Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T28C6_6
(900 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3) [C... 142 1e-32
gi|39578930|emb|CAE57041.1| Hypothetical protein CBG24927 [Caeno... 139 7e-32
gi|17538876|ref|NP_502107.1| COLlagen structural gene (28.7 kD) ... 138 2e-31
gi|39593732|emb|CAE62024.1| Hypothetical protein CBG06035 [Caeno... 137 4e-31
gi|17543264|ref|NP_500133.1| COLlagen structural gene (col-108) ... 125 1e-27
gi|48060128|gb|AAK68452.2| Collagen protein 108 [Caenorhabditis ... 125 1e-27
gi|39592038|emb|CAE75258.1| Hypothetical protein CBG23219 [Caeno... 115 1e-24
gi|39592014|emb|CAE75234.1| Hypothetical protein CBG23185 [Caeno... 115 1e-24
gi|39592016|emb|CAE75236.1| Hypothetical protein CBG23187 [Caeno... 115 1e-24
gi|39580357|emb|CAE61462.1| Hypothetical protein CBG05354 [Caeno... 115 2e-24
gi|17539490|ref|NP_500520.1| abnormal RAy Morphology RAM-4, COLl... 115 2e-24
gi|345339|pir||JC1448 collagen col-34 - Caenorhabditis elegans >... 115 2e-24
gi|17561474|ref|NP_505886.1| COLlagen structural gene (29.3 kD) ... 114 2e-24
gi|17564278|ref|NP_505913.1| predicted CDS, COLlagen structural ... 114 4e-24
gi|17561476|ref|NP_505888.1| COLlagen structural gene (col-155) ... 92 2e-17
gi|32453014|gb|AAA96159.2| Collagen protein 33 [Caenorhabditis e... 91 3e-17
gi|1589837|gb|AAC48358.1| cuticle preprocollagen [Meloidogyne in... 90 8e-17
gi|39592242|emb|CAE75463.1| Hypothetical protein CBG23461 [Caeno... 87 4e-16
gi|17563290|ref|NP_506095.1| COLlagen structural gene, SQuaT SQT... 86 9e-16
gi|39585732|emb|CAE59934.1| Hypothetical protein CBG03420 [Caeno... 86 1e-15
gi|39584177|emb|CAE61552.1| Hypothetical protein CBG05461 [Caeno... 86 1e-15
gi|1184072|gb|AAC47437.1| COL-1 86 1e-15
gi|17539482|ref|NP_501829.1| COLlagen structural gene (col-2) [C... 84 4e-15
gi|25153764|ref|NP_741423.1| COLlagen structural gene (28.9 kD) ... 83 1e-14
gi|17539488|ref|NP_500524.1| COLlagen structural gene (col-33) [... 82 1e-14
gi|17539566|ref|NP_500519.1| DumPY : shorter than wild-type DPY-... 82 2e-14
gi|39580356|emb|CAE61461.1| Hypothetical protein CBG05353 [Caeno... 80 5e-14
gi|17566746|ref|NP_505074.1| COLlagen structural gene (29.5 kD) ... 80 6e-14
gi|39590411|emb|CAE66150.1| Hypothetical protein CBG11380 [Caeno... 80 6e-14
gi|17543328|ref|NP_502808.1| COLlagen structural gene (col-134) ... 80 8e-14
gi|39588210|emb|CAE68135.1| Hypothetical protein CBG13781 [Caeno... 79 1e-13
gi|39591778|emb|CAE71356.1| Hypothetical protein CBG18259 [Caeno... 78 2e-13
gi|17540574|ref|NP_502700.1| COLlagen structural gene (col-133) ... 78 3e-13
gi|39584181|emb|CAE61556.1| Hypothetical protein CBG05465 [Caeno... 78 3e-13
gi|17539418|ref|NP_501561.1| COLlagen structural gene (col-119) ... 77 5e-13
gi|17555472|ref|NP_499410.1| COLlagen structural gene (29.2 kD) ... 77 5e-13
gi|39586422|emb|CAE74080.1| Hypothetical protein CBG21735 [Caeno... 77 7e-13
gi|17555480|ref|NP_499408.1| COLlagen structural gene (29.2 kD) ... 77 7e-13
gi|39591777|emb|CAE71355.1| Hypothetical protein CBG18258 [Caeno... 76 1e-12
gi|17555478|ref|NP_499409.1| COLlagen structural gene (29.2 kD) ... 75 2e-12
gi|17538760|ref|NP_501867.1| COLlagen structural gene (29.1 kD) ... 75 2e-12
