Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= W01H2_2
         (591 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17570221|ref|NP_508721.1| RAB family member (rab-37) [Caenorh...   399   e-110
gi|39597850|emb|CAE68542.1| Hypothetical protein CBG14372 [Caeno...   328   3e-89
gi|47219617|emb|CAG02662.1| unnamed protein product [Tetraodon n...   209   2e-53
gi|7677422|gb|AAF67162.1| GTPase Rab37 [Mus musculus] >gnl|BL_OR...   208   5e-53
gi|31543568|ref|NP_067386.2| RAB37, member of RAS oncogene famil...   206   2e-52
gi|20139581|sp|Q96AX2|RB37_HUMAN Ras-related protein Rab-37 >gnl...   205   4e-52
gi|50755689|ref|XP_414855.1| PREDICTED: similar to RAB26, member...   203   2e-51
gi|46361978|ref|NP_055168.2| RAB26, member RAS oncogene family [...   201   1e-50
gi|44890744|gb|AAH66913.1| RAB26, member RAS oncogene family [Ho...   201   1e-50
gi|33873723|gb|AAH07681.2| RAB26 protein [Homo sapiens]               201   1e-50
gi|38082075|ref|XP_283428.2| RAB26, member RAS oncogene family [...   200   1e-50
gi|38303826|gb|AAH61984.1| Rab26 protein [Rattus norvegicus]          200   2e-50
gi|12230537|sp|Q9ULW5|RB26_HUMAN Ras-related protein Rab-26 >gnl...   197   1e-49
gi|19424272|ref|NP_598264.1| RAB26, member RAS oncogene family [...   196   2e-49
gi|1083775|pir||JC2528 GTP-binding protein Rab26 - rat                195   5e-49
gi|34875317|ref|XP_343984.1| similar to GTPase Rab37 [Rattus nor...   191   1e-47
gi|48095308|ref|XP_392276.1| similar to CG7605-PA [Apis mellifera]    190   1e-47
gi|26337951|dbj|BAC32661.1| unnamed protein product [Mus musculus]    186   3e-46
gi|28376635|ref|NP_783865.1| RAB37, member RAS oncogene family; ...   184   1e-45
gi|50540198|ref|NP_001002566.1| zgc:92757 [Danio rerio] >gnl|BL_...   181   1e-44
gi|47222415|emb|CAG12935.1| unnamed protein product [Tetraodon n...   180   2e-44
gi|50604253|gb|AAH78133.1| Unknown (protein for MGC:84543) [Xeno...   179   3e-44
gi|12843097|dbj|BAB25858.1| unnamed protein product [Mus musculus]    178   6e-44
gi|7710086|ref|NP_057885.1| RAB10, member RAS oncogene family [M...   178   6e-44
gi|131804|sp|P24409|RB10_CANFA Ras-related protein Rab-10 >gnl|B...   178   6e-44
gi|37747686|gb|AAH60015.1| MGC68629 protein [Xenopus laevis]          178   8e-44
gi|33695095|ref|NP_057215.2| ras-related GTP-binding protein RAB...   177   1e-43
gi|1370196|emb|CAA98175.1| RAB8D [Lotus corniculatus var. japoni...   177   2e-43
gi|50553762|ref|XP_504292.1| YlRYL1 [Yarrowia lipolytica] >gnl|B...   176   3e-43
gi|1370194|emb|CAA98174.1| RAB8C [Lotus corniculatus var. japoni...   176   3e-43
gi|1362067|pir||S57478 GTP-binding protein GTP13 - garden pea >g...   176   4e-43
gi|1362065|pir||S57462 GTP-binding protein GTP11 - garden pea >g...   176   4e-43
gi|2133238|pir||S51495 GTP-binding protein RYL1 - yeast (Yarrowi...   176   4e-43
gi|25150215|ref|NP_491199.2| RAB family member (24.0 kD) (rab-8)...   176   4e-43
gi|7498104|pir||T33855 hypothetical protein D1037.4 - Caenorhabd...   175   5e-43
gi|234746|gb|AAB19681.1| RAS-related protein MEL [Homo sapiens]       175   5e-43
gi|420269|pir||B42148 GTP-binding protein rab10 - rat                 175   5e-43
gi|18447921|dbj|BAB84326.1| ras-related protein RAB8-5 [Nicotian...   175   6e-43
gi|33146687|dbj|BAC80082.1| putative ethylene-responsive small G...   175   6e-43
gi|1362066|pir||S57471 GTP-binding protein GTP6 - garden pea >gn...   175   6e-43
gi|1370190|emb|CAA98172.1| RAB8A [Lotus corniculatus var. japoni...   175   6e-43
gi|7438373|pir||S72515 GTP-binding protein RAB1 - garden petunia...   175   6e-43
gi|15242773|ref|NP_195972.1| Ras-related GTP-binding protein, pu...   174   8e-43
gi|18447917|dbj|BAB84324.1| ras-related protein RAB8-3 [Nicotian...   174   8e-43
gi|18447913|dbj|BAB84322.1| ras-related protein RAB8-1 [Nicotian...   174   8e-43
gi|18447915|dbj|BAB84323.1| ras-related protein RAB8-2 [Nicotian...   174   8e-43
gi|29124128|gb|AAO65869.1| ethylene-responsive small GTP-binding...   174   8e-43
gi|15232784|ref|NP_187601.1| Ras-related GTP-binding protein, pu...   174   8e-43
gi|47900325|gb|AAT39172.1| putative GTP-binding protein [Oryza s...   174   1e-42
gi|2808638|emb|CAA04701.1| small GTP-binding protein [Daucus car...   174   1e-42
gi|49522647|gb|AAH71176.1| Unknown (protein for IMAGE:7098881) [...   174   1e-42
gi|38372905|ref|NP_075615.2| cell line NK14 derived transforming...   174   1e-42
gi|131847|sp|P22127|RB10_DISOM Ras-related protein Rab-10 (ORA1)...   174   1e-42
gi|17737369|ref|NP_523419.1| CG17060-PA [Drosophila melanogaster...   174   1e-42
gi|3024527|sp|Q39433|RAB1_BETVU Ras-related protein RAB1BV >gnl|...   174   1e-42
gi|39586275|emb|CAE66686.1| Hypothetical protein CBG12025 [Caeno...   174   1e-42
gi|1710002|sp|P55258|RB8A_MOUSE Ras-related protein Rab-8A (Onco...   174   1e-42
gi|1370198|emb|CAA98176.1| RAB8E [Lotus corniculatus var. japoni...   173   2e-42
gi|5669640|gb|AAD46405.1| ethylene-responsive small GTP-binding ...   173   2e-42
gi|16902020|gb|AAL27637.1| GH21984p [Drosophila melanogaster]         173   2e-42
gi|24668006|ref|NP_649303.2| CG7605-PA [Drosophila melanogaster]...   173   2e-42
gi|15231322|ref|NP_190192.1| Ras-related protein (ARA-3) / small...   173   2e-42
gi|134236|sp|P20791|SAS2_DICDI GTP-binding protein SAS2 >gnl|BL_...   173   2e-42
