07
gi|15219136|ref|NP_173608.1| emp24/gp25L/p24 family protein [Ara... 57 4e-07
gi|6321436|ref|NP_011513.1| Protein with similarity to Emp24p an... 56 6e-07
gi|7487150|pir||T02697 hypothetical protein At2g03290 [imported]... 55 8e-07
gi|42568904|ref|NP_178428.2| emp24/gp25L/p24 family protein [Ara... 55 8e-07
gi|6319319|ref|NP_009402.1| Protein that forms a heterotrimeric ... 55 8e-07
gi|45269311|gb|AAS56036.1| YAR002C-A [Saccharomyces cerevisiae] 55 1e-06
gi|6324590|ref|NP_014659.1| Protein with similarity to Emp24p an... 55 1e-06
gi|22330523|ref|NP_177105.2| emp24/gp25L/p24 family protein [Ara... 55 1e-06
gi|12597802|gb|AAG60114.1| unknown protein [Arabidopsis thaliana... 55 1e-06
gi|27819749|gb|AAL68388.2| SD08771p [Drosophila melanogaster] 54 2e-06
gi|24642087|ref|NP_727821.1| CG9053-PB [Drosophila melanogaster]... 54 2e-06
gi|18859965|ref|NP_572994.1| CG9053-PA [Drosophila melanogaster]... 54 2e-06
gi|15223626|ref|NP_176075.1| emp24/gp25L/p24 family protein [Ara... 54 2e-06
gi|46229408|gb|EAK90226.1| P24 like gold domain protein, possibl... 54 3e-06
gi|50285737|ref|XP_445297.1| unnamed protein product [Candida gl... 53 4e-06
gi|46805447|dbj|BAD16929.1| emp24/gp25L/p24-like [Oryza sativa (... 53 5e-06
gi|31208669|ref|XP_313301.1| ENSANGP00000010504 [Anopheles gambi... 52 7e-06
gi|21618241|gb|AAM67291.1| unknown [Arabidopsis thaliana] 52 7e-06
gi|50287927|ref|XP_446392.1| unnamed protein product [Candida gl... 52 9e-06
gi|13385614|ref|NP_080385.1| RIKEN cDNA 1810008K16 [Mus musculus... 52 9e-06
gi|12859034|dbj|BAB31517.1| unnamed protein product [Mus musculus] 52 9e-06
gi|18396016|ref|NP_564256.1| emp24/gp25L/p24 family protein [Ara... 52 1e-05
gi|32412710|ref|XP_326835.1| hypothetical protein ( (AL451017) p... 52 1e-05
gi|26452085|dbj|BAC43132.1| unknown protein [Arabidopsis thalian... 52 1e-05
gi|38111702|gb|EAA57241.1| hypothetical protein MG08210.4 [Magna... 51 1e-05
gi|50307461|ref|XP_453709.1| unnamed protein product [Kluyveromy... 51 1e-05
gi|19112583|ref|NP_595791.1| similarity to COPII-coated vesicle ... 51 1e-05
gi|33146897|dbj|BAC79896.1| putative transmembrane protein [Oryz... 51 2e-05
gi|32405418|ref|XP_323322.1| hypothetical protein [Neurospora cr... 51 2e-05
gi|18921314|gb|AAL82519.1| putative transmembrane protein [Oryza... 51 2e-05
gi|47223912|emb|CAG06089.1| unnamed protein product [Tetraodon n... 50 3e-05
gi|46137103|ref|XP_390243.1| hypothetical protein FG10067.1 [Gib... 50 3e-05
gi|3087752|emb|CAA76640.1| S31 protein [Cyprinus carpio] 50 4e-05
gi|31455473|dbj|BAC77362.1| putative NFkB activating protein [Ho... 49 6e-05
gi|46137245|ref|XP_390314.1| hypothetical protein FG10138.1 [Gib... 49 1e-04
gi|50407489|ref|XP_456715.1| unnamed protein product [Debaryomyc... 49 1e-04
gi|49093682|ref|XP_408302.1| hypothetical protein AN4165.2 [Aspe... 49 1e-04
gi|49073514|ref|XP_400970.1| hypothetical protein UM03355.1 [Ust... 49 1e-04
gi|38074676|ref|XP_140916.2| similar to gp25L2 protein [Mus musc... 48 1e-04
gi|50548979|ref|XP_501960.1| hypothetical protein [Yarrowia lipo... 48 1e-04
gi|34529356|dbj|BAC85686.1| unnamed protein product [Homo sapiens] 48 2e-04
gi|46437725|gb|EAK97066.1| hypothetical protein CaO19.7409 [Cand... 47 2e-04
gi|11994711|dbj|BAB02949.1| golgi-associated membrane traffickin... 47 4e-04
gi|15228586|ref|NP_189550.1| emp24/gp25L/p24 family protein [Ara... 47 4e-04
gi|50259637|gb|EAL22307.1| hypothetical protein CNBB4820 [Crypto... 46 5e-04
gi|50553696|ref|XP_504259.1| hypothetical protein [Yarrowia lipo... 46 6e-04
gi|3087719|emb|CAA76642.1| S31 protein [Anguilla anguilla] 45 8e-04
gi|15223027|ref|NP_172854.1| emp24/gp25L/p24 family protein [Ara... 45 8e-04