gi|115397|sp|P08124|CC01_CAEEL Cuticle collagen 1 precursor (Squ... 74 6e-12
gi|32565764|ref|NP_871702.1| COLlagen structural gene (col-95) [... 73 1e-11
gi|115401|sp|P16253|CAC3_HAECO Cuticle collagen 3A3 >gnl|BL_ORD_... 73 1e-11
gi|321006|pir||A44984 collagen - nematode (Haemonchus contortus) 73 1e-11
gi|39584782|emb|CAE67677.1| Hypothetical protein CBG13240 [Caeno... 72 2e-11
gi|32565788|ref|NP_871711.1| predicted CDS, COLlagen structural ... 72 2e-11
gi|39585707|emb|CAE59909.1| Hypothetical protein CBG03393 [Caeno... 72 2e-11
gi|39588940|emb|CAE69570.1| Hypothetical protein CBG15782 [Caeno... 68 2e-10
gi|17553060|ref|NP_499703.1| COLlagen structural gene (col-98) [... 68 2e-10
gi|39594094|emb|CAE70204.1| Hypothetical protein CBG16679 [Caeno... 68 3e-10
gi|39596498|emb|CAE63117.1| Hypothetical protein CBG07414 [Caeno... 67 5e-10
gi|39582210|emb|CAE64161.1| Hypothetical protein CBG08781 [Caeno... 67 7e-10
gi|32698037|emb|CAE11316.1| Hypothetical protein H06A10.2 [Caeno... 66 9e-10
gi|39584781|emb|CAE67676.1| Hypothetical protein CBG13239 [Caeno... 65 2e-09
gi|17560884|ref|NP_504252.1| COLlagen structural gene (col-139) ... 65 3e-09
gi|17542184|ref|NP_501700.1| COLlagen structural gene (29.4 kD) ... 65 3e-09
gi|39596517|emb|CAE63136.1| Hypothetical protein CBG07436 [Caeno... 64 4e-09
gi|39593552|emb|CAE61844.1| Hypothetical protein CBG05818 [Caeno... 64 4e-09
gi|17539522|ref|NP_501150.1| COLlagen structural gene (col-114) ... 64 5e-09
gi|7498195|pir||T34203 hypothetical protein D2024.8 - Caenorhabd... 64 5e-09
gi|39596499|emb|CAE63118.1| Hypothetical protein CBG07415 [Caeno... 63 8e-09
gi|17540822|ref|NP_500071.1| COLlagen structural gene (col-105) ... 63 8e-09
gi|39596527|emb|CAE63146.1| Hypothetical protein CBG07448 [Caeno... 62 2e-08
gi|17568109|ref|NP_510274.1| COLlagen structural gene (col-44) [... 62 2e-08
gi|17551424|ref|NP_510247.1| COLlagen structural gene (col-183) ... 61 3e-08
gi|39588428|emb|CAE72779.1| Hypothetical protein CBG20034 [Caeno... 61 3e-08
gi|39584784|emb|CAE67679.1| Hypothetical protein CBG13242 [Caeno... 61 4e-08
gi|39580392|emb|CAE70951.1| Hypothetical protein CBG17762 [Caeno... 60 5e-08
gi|17535685|ref|NP_496589.1| ROLler: helically twisted, animals ... 59 1e-07
gi|17537301|ref|NP_494562.1| COLlagen structural gene (37.0 kD) ... 57 7e-07
gi|17557099|ref|NP_499700.1| COLlagen structural gene (30.3 kD) ... 57 7e-07
gi|39588941|emb|CAE69571.1| Hypothetical protein CBG15783 [Caeno... 57 7e-07
gi|17543166|ref|NP_500138.1| COLlagen structural gene (29.0 kD) ... 57 7e-07
gi|39583745|emb|CAE63849.1| Hypothetical protein CBG08408 [Caeno... 57 7e-07
gi|159171|gb|AAA29174.1| collagen 8E 56 1e-06
gi|321007|pir||B44984 collagen - nematode (Haemonchus contortus)... 56 1e-06
gi|39580360|emb|CAE61465.1| Hypothetical protein CBG05357 [Caeno... 55 2e-06
gi|115399|sp|P16252|CAC2_HAECO Cuticle collagen 2C >gnl|BL_ORD_I... 55 3e-06
gi|39591412|emb|CAE73466.1| Hypothetical protein CBG20917 [Caeno... 55 3e-06
gi|1236783|emb|CAA65506.1| cuticular collagen [Teladorsagia circ... 54 6e-06
gi|1236781|emb|CAA65507.1| cuticular collagen [Teladorsagia circ... 54 6e-06
gi|17568107|ref|NP_510273.1| COLlagen structural gene (col-9) [C... 53 8e-06