gi|29841143|gb|AAP06156.1| similar to NM_070996 RAS-related prot...   173   2e-42
gi|1362064|pir||S57474 GTP-binding protein - garden pea >gnl|BL_...   172   3e-42
gi|21592670|gb|AAM64619.1| putative Ras-like GTP-binding protein...   172   3e-42
gi|15238542|ref|NP_200792.1| Ras-related GTP-binding family prot...   172   3e-42
gi|15231847|ref|NP_190929.1| Ras-related GTP-binding protein, pu...   172   3e-42
gi|39595692|emb|CAE67195.1| Hypothetical protein CBG12631 [Caeno...   172   3e-42
gi|47225841|emb|CAF98321.1| unnamed protein product [Tetraodon n...   172   3e-42
gi|7438394|pir||T14405 small GTP-binding protein rab-1 - turnip ...   172   3e-42
gi|479442|pir||S33900 GTP-binding protein ypt2 - tomato >gnl|BL_...   172   4e-42
gi|30585389|gb|AAP36967.1| Homo sapiens mel transforming oncogen...   172   4e-42
gi|50752811|ref|XP_413757.1| PREDICTED: similar to GTPase Rab8b ...   172   4e-42
gi|16933567|ref|NP_005361.2| mel transforming oncogene; ras-asso...   172   4e-42
gi|1053065|gb|AAA80679.1| small GTP-binding protein                   172   5e-42
gi|23463313|ref|NP_695229.1| GTPase Rab8b [Rattus norvegicus] >g...   172   5e-42
gi|38194437|gb|AAR13228.1| Rab family GTPase Rab8 [Fucus distichus]   171   7e-42
gi|303748|dbj|BAA02115.1| GTP-binding protein [Pisum sativum] >g...   171   9e-42
gi|32398899|emb|CAD98364.1| small GTP binding protein rab1a, pro...   171   9e-42
gi|17737663|ref|NP_524172.1| CG8287-PA [Drosophila melanogaster]...   171   9e-42
gi|7706563|ref|NP_057614.1| RAB8B, member RAS oncogene family; R...   171   9e-42
gi|31204497|ref|XP_311197.1| ENSANGP00000019091 [Anopheles gambi...   171   9e-42
gi|1370162|emb|CAA66447.1| RAB1A [Lotus corniculatus var. japoni...   170   2e-41
gi|17509233|ref|NP_491857.1| RAB family member (22.7 kD) (rab-10...   170   2e-41
gi|46326983|gb|AAS88430.1| ethylene-responsive small GTP-binding...   170   2e-41
gi|8394124|ref|NP_059055.1| ras-related protein rab10 [Rattus no...   170   2e-41
gi|131848|sp|P22128|RAB8_DISOM Ras-related protein Rab-8 (ORA2) ...   170   2e-41
gi|23613148|ref|NP_703470.1| GTPase, putative [Plasmodium falcip...   170   2e-41
gi|41152205|ref|NP_958486.1| RAB13, member RAS oncogene family [...   169   3e-41
gi|49102994|ref|XP_411111.1| hypothetical protein AN6974.2 [Aspe...   169   4e-41
gi|541978|pir||S41430 GTP-binding protein, ras-like (clone vfa-y...   169   4e-41
gi|134228|sp|P20790|SAS1_DICDI GTP-binding protein SAS1 >gnl|BL_...   169   5e-41
gi|25294107|pir||JC7589 Sec4p homolog - yeast (Pichia pastoris) ...   168   6e-41
gi|11558647|emb|CAC17832.1| secretion related GTPase, (SrgA) [As...   168   8e-41
gi|31243023|ref|XP_321946.1| ENSANGP00000013866 [Anopheles gambi...   168   8e-41
gi|4506363|ref|NP_002861.1| RAB13, member RAS oncogene family; R...   167   1e-40
gi|34914060|ref|NP_918377.1| putative RIC1_ORYSA RAS-RELATED PRO...   167   1e-40
gi|38106736|gb|EAA53007.1| hypothetical protein MG06135.4 [Magna...   167   1e-40
gi|40225607|gb|AAH09227.2| RAB13 protein [Homo sapiens]               167   1e-40
gi|3334326|sp|O14462|SEC4_CANAL Ras-related protein SEC4 >gnl|BL...   167   1e-40
gi|49257311|gb|AAH73168.1| RAB13 protein [Homo sapiens]               167   1e-40
gi|29789271|ref|NP_112354.1| RAB13 [Rattus norvegicus] >gnl|BL_O...   167   1e-40
gi|46123663|ref|XP_386385.1| hypothetical protein FG06209.1 [Gib...   167   1e-40
gi|1370170|emb|CAA98162.1| RAB1E [Lotus corniculatus var. japoni...   167   2e-40
gi|227603|prf||1707300A guanine nucleotide binding protein            166   2e-40
gi|466170|sp|P16976|YPT1_MAIZE GTP-binding protein YPTM1 >gnl|BL...   166   2e-40
gi|47223089|emb|CAG07176.1| unnamed protein product [Tetraodon n...   166   2e-40
gi|27817324|emb|CAD61089.1| SI:zC101N13.3 (novel protein similar...   166   3e-40
gi|21311975|ref|NP_080953.1| RAS-associated protein RAB13 [Mus m...   166   3e-40
gi|14475537|emb|CAC41973.1| putative Rab/GTPase [Colletotrichum ...   166   3e-40
gi|4586580|dbj|BAA76422.1| rab-type small GTP-binding protein [C...   166   4e-40
gi|730510|sp|P40392|RIC1_ORYSA Ras-related protein RIC1 >gnl|BL_...   166   4e-40
gi|103720|pir||D38625 GTP-binding protein o-rab1 - electric ray ...   165   5e-40
gi|1616614|emb|CAA69701.1| small GTP-binding protein [Nicotiana ...   165   5e-40
gi|15236555|ref|NP_193486.1| Ras-related GTP-binding protein, pu...   165   5e-40
gi|7438375|pir||H71444 GTP-binding protein - Arabidopsis thalian...   165   5e-40
gi|38175435|dbj|BAC83185.2| putative ras-related protein [Oryza ...   165   7e-40
gi|541948|pir||S39565 GTP-binding protein rab1 - soybean >gnl|BL...   165   7e-40
gi|131785|sp|P22125|RAB1_DISOM Ras-related protein ORAB-1 >gnl|B...   165   7e-40
gi|19115492|ref|NP_594580.1| ypt1-related protein 2 [Schizosacch...   165   7e-40
gi|7643790|gb|AAF65510.1| small GTP-binding protein [Capsicum an...   164   9e-40
gi|103724|pir||B38625 GTP-binding protein ora2 - electric ray (D...   164   9e-40
gi|1370168|emb|CAA98161.1| RAB1D [Lotus corniculatus var. japoni...   164   1e-39
gi|15217622|ref|NP_171715.1| Ras-related protein (ARA-5) / small...   164   1e-39
gi|5902803|sp|P28188|ARA5_ARATH Ras-related protein ARA-5 >gnl|B...   164   1e-39
gi|217841|dbj|BAA00832.1| small GTP-binding protein [Arabidopsis...   164   1e-39
gi|81634|pir||PS0279 GTP-binding protein ara-5 - Arabidopsis tha...   164   1e-39