gi|50303261|ref|XP_451572.1| unnamed protein product [Kluyveromy... 45 8e-04
gi|16769426|gb|AAL28932.1| LD30746p [Drosophila melanogaster] 45 0.001
gi|8778403|gb|AAF79411.1| F16A14.23 [Arabidopsis thaliana] 44 0.002
gi|50291741|ref|XP_448303.1| unnamed protein product [Candida gl... 44 0.002
gi|48098733|ref|XP_392556.1| similar to CG11785-PA [Apis mellifera] 44 0.003
gi|45188058|ref|NP_984281.1| ADR185Wp [Eremothecium gossypii] >g... 44 0.003
gi|34902162|ref|NP_912427.1| Hypothetical protein [Oryza sativa ... 44 0.003
gi|45190850|ref|NP_985104.1| AER247Wp [Eremothecium gossypii] >g... 43 0.004
gi|19114315|ref|NP_593403.1| putative component of the COPII-coa... 43 0.004
gi|24659053|ref|NP_729140.1| CG10733-PA [Drosophila melanogaster... 43 0.004
gi|23482735|gb|EAA18629.1| transmembrane protein tmp21 precursor... 42 0.009
gi|22760075|dbj|BAC11058.1| unnamed protein product [Homo sapiens] 42 0.009
gi|6323630|ref|NP_013701.1| Protein that forms a heterotrimeric ... 42 0.009
gi|26335415|dbj|BAC31408.1| unnamed protein product [Mus musculus] 42 0.012
gi|50289143|ref|XP_447001.1| unnamed protein product [Candida gl... 41 0.016
gi|50405249|ref|YP_054341.1| hypothetical protein PTMB.413-bc [P... 40 0.035
gi|26347137|dbj|BAC37217.1| unnamed protein product [Mus musculus] 39 0.059
gi|29840971|gb|AAP05972.1| similar to GenBank Accession Number A... 39 0.059
gi|48105826|ref|XP_396009.1| similar to CG33104-PA [Apis mellifera] 39 0.077
gi|5689817|emb|CAB52018.1| p24B protein [Homo sapiens] 37 0.29
gi|23510200|ref|NP_702866.1| hypothetical protein [Plasmodium fa... 37 0.29
gi|29247378|gb|EAA38942.1| GLP_438_30879_30295 [Giardia lamblia ... 36 0.65
gi|47230203|emb|CAG10617.1| unnamed protein product [Tetraodon n... 36 0.65
gi|23481278|gb|EAA17603.1| hypothetical protein [Plasmodium yoel... 35 1.5
gi|40787393|gb|AAR90270.1| polyketide synthase [Cochliobolus het... 34 1.9
gi|30018746|ref|NP_830377.1| Two component system histidine kina... 33 3.2
gi|32394664|gb|AAN38999.1| transmembrane protein Tmp21 precursor... 33 3.2
gi|1346953|sp|P49193|RALB_TODPA Retinal-binding protein (RALBP) ... 33 4.2
gi|34896380|ref|NP_909534.1| hypothetical protein [Oryza sativa ... 33 5.5
gi|42407411|dbj|BAD09569.1| integral membrane protein-like [Oryz... 32 7.2
gi|34851659|ref|XP_214683.2| similar to RIKEN cDNA 1810015P03 [R... 32 9.4
gi|7513402|pir||G01160 transmembrane protein - human (fragment) ... 32 9.4
gi|15227522|ref|NP_178404.1| transmembrane protein-related [Arab... 32 9.4
>gi|17563258|ref|NP_505145.1| Suppressor/Enhancer of Lin-12 SEL-9,
coated vesicle membrane protein (23.0 kD) (sel-9)
[Caenorhabditis elegans]
gi|20455283|sp|O17528|SEL9_CAEEL Suppressor/enhancer of lin-12
protein 9 precursor
gi|7508835|pir||T29844 hypothetical protein W02D7.7 -
Caenorhabditis elegans
gi|2275635|gb|AAB63937.1| Suppressor/enhancer of lin-12 protein 9
[Caenorhabditis elegans]
Length = 203
Score = 374 bits (960), Expect = e-103
Identities = 188/203 (92%), Positives = 188/203 (92%)
Frame = -1
Query: 612 MNSLTWILAVLFVTPAASYFIHVDANEEQCFFDRLTSGTKMGLMFEVAEGGFLDIDVKIT 433
MNSLTWILAVLFVTPAASYFIHVDANEEQCFFDRLTSGTKMGLMFEVAEGGFLDIDVKIT
Sbjct: 1 MNSLTWILAVLFVTPAASYFIHVDANEEQCFFDRLTSGTKMGLMFEVAEGGFLDIDVKIT 60
Query: 432 GPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTVEITEPHXXXXXX 253
GPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTVEITEPH
Sbjct: 61 GPDNKEIYKGERESSGKFTFAAHMDGVYTYCFGNKMSTMTPKAVMFTVEITEPHQQAPGA 120
Query: 252 XXXXXXXXXAKLEEMVRELSSALMSVKHEQEYMEVRERVHRNINENTNSRVVMWAAFEAF 73
AKLEEMVRELSSALMSVKHEQEYMEVRERVHRNINENTNSRVVMWAAFEAF
Sbjct: 121 AANQDAADNAKLEEMVRELSSALMSVKHEQEYMEVRERVHRNINENTNSRVVMWAAFEAF 180
Query: 72 VLVGMTVGQIFYLKRFFEVRTMV 4
VLVGMTVGQIFYLKRFFEVRTMV
Sbjct: 181 VLVGMTVGQIFYLKRFFEVRTMV 203