gi|49065350|emb|CAG38493.1| RAB1B [Homo sapiens]                      164   1e-39
gi|1370166|emb|CAA98160.1| RAB1C [Lotus corniculatus var. japoni...   164   1e-39
gi|1381678|gb|AAB97115.1| small GTP-binding protein [Glycine max]     164   1e-39
gi|50738954|ref|XP_419342.1| PREDICTED: similar to ras-related p...   164   1e-39
gi|27924279|gb|AAH45014.1| Rab1-prov protein [Xenopus laevis] >g...   164   1e-39
gi|32411557|ref|XP_326259.1| RAS-RELATED PROTEIN RAB1BV [Neurosp...   163   2e-39
gi|1053067|gb|AAA80680.1| small GTP-binding protein                   163   2e-39
gi|49074732|ref|XP_401480.1| hypothetical protein UM03865.1 [Ust...   163   2e-39
gi|50424201|ref|XP_460687.1| unnamed protein product [Debaryomyc...   163   2e-39
gi|4758988|ref|NP_004152.1| RAB1A, member RAS oncogene family; R...   163   3e-39
gi|15229836|ref|NP_187779.1| Ras-related GTP-binding protein, pu...   163   3e-39
gi|39588485|emb|CAE58008.1| Hypothetical protein CBG01077 [Caeno...   162   3e-39
gi|17558550|ref|NP_503397.1| RAB family member (22.5 kD) (rab-1)...   162   3e-39
gi|47209142|emb|CAF90455.1| unnamed protein product [Tetraodon n...   162   3e-39
gi|21313162|ref|NP_083852.1| RIKEN cDNA 1110011F09 [Mus musculus...   162   4e-39
gi|7438392|pir||T14391 GTP-binding protein homolog - turnip >gnl...   162   4e-39
gi|1370164|emb|CAA98159.1| RAB1B [Lotus corniculatus var. japoni...   162   4e-39
gi|349484|gb|AAA18826.1| GTP-binding protein homologue                162   4e-39
gi|131787|sp|P05711|RB1A_RAT Ras-related protein Rab-1A >gnl|BL_...   162   6e-39
gi|13569962|ref|NP_112243.1| RAB1B, member RAS oncogene family; ...   162   6e-39
gi|23479748|gb|EAA16491.1| putative GTPase [Plasmodium yoelii yo...   162   6e-39
gi|16974365|gb|AAL31108.1| AT4g17530/dl4800c [Arabidopsis thaliana]   162   6e-39
gi|14573837|gb|AAK68195.1| Rab family protein 3, isoform a [Caen...   161   1e-38
gi|13537429|dbj|BAB40669.1| small GTPase Rab1 [Entamoeba histoly...   161   1e-38
gi|39596953|emb|CAE59180.1| Hypothetical protein CBG02488 [Caeno...   161   1e-38
gi|15042957|ref|NP_114080.2| RAB3D, member RAS oncogene family [...   161   1e-38
gi|17535675|ref|NP_495129.1| RAB family member, small GTP-bindin...   161   1e-38
gi|41055496|ref|NP_957436.1| similar to RAB1, member RAS oncogen...   161   1e-38
gi|92339|pir||S06147 GTP-binding protein rab1B - rat >gnl|BL_ORD...   161   1e-38
gi|303750|dbj|BAA02116.1| GTP-binding protein [Pisum sativum] >g...   161   1e-38
gi|7496249|pir||T15546 hypothetical protein C18A3.6 - Caenorhabd...   161   1e-38
gi|47225370|emb|CAG11853.1| unnamed protein product [Tetraodon n...   160   2e-38
gi|4759000|ref|NP_004274.1| RAB3D, member RAS oncogene family; R...   160   2e-38
gi|346947|pir||A45384 GTP-binding protein rab3D - mouse               160   2e-38
gi|2500076|sp|Q01890|YPT1_PHYIN Ras-like GTP-binding protein YPT...   160   2e-38
gi|466172|sp|Q05737|YPT2_MAIZE GTP-binding protein YPTM2 >gnl|BL...   160   2e-38
gi|18422766|ref|NP_568678.1| Ras-related GTP-binding protein, pu...   160   2e-38
gi|30583917|gb|AAP36207.1| Homo sapiens RAB3D, member RAS oncoge...   160   2e-38
gi|12084567|pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanos...   160   2e-38
gi|37360618|dbj|BAC98287.1| mKIAA3012 protein [Mus musculus]          160   2e-38
gi|49257746|gb|AAH74589.1| Unknown (protein for MGC:69316) [Xeno...   160   2e-38
gi|1053063|gb|AAA80678.1| small GTP-binding protein                   160   2e-38
gi|131803|sp|P10536|RB1B_RAT Ras-related protein Rab-1B >gnl|BL_...   159   3e-38
gi|303732|dbj|BAA02117.1| GTP-binding protein [Pisum sativum] >g...   159   3e-38
gi|14140133|emb|CAC39050.1| putative GTP-binding protein [Oryza ...   159   3e-38
gi|421942|pir||S34253 GTP-binding protein, ras-related - common ...   159   3e-38
gi|47211161|emb|CAF92536.1| unnamed protein product [Tetraodon n...   159   3e-38
gi|34906164|ref|NP_914429.1| putative GTP-binding protein [Oryza...   159   3e-38
gi|1370192|emb|CAA98173.1| RAB8B [Lotus corniculatus var. japoni...   159   4e-38
gi|14318517|ref|NP_116650.1| Secretory vesicle associated Rab GT...   159   4e-38
gi|1016750|gb|AAA79138.1| rab-related GTP-binding protein             159   4e-38
gi|27709432|ref|XP_229035.1| similar to Ras-related protein Rab-...   159   4e-38
gi|12084563|pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp >g...   159   4e-38
gi|50292669|ref|XP_448767.1| unnamed protein product [Candida gl...   159   5e-38
gi|32492048|gb|AAP85296.1| Rab1a [Babesia bovis]                      158   6e-38
gi|48096697|ref|XP_392500.1| similar to Ras-related protein Rab-...   158   6e-38
gi|464523|sp|P34139|RB1A_DICDI Ras-related protein Rab1A >gnl|BL...   158   6e-38
gi|31208125|ref|XP_313029.1| ENSANGP00000011746 [Anopheles gambi...   158   8e-38
gi|50539696|ref|NP_001002318.1| zgc:86635 [Danio rerio] >gnl|BL_...   158   8e-38
gi|1845598|gb|AAB47925.1| Rab3 [Loligo pealei]                        157   1e-37
gi|50582491|dbj|BAD32700.1| Rab3 [Loligo pealei]                      157   1e-37
gi|464563|sp|P35291|RB16_RAT Ras-related protein Rab-16 >gnl|BL_...   157   1e-37
gi|283769|pir||A43958 GTP-binding protein, synaptic vesicle spec...   157   1e-37
gi|549809|sp|P36861|YPT2_VOLCA GTP-binding protein yptV2 >gnl|BL...   157   1e-37
gi|2342660|gb|AAB67800.1| GTP-binding protein sprab3 [Strongyloc...   157   2e-37
gi|3273209|dbj|BAA31150.1| Rab1C [Dictyostelium discoideum]           157   2e-37
gi|464525|sp|P34140|RB1B_DICDI Ras-related protein Rab1B >gnl|BL...   157   2e-37
gi|50259473|gb|EAL22146.1| hypothetical protein CNBC2840 [Crypto...   157   2e-37
gi|14318480|ref|NP_116615.1| Ras-like small GTPase, involved in ...   157   2e-37
gi|4293|emb|CAA25036.1| unnamed protein product [Saccharomyces c...   157   2e-37
gi|7438417|pir||JE0318 GTP-binding protein rabB - silkworm >gnl|...   157   2e-37
gi|48104721|ref|XP_392967.1| similar to CG3320-PA [Apis mellifera]    156   2e-37
gi|49074658|ref|XP_401448.1| YPT1_NEUCR GTP-binding protein ypt1...   156   2e-37
gi|46138717|ref|XP_391049.1| YPT1_NEUCR GTP-binding protein ypt1...   156   2e-37
gi|45201075|ref|NP_986645.1| AGL021Wp [Eremothecium gossypii] >g...   156   2e-37
gi|18034781|ref|NP_542147.1| RAB3D, member RAS oncogene family [...   156   3e-37
gi|392973|gb|AAA03315.1| Rab3                                         156   3e-37
gi|41148993|ref|XP_372086.1| similar to RAB1B, member RAS oncoge...   156   3e-37
gi|27696356|gb|AAH43857.1| Rab3d protein [Xenopus laevis]             156   3e-37
gi|50540426|ref|NP_001002679.1| zgc:86892 [Danio rerio] >gnl|BL_...   156   3e-37
gi|50306647|ref|XP_453297.1| unnamed protein product [Kluyveromy...   156   3e-37
gi|50287271|ref|XP_446065.1| unnamed protein product [Candida gl...   155   4e-37
gi|50256143|gb|EAL18870.1| hypothetical protein CNBI1310 [Crypto...   155   4e-37
gi|11558500|emb|CAC17744.1| small GTP-binding protein YPTI [Hypo...   155   4e-37
gi|32418088|ref|XP_329522.1| GTP-BINDING PROTEIN YPT1 [Neurospor...   155   5e-37
gi|11558649|emb|CAC17833.1| secretion related GTPase (SrgB) [Asp...   155   5e-37
gi|466171|sp|P33723|YPT1_NEUCR GTP-binding protein ypt1 >gnl|BL_...   155   5e-37
gi|10129780|emb|CAC08198.1| putative GTP-binding protein [Kluyve...   155   5e-37
gi|49093914|ref|XP_408418.1| YPT1_NEUCR GTP-binding protein ypt1...   155   5e-37
gi|29841146|gb|AAP06159.1| similar to NM_078963 GTP-binding prot...   155   7e-37
gi|401686|sp|P31584|YPT1_VOLCA GTP-binding protein yptV1 >gnl|BL...   155   7e-37
gi|50308977|ref|XP_454494.1| unnamed protein product [Kluyveromy...   155   7e-37
gi|38109427|gb|EAA55305.1| hypothetical protein MG06962.4 [Magna...   155   7e-37
gi|23490566|gb|EAA22313.1| Rab1 protein [Plasmodium yoelii yoelii]    155   7e-37
gi|45185452|ref|NP_983169.1| ABR220Wp [Eremothecium gossypii] >g...   155   7e-37
gi|464524|sp|Q05974|RAB1_LYMST Ras-related protein Rab-1A >gnl|B...   154   9e-37
gi|14423577|gb|AAK62471.1| small GTP-binding protein Rab8 [Entam...   154   9e-37
gi|19112997|ref|NP_596205.1| ypt1-related protein 1 [Schizosacch...   154   9e-37
gi|82803|pir||S04590 GTP-binding protein ypt1 - fission yeast  (...   154   9e-37
gi|47217500|emb|CAG10880.1| unnamed protein product [Tetraodon n...   154   9e-37
gi|32398960|emb|CAD98425.1| rab1a protein, probable [Cryptospori...   154   1e-36
gi|7533034|gb|AAF63333.1| YptA [Aspergillus awamori]                  154   1e-36
gi|2500073|sp|Q39571|YPT1_CHLRE GTP-binding protein YPTC1 >gnl|B...   154   1e-36
gi|106187|pir||D34323 GTP-binding protein Rab3B - human >gnl|BL_...   154   2e-36
gi|17737457|ref|NP_523687.1| CG7576-PA [Drosophila melanogaster]...   154   2e-36
gi|30354316|gb|AAH51918.1| Rab3b protein [Mus musculus]               153   2e-36
gi|27806113|ref|NP_776872.1| RAB3B, member RAS oncogene family [...   153   2e-36
gi|12963723|ref|NP_076026.1| RAB3B, member RAS oncogene family [...   153   2e-36
gi|13470090|ref|NP_076341.1| RAB3C, member RAS oncogene family [...   153   2e-36
gi|19424194|ref|NP_598220.1| RAB3C, member RAS oncogene family [...   153   2e-36
gi|1045640|gb|AAC52704.1| rab3c                                       153   2e-36
gi|50550177|ref|XP_502561.1| hypothetical protein [Yarrowia lipo...   153   2e-36
gi|31210411|ref|XP_314172.1| ENSANGP00000015837 [Anopheles gambi...   153   2e-36
gi|13592037|ref|NP_112353.1| Rab3B protein [Rattus norvegicus] >...   153   3e-36
gi|19923750|ref|NP_002858.2| RAB3B, member RAS oncogene family; ...   153   3e-36
gi|27806111|ref|NP_776871.1| RAB3A, member RAS oncogene family [...   153   3e-36
gi|50413456|ref|XP_457265.1| unnamed protein product [Debaryomyc...   152   3e-36
gi|19923985|ref|NP_612462.1| RAB3C, member RAS oncogene family [...   152   3e-36
gi|89584|pir||C29224 GTP-binding protein smg-25C - bovine             152   3e-36
gi|7689363|gb|AAF67748.1| GTP-binding protein RAB3A [Homo sapiens]    152   3e-36
gi|50540122|ref|NP_001002530.1| zgc:92916 [Danio rerio] >gnl|BL_...   152   3e-36
gi|34853590|ref|XP_229401.2| similar to Ras-related protein Rab-...   152   3e-36
gi|24649793|ref|NP_733043.1| CG31118-PA [Drosophila melanogaster...   152   4e-36
gi|15077428|gb|AAK83158.1| small GTP-binding protein Ypt1p [Cand...   152   4e-36
gi|48103608|ref|XP_392879.1| similar to ENSANGP00000012769 [Apis...   152   4e-36
gi|1546067|gb|AAB08102.1| GTPase SUrab10p [Strongylocentrotus pu...   152   6e-36
gi|4930237|pdb|3RAB|A Chain A, Gppnhp-Bound Rab3a At 2.0 A Resol...   152   6e-36
gi|6679593|ref|NP_033027.1| RAB3A, member RAS oncogene family [M...   152   6e-36
gi|4506367|ref|NP_002857.1| RAB3A, member RAS oncogene family; R...   152   6e-36
gi|6981452|ref|NP_037150.1| RAB3A, member RAS oncogene family; R...   152   6e-36
gi|89582|pir||A29224 GTP-binding protein smg-25A - bovine             152   6e-36
gi|10047433|gb|AAG12240.1| guanine nucleotide-binding protein Ra...   151   8e-36
gi|420274|pir||G42148 GTP-binding protein rab16 - rat                 151   8e-36
gi|50751596|ref|XP_422470.1| PREDICTED: similar to RAB3C, member...   151   8e-36
gi|31199873|ref|XP_308884.1| ENSANGP00000012769 [Anopheles gambi...   151   8e-36
gi|45191035|ref|NP_985289.1| AER434Cp [Eremothecium gossypii] >g...   151   1e-35
gi|47216418|emb|CAG01969.1| unnamed protein product [Tetraodon n...   150   1e-35
gi|49256375|gb|AAH74481.1| Unknown (protein for MGC:84786) [Xeno...   150   1e-35
gi|50370044|gb|AAH75980.1| Unknown (protein for MGC:92276) [Dani...   150   2e-35
gi|49115537|gb|AAH73442.1| Unknown (protein for MGC:80943) [Xeno...   150   2e-35
gi|50285709|ref|XP_445283.1| unnamed protein product [Candida gl...   150   2e-35
gi|24648682|ref|NP_732610.1| CG3320-PA [Drosophila melanogaster]...   150   2e-35
gi|24306110|gb|AAN52527.1| GTP-binding protein [Pichia angusta] ...   150   2e-35
gi|23613161|ref|NP_703483.1| Rab1 protein [Plasmodium falciparum...   150   2e-35
gi|4585808|emb|CAB40900.1| putative Rab1A protein [Plasmodium fa...   150   2e-35
gi|50292391|ref|XP_448628.1| unnamed protein product [Candida gl...   149   4e-35
gi|18543235|ref|NP_569921.1| CG14791-PC [Drosophila melanogaster...   149   5e-35
gi|27734452|sp|P59190|RB15_HUMAN Ras-related protein Rab-15           149   5e-35
gi|7438439|pir||T07609 GTP-binding protein SYPT - soybean >gnl|B...   149   5e-35
gi|10047431|gb|AAG12239.1| guanine nucleotide-binding protein Ra...   148   6e-35
gi|1613773|gb|AAB16753.1| Rab1                                        148   6e-35
gi|38454238|ref|NP_942044.1| Ras-related protein Rab-15 [Rattus ...   148   6e-35
gi|31559981|ref|NP_598811.2| RAB15, member RAS oncogene family [...   148   6e-35
gi|5729997|ref|NP_004154.2| RAB27B, member RAS oncogene family [...   148   6e-35
gi|27807425|ref|NP_777163.1| RAB27B, member RAS oncogene family ...   148   6e-35
gi|13385282|ref|NP_085031.1| RAB27b, member RAS oncogene family ...   148   6e-35
gi|2500074|sp|Q39570|YPT4_CHLRE GTP-binding protein YPTC4 >gnl|B...   148   8e-35
gi|4557959|pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector ...   148   8e-35
gi|6320869|ref|NP_010948.1| probably involved in intra-Golgi tra...   148   8e-35
gi|47224370|emb|CAG09216.1| unnamed protein product [Tetraodon n...   147   1e-34
gi|34882806|ref|XP_229263.2| similar to Ras-related protein Rab-...   147   1e-34
gi|5764095|gb|AAD51132.1| small GTP-binding protein rab1 [Theile...   147   1e-34
gi|45360657|ref|NP_989002.1| hypothetical protein MGC75714 [Xeno...   147   1e-34
gi|6321228|ref|NP_011305.1| probably involved in intra-Golgi tra...   147   1e-34
gi|50404925|ref|YP_054017.1| GTP-binding protein RAB2 homolog [P...   147   1e-34
gi|17737545|ref|NP_523970.1| CG7062-PA [Drosophila melanogaster]...   147   2e-34
gi|20129057|ref|NP_608373.1| CG9575-PA [Drosophila melanogaster]...   147   2e-34
gi|549811|sp|P36863|YPT4_VOLCA GTP-binding protein yptV4 (RAB2 h...   146   2e-34
gi|7438379|pir||E71440 GTP-binding protein RAB2A - Arabidopsis t...   146   3e-34
gi|15235981|ref|NP_193450.1| Rab2-like GTP-binding protein (RAB2...   146   3e-34
gi|39595276|emb|CAE60313.1| Hypothetical protein CBG03904 [Caeno...   146   3e-34
gi|1370176|emb|CAA98165.1| RAB2A [Lotus corniculatus var. japoni...   146   3e-34
gi|7438383|pir||S71559 GTP-binding protein rab2 - soybean >gnl|B...   146   3e-34
gi|8394142|ref|NP_059013.1| low Mr GTP-binding protein [Rattus n...   146   3e-34
gi|38051907|gb|AAH60562.1| Unknown (protein for MGC:72799) [Ratt...   145   4e-34
gi|24639106|ref|NP_726743.1| CG14791-PB [Drosophila melanogaster...   145   4e-34
gi|16758202|ref|NP_445911.1| RAB27B, member RAS oncogene family ...   145   4e-34
gi|5738166|gb|AAD50280.1| putative intermediate compartment prot...   145   5e-34
gi|15235980|ref|NP_193449.1| Ras-related GTP-binding protein, pu...   145   5e-34
gi|50752910|ref|XP_413795.1| PREDICTED: similar to Ras-related p...   145   5e-34
gi|5738170|gb|AAD50282.1| putative intermediate compartment prot...   145   5e-34
gi|16755592|gb|AAL28022.1| small GTPase Rab2 [Nicotiana tabacum]      145   7e-34
gi|47212450|emb|CAF94102.1| unnamed protein product [Tetraodon n...   145   7e-34
gi|48141271|ref|XP_397201.1| similar to ENSANGP00000011129 [Apis...   145   7e-34
gi|7508349|pir||T28972 hypothetical protein T23H2.6 - Caenorhabd...   144   9e-34
gi|28828965|gb|AAO51546.1| similar to RAS-related protein [Caeno...   144   9e-34
gi|31205793|ref|XP_311848.1| ENSANGP00000018202 [Anopheles gambi...   144   9e-34
gi|7438437|pir||T03767 GTP-binding protein rab2 - rice >gnl|BL_O...   144   1e-33
gi|13128964|ref|NP_076124.1| RAB27A protein; ashen [Mus musculus...   144   1e-33
gi|32527715|gb|AAP86259.1| Ac2-048 [Rattus norvegicus]                144   1e-33
gi|23480789|gb|EAA17254.1| putative Rab2 GTPase [Plasmodium yoel...   144   2e-33
gi|23508994|ref|NP_701662.1| Rab2 GTPase, putative [Plasmodium f...   144   2e-33
gi|4837727|gb|AAD30658.1| small GTP binding protein Rab2 [Sporob...   144   2e-33
gi|7438438|pir||T04362 GTP-binding protein yptm3 - maize >gnl|BL...   144   2e-33
gi|46806275|dbj|BAD17483.1| putative GTP-binding protein yptm3 [...   144   2e-33
gi|13397937|emb|CAC34627.1| putative Rab2 GTPase [Plasmodium fal...   143   2e-33
gi|17507543|ref|NP_490675.1| RAB family member (23.4 kD) (rab-11...   143   2e-33
gi|47225622|emb|CAG07965.1| unnamed protein product [Tetraodon n...   143   2e-33
gi|1619851|gb|AAB16971.1| rab8-like [Caenorhabditis elegans]          143   2e-33
gi|14249144|ref|NP_116006.1| RAB11B, member RAS oncogene family ...   143   2e-33
gi|49456343|emb|CAG46492.1| RAB11B [Homo sapiens]                     143   2e-33
gi|499068|emb|CAA54506.1| GTPase [Glycine max]                        143   3e-33
gi|32401324|gb|AAP80834.1| GTP-binding protein [Griffithsia japo...   143   3e-33
gi|26341800|dbj|BAC34562.1| unnamed protein product [Mus musculus]    143   3e-33
gi|1346957|sp|P49104|RB2B_MAIZE Ras-related protein Rab-2-B >gnl...   143   3e-33
gi|23503094|sp|P10949|RB3C_BOVIN Ras-related protein Rab-3C (SMG...   143   3e-33
gi|28875789|ref|NP_789862.1| RAB3C, member RAS oncogene family; ...   143   3e-33
gi|32492052|gb|AAP85298.1| Rab2 [Babesia bovis]                       143   3e-33
gi|46193751|emb|CAG25544.1| putative Ras-related GTP-binding pro...   142   4e-33
gi|31199429|ref|XP_308662.1| ENSANGP00000011129 [Anopheles gambi...   142   4e-33
gi|4758986|ref|NP_004209.1| RAB11B, member RAS oncogene family; ...   142   4e-33
gi|15231462|ref|NP_187397.1| Ras-related GTP-binding family prot...   142   4e-33
gi|29647488|dbj|BAC75417.1| putative GTP-binding protein(RAB11G)...   142   5e-33
gi|50754287|ref|XP_414313.1| PREDICTED: similar to Ras-related p...   142   5e-33
gi|19920864|ref|NP_609094.1| CG9100-PB [Drosophila melanogaster]...   142   5e-33
gi|6984166|gb|AAF34783.1| RAB6 protein [Toxoplasma gondii]            142   5e-33
gi|32492050|gb|AAP85297.1| Rab1b [Babesia bovis]                      142   5e-33
gi|6679583|ref|NP_033023.1| RAB11B, member RAS oncogene family [...   142   5e-33
gi|49168476|emb|CAG38733.1| RAB11B [Homo sapiens]                     142   5e-33
gi|2118462|pir||S52646 GTP-binding protein gmr2 - soybean             142   6e-33
gi|19923264|ref|NP_004571.2| Ras-related protein Rab-27A; GTP-bi...   142   6e-33
gi|48146269|emb|CAG33357.1| RAB27A [Homo sapiens]                     142   6e-33
gi|24459169|gb|AAG45502.1| RAB27B [Mus musculus]                      142   6e-33
gi|46359909|gb|AAS88841.1| putative GTP-binding protein [Oryza s...   141   8e-33
gi|1370154|emb|CAA98183.1| RAB11G [Lotus corniculatus var. japon...   141   1e-32
gi|21361418|ref|NP_055303.2| RAB30, member RAS oncogene family [...   141   1e-32
gi|15233367|ref|NP_195311.1| Ras-related GTP-binding protein, pu...   141   1e-32
gi|1346956|sp|P49103|RB2A_MAIZE Ras-related protein Rab-2-A >gnl...   141   1e-32
gi|49523184|gb|AAH75102.1| Unknown (protein for MGC:79588) [Xeno...   141   1e-32
gi|50414608|gb|AAH77245.1| MGC80016 protein [Xenopus laevis]          141   1e-32
gi|15221005|ref|NP_173258.1| Ras-related GTP-binding family prot...   140   1e-32
gi|7438404|pir||T03626 GTP-binding protein Rab11e - common tobac...   140   1e-32
gi|9719734|gb|AAF97836.1| Contains similarity to ras-related GTP...   140   1e-32
gi|31212835|ref|XP_315402.1| ENSANGP00000020903 [Anopheles gambi...   140   2e-32
gi|17137088|ref|NP_477090.1| CG3269-PA [Drosophila melanogaster]...   140   2e-32
gi|38524287|emb|CAD57744.1| RAB-like small G-protein [Hordeum vu...   140   2e-32
gi|15219515|ref|NP_177505.1| Ras-related GTP-binding family prot...   140   2e-32
gi|50731203|ref|XP_417213.1| PREDICTED: similar to RAB30 [Gallus...   140   2e-32
gi|50760924|ref|XP_418183.1| PREDICTED: similar to GTP-binding p...   140   2e-32
gi|50540176|ref|NP_001002555.1| zgc:92772 [Danio rerio] >gnl|BL_...   140   2e-32
gi|131849|sp|P22129|R11B_DISOM Ras-related protein Rab-11B (ORA3...   140   2e-32
gi|31324876|gb|AAP48704.1| rab11-2 [Limulus polyphemus]               140   2e-32
gi|131793|sp|P05714|RB4A_RAT Ras-related protein Rab-4A >gnl|BL_...   140   2e-32
gi|1076457|pir||S52024 GTP-binding protein bra - rape >gnl|BL_OR...   140   2e-32
gi|15224226|ref|NP_181842.1| Ras-related protein (ARA-4) / small...   140   2e-32
gi|18376163|emb|CAD21237.1| probable GTP-binding protein Drab11 ...   140   2e-32
gi|37550537|ref|XP_290714.2| RAB41 protein [Homo sapiens] >gnl|B...   140   2e-32
gi|464526|sp|Q05975|RAB2_LYMST Ras-related protein Rab-2 >gnl|BL...   140   2e-32
gi|12643422|sp|P51159|RB27_HUMAN Ras-related protein Rab-27A (Ra...   140   2e-32
gi|2136080|pir||I39198 Ram/Rab27 - human                              140   2e-32
gi|15230422|ref|NP_187823.1| Ras-related GTP-binding family prot...   140   2e-32
gi|47938712|gb|AAH72158.1| MGC80171 protein [Xenopus laevis]          140   2e-32
gi|46559001|emb|CAG27070.1| small GTPase [Medicago sativa]            140   2e-32
gi|3024502|sp|Q40194|R11D_LOTJA Ras-related protein Rab11D >gnl|...   140   2e-32
gi|14275890|dbj|BAB58891.1| rab-like protein E [Giardia intestin...   139   3e-32
gi|5738168|gb|AAD50281.1| putative intermediate compartment prot...   139   3e-32
gi|17507539|ref|NP_491233.1| RAB family member (23.6 kD) (rab-2)...   139   3e-32
gi|34849826|gb|AAH58382.1| RAB2, member RAS oncogene family [Mus...   139   3e-32
gi|26986192|emb|CAD58914.1| Ras-related protein Rab [Mus musculus]    139   3e-32
gi|49671143|gb|AAH75268.1| Unknown (protein for MGC:88884) [Xeno...   139   3e-32
gi|37788825|gb|AAP51290.1| Rab11-1a [Limulus polyphemus] >gnl|BL...   139   3e-32
gi|31241057|ref|XP_320947.1| ENSANGP00000017643 [Anopheles gambi...   139   4e-32
gi|30677910|ref|NP_171628.2| Ras-related GTP-binding protein, pu...   139   4e-32
gi|15225121|ref|NP_180726.1| Ras-related GTP-binding protein, pu...   139   4e-32
gi|18266415|gb|AAL67567.1| small GTP binding protein rab6 [Babes...   139   4e-32
gi|32414965|ref|XP_327962.1| hypothetical protein ( (NM_017382) ...   139   4e-32
gi|39586261|emb|CAE66672.1| Hypothetical protein CBG12011 [Caeno...   139   4e-32
gi|106185|pir||B34323 GTP-binding protein Rab2 - human >gnl|BL_O...   139   4e-32
gi|1619853|gb|AAB16972.1| rab10-like [Caenorhabditis elegans]         139   4e-32
gi|47216427|emb|CAG01978.1| unnamed protein product [Tetraodon n...   139   4e-32
gi|22597172|gb|AAN03473.1| small GTP-binding protein [Glycine max]    139   4e-32
gi|7438433|pir||T06448 GTP-binding protein - garden pea >gnl|BL_...   139   4e-32
gi|6517192|dbj|BAA87878.1| Drab2 [Drosophila melanogaster]            139   5e-32
gi|31209781|ref|XP_313857.1| ENSANGP00000024287 [Anopheles gambi...   139   5e-32
gi|15219955|ref|NP_173136.1| Ras-related GTP-binding protein, pu...   139   5e-32
gi|47216650|emb|CAG04848.1| unnamed protein product [Tetraodon n...   139   5e-32
gi|50745164|ref|XP_420003.1| PREDICTED: similar to MGC68629 prot...   139   5e-32
gi|7144601|gb|AAF37308.1| RabB [Entamoeba histolytica]                139   5e-32
gi|1588651|prf||2209256A rab2 gene                                    139   5e-32
gi|4506365|ref|NP_002856.1| RAB2, member RAS oncogene family [Ho...   139   5e-32
gi|10946940|ref|NP_067493.1| RAB2, member RAS oncogene family; G...   139   5e-32
gi|41393075|ref|NP_958862.1| RAB2, member RAS oncogene family [D...   139   5e-32
gi|266878|sp|Q01971|RB2A_RABIT Ras-related protein Rab-2A >gnl|B...   139   5e-32
gi|45382561|ref|NP_990559.1| GTP-binding protein [Gallus gallus]...   139   5e-32
gi|26335369|dbj|BAC31385.1| unnamed protein product [Mus musculus]    139   5e-32
gi|27370881|gb|AAH41250.1| Rab11b-prov protein [Xenopus laevis]       139   5e-32
gi|37788823|gb|AAP51289.1| Rab11-1c [Limulus polyphemus]              139   5e-32
gi|15221477|ref|NP_172128.1| Ras-related GTP-binding protein (AR...   138   7e-32
gi|2136076|pir||JC4962 rab protein 30 - human >gnl|BL_ORD_ID|188...   138   7e-32
gi|47216652|emb|CAG04850.1| unnamed protein product [Tetraodon n...   138   7e-32
gi|6981454|ref|NP_037151.1| RAB4A, member RAS oncogene family; R...   138   9e-32
gi|47219616|emb|CAG02661.1| unnamed protein product [Tetraodon n...   138   9e-32
gi|21555752|gb|AAM63927.1| guanine nucleotide regulatory protein...   138   9e-32
gi|7438428|pir||T06443 GTP-binding protein - garden pea >gnl|BL_...   138   9e-32
gi|12851685|dbj|BAB29132.1| unnamed protein product [Mus musculus]    138   9e-32
gi|38344743|emb|CAE03047.2| OSJNBa0089K21.1 [Oryza sativa (japon...   138   9e-32
gi|39587673|emb|CAE58611.1| Hypothetical protein CBG01778 [Caeno...   138   9e-32
gi|13929006|ref|NP_113906.1| RAB2, member RAS oncogene family [R...   138   9e-32
gi|15489394|gb|AAH13790.1| Rab15 protein [Mus musculus]               138   9e-32
gi|38303943|gb|AAH62016.1| Unknown (protein for MGC:72520) [Ratt...   138   9e-32
gi|29337213|sp|P20338|RB4A_HUMAN Ras-related protein Rab-4A           137   1e-31
gi|28556900|dbj|BAC57527.1| GTP-binding protein rab-2 homologue ...   137   1e-31
gi|4758984|ref|NP_004654.1| Ras-related protein Rab-11A; RAB 11A...   137   1e-31
gi|46561764|gb|AAT01087.1| putative rab11 [Homalodisca coagulata]     137   1e-31
gi|49257826|gb|AAH74632.1| Unknown (protein for MGC:69558) [Xeno...   137   1e-31
gi|41150482|ref|XP_370980.1| similar to RAB41 [Homo sapiens]          137   1e-31
gi|49257196|gb|AAH71068.1| Unknown (protein for MGC:78967) [Xeno...   137   1e-31
gi|12856302|dbj|BAB30625.1| unnamed protein product [Mus musculus]    137   1e-31
gi|26336006|dbj|BAC31701.1| unnamed protein product [Mus musculus]    137   1e-31
gi|17137216|ref|NP_477170.1| CG5771-PB [Drosophila melanogaster]...   137   1e-31
gi|25012906|gb|AAN71540.1| RH21315p [Drosophila melanogaster]         137   1e-31
gi|17509579|ref|NP_492966.1| RAB family member (rab-11.2) [Caeno...   137   1e-31
gi|50753230|ref|XP_413914.1| PREDICTED: similar to RAB11a, membe...   137   1e-31
gi|19923260|ref|NP_004569.2| RAB4A, member RAS oncogene family; ...   137   1e-31
gi|50741401|ref|XP_419573.1| PREDICTED: similar to RAB4A, member...   137   1e-31
gi|47550807|ref|NP_999935.1| zgc:55760 [Danio rerio] >gnl|BL_ORD...   137   1e-31
gi|30584069|gb|AAP36283.1| Homo sapiens RAB11A, member RAS oncog...   137   1e-31
gi|39592471|emb|CAE63548.1| Hypothetical protein CBG08034 [Caeno...   137   1e-31
gi|21361884|ref|NP_116235.2| RAB2B protein; RAS family, member R...   137   1e-31
gi|1710015|sp|P51152|RB12_CANFA Ras-related protein Rab-12 >gnl|...   137   1e-31
gi|47937791|gb|AAH72360.1| MGC83515 protein [Xenopus laevis]          137   1e-31
gi|49250515|gb|AAH74609.1| Unknown (protein for MGC:69471) [Xeno...   137   1e-31
gi|560504|emb|CAA82710.1| guanine nucleotide regulatory protein ...   137   1e-31
gi|47217979|emb|CAG02262.1| unnamed protein product [Tetraodon n...   137   1e-31
gi|420271|pir||D42148 GTP-binding protein rab13 - rat (fragment)...   137   1e-31
gi|26892279|gb|AAN86142.1| RAB2B [Homo sapiens]                       137   2e-31
gi|41056251|ref|NP_956417.1| Unknown (protein for MGC:63565); wu...   137   2e-31
gi|7108528|gb|AAF36458.1| small GTPase [Mus musculus]                 137   2e-31
gi|37545057|ref|XP_113967.2| similar to Rab12 protein [Homo sapi...   137   2e-31
gi|49080386|ref|XP_403719.1| hypothetical protein UM06104.1 [Ust...   137   2e-31
gi|48103887|ref|XP_392903.1| similar to RAB18, member RAS oncoge...   137   2e-31
gi|39584751|emb|CAE67646.1| Hypothetical protein CBG13205 [Caeno...   137   2e-31
gi|6759651|gb|AAF27978.1| GTP binding protein; Rab6 [Plasmodium ...   137   2e-31
gi|42543202|pdb|1OIV|A Chain A, X-Ray Structure Of The Small G P...   137   2e-31
gi|17380746|gb|AAL36203.1| putative RAS-related protein ARA-1 [A...   137   2e-31
gi|23481886|gb|EAA18032.1| Rab6 [Plasmodium yoelii yoelii]            137   2e-31
gi|6679595|ref|NP_033029.1| RAB4A, member RAS oncogene family [M...   136   3e-31
gi|27675132|ref|XP_223991.1| similar to Ras-related protein Rab-...   136   3e-31
gi|50418486|gb|AAH77124.1| Unknown (protein for MGC:100812) [Dan...   136   3e-31
gi|548665|sp|P36409|RAB2_DICDI Ras-related protein Rab2 >gnl|BL_...   136   3e-31
gi|13537447|dbj|BAB40678.1| small GTPase Rab11B [Entamoeba histo...   136   3e-31
gi|17555956|ref|NP_499454.1| RAB family member (23.4 kD) (rab-35...   136   3e-31
gi|17543864|ref|NP_502576.1| RAB family member (rab-19) [Caenorh...   136   3e-31
gi|1575675|gb|AAC47440.1| rab6 [Plasmodium falciparum]                136   3e-31
gi|47211718|emb|CAF95873.1| unnamed protein product [Tetraodon n...   136   3e-31
gi|27924185|gb|AAH44974.1| Rab4a-prov protein [Xenopus laevis]        136   3e-31
gi|30525051|ref|NP_766189.1| RAB2B protein [Mus musculus] >gnl|B...   136   3e-31
gi|49084594|ref|XP_404484.1| hypothetical protein AN0347.2 [Aspe...   136   3e-31
gi|23612940|ref|NP_704479.1| Rab18 GTPase, putative [Plasmodium ...   136   3e-31
gi|32451720|gb|AAH54719.1| Unknown (protein for MGC:64765) [Mus ...   136   3e-31
gi|106188|pir||E34323 GTP-binding protein Rab4 - human >gnl|BL_O...   135   4e-31
gi|42561732|ref|NP_563750.2| Ras-related protein (ARA-1) (ARA) /...   135   4e-31
gi|48101226|ref|XP_392651.1| similar to ENSANGP00000020903 [Apis...   135   4e-31
gi|47217415|emb|CAG00775.1| unnamed protein product [Tetraodon n...   135   4e-31
gi|34909538|ref|NP_916116.1| putative GTP-binding protein [Oryza...   135   4e-31
gi|114085|sp|P19892|ARA1_ARATH Ras-related protein ARA-1 >gnl|BL...   135   4e-31
gi|46485881|gb|AAS98506.1| putative GTP-binding protein Rab11 [O...   135   4e-31
gi|5714658|gb|AAD48018.1| Rab GTP-binding protein Rab11a [Gossyp...   135   6e-31
gi|49901476|gb|AAH76437.1| Zgc:100889 protein [Danio rerio]           135   6e-31
gi|31208277|ref|XP_313105.1| ENSANGP00000012897 [Anopheles gambi...   135   6e-31
gi|24641152|ref|NP_727472.1| CG32670-PA [Drosophila melanogaster...   135   6e-31
gi|47217560|emb|CAG02487.1| unnamed protein product [Tetraodon n...   135   6e-31
gi|1628428|emb|CAA63555.1| GTPase; RAB6 [Plasmodium falciparum 3D7]   135   6e-31
gi|21217443|gb|AAM33785.1| Rab11 [Periplaneta americana]              135   6e-31
gi|14275882|dbj|BAB58887.1| rab-like protein A [Giardia intestin...   135   7e-31
gi|10120632|pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium ...   135   7e-31
gi|45383121|ref|NP_989856.1| rab5C-like protein [Gallus gallus] ...   135   7e-31
gi|12837642|dbj|BAB23894.1| unnamed protein product [Mus musculus]    135   7e-31
gi|19114579|ref|NP_593667.1| YPT1-related rab subfamily protein ...   135   7e-31
gi|50737376|ref|XP_419183.1| PREDICTED: similar to Ras-related p...   135   7e-31
gi|29841055|gb|AAP06068.1| similar to GenBank Accession Number S...   135   7e-31
gi|17568765|ref|NP_510572.1| RAB family member (23.4 kD) (rab-14...   135   7e-31


>gi|17570221|ref|NP_508721.1| RAB family member (rab-37)
           [Caenorhabditis elegans]
 gi|7438397|pir||T15123 hypothetical protein W01H2.3 -
           Caenorhabditis elegans
 gi|1946985|gb|AAB52888.1| Rab family protein 37 [Caenorhabditis
           elegans]
 gi|50582487|dbj|BAD32698.1| Rab37 [Caenorhabditis elegans]
          Length = 196

 Score =  399 bits (1024), Expect = e-110
 Identities = 196/196 (100%), Positives = 196/196 (100%)
 Frame = -1

Query: 591 MFLKVMLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGDKKVKLQIWDTA 412
           MFLKVMLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGDKKVKLQIWDTA
Sbjct: 1   MFLKVMLLGDSCTGKTCLLIRYKDGAFLNNNFISTVGIDYRNKLITMGDKKVKLQIWDTA 60

Query: 411 GQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGKEAVQVTLVGNKCDL 232
           GQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGKEAVQVTLVGNKCDL
Sbjct: 61  GQERFRSVTTSYYRDADALLLVYDIANRASFENCRNWLSQIKEYGKEAVQVTLVGNKCDL 120

Query: 231 PRAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAERMLKLKYGFVPGGEMADTIS 52
           PRAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAERMLKLKYGFVPGGEMADTIS
Sbjct: 121 PRAVPTDEGKRLAEAYQIPFMETSAKTGFNVDRAFLGLAERMLKLKYGFVPGGEMADTIS 180

Query: 51  VADTKKPEIARCCTFN 4
           VADTKKPEIARCCTFN
Sbjct: 181 VADTKKPEIARCCTFN 196




[DB home][top]