gi|39585824|emb|CAE61237.1| Hypothetical protein CBG05037 [Caeno... 52 1e-05
gi|17569755|ref|NP_509059.1| COLlagen structural gene (28.5 kD) ... 52 2e-05
gi|17539916|ref|NP_500598.1| COLlagen structural gene (col-110) ... 52 2e-05
gi|7507620|pir||T16841 hypothetical protein T10E10.2 - Caenorhab... 52 2e-05
gi|17569753|ref|NP_509060.1| COLlagen structural gene (28.5 kD) ... 51 3e-05
gi|30025105|gb|AAP13769.1| Hypothetical protein T07H6.3b [Caenor... 51 3e-05
gi|17569675|ref|NP_509051.1| COLlagen structural gene (col-166) ... 51 3e-05
gi|39585827|emb|CAE61240.1| Hypothetical protein CBG05040 [Caeno... 51 3e-05
gi|32566594|ref|NP_872267.1| COLlagen structural gene (col-170) ... 51 3e-05
gi|39585826|emb|CAE61239.1| Hypothetical protein CBG05039 [Caeno... 51 3e-05
gi|39585825|emb|CAE61238.1| Hypothetical protein CBG05038 [Caeno... 51 3e-05
gi|17550996|ref|NP_509960.1| COLlagen structural gene (col-180Co... 51 3e-05
gi|39585828|emb|CAE61241.1| Hypothetical protein CBG05041 [Caeno... 51 3e-05
gi|39585817|emb|CAE61230.1| Hypothetical protein CBG05029 [Caeno... 51 3e-05
gi|4809258|gb|AAD30169.1| collagen [Haemonchus contortus] 51 4e-05
gi|563237|gb|AAC46628.1| cuticular collagen Bmcol-2 50 5e-05
gi|32566570|ref|NP_872255.1| COLlagen structural gene (28.4 kD) ... 49 1e-04
gi|39587615|emb|CAE58553.1| Hypothetical protein CBG01712 [Caeno... 49 1e-04
gi|17532495|ref|NP_493660.1| COLlagen structural gene (col-68) [... 49 2e-04
gi|17551382|ref|NP_508395.1| DumPY : shorter than wild-type DPY-... 49 2e-04
gi|39591507|emb|CAE73561.1| Hypothetical protein CBG21031 [Caeno... 48 3e-04
gi|39597358|emb|CAE59586.1| Hypothetical protein CBG02987 [Caeno... 47 6e-04
gi|39597656|emb|CAE68347.1| Hypothetical protein CBG14077 [Caeno... 47 6e-04
gi|17533809|ref|NP_496362.1| COLlagen structural gene (29.2 kD) ... 47 8e-04
gi|32566596|ref|NP_872268.1| COLlagen structural gene (col-171) ... 46 0.001
gi|39586875|emb|CAE62810.1| Hypothetical protein CBG06986 [Caeno... 45 0.002
gi|21954120|gb|AAM80556.1| cuticular collagen [Trichinella spira... 45 0.002
gi|39586728|emb|CAE65770.1| Hypothetical protein CBG10862 [Caeno... 44 0.004
gi|39594125|emb|CAE70235.1| Hypothetical protein CBG16724 [Caeno... 44 0.004
gi|39582304|emb|CAE67553.1| Hypothetical protein CBG13078 [Caeno... 44 0.004
gi|7496625|pir||T15670 hypothetical protein C27H5.5 - Caenorhabd... 44 0.006
gi|17532623|ref|NP_495487.1| COLlagen structural gene (col-36) [... 44 0.006
gi|39593182|emb|CAE64651.1| Hypothetical protein CBG09422 [Caeno... 44 0.006
gi|17567743|ref|NP_509276.1| COLlagen structural gene (30.0 kD) ... 43 0.011
gi|33285161|gb|AAC48094.2| Dumpy : shorter than wild-type protei... 43 0.011
gi|39587054|emb|CAE62989.1| Hypothetical protein CBG07217 [Caeno... 43 0.011
gi|17531395|ref|NP_495104.1| BLIstered cuticle BLI-2, Nematode c... 42 0.014
gi|7378657|emb|CAB85466.1| putative cuticular collagen [Ascaris ... 42 0.019
gi|1814029|gb|AAB41793.1| cuticle collagen [Caenorhabditis brigg... 42 0.024
gi|17559060|ref|NP_505677.1| COLlagen structural gene (col-13) [... 42 0.024
gi|39596930|emb|CAE59157.1| Hypothetical protein CBG02463 [Caeno... 42 0.024
gi|17559058|ref|NP_505678.1| COLlagen structural gene (30.1 kD) ... 42 0.024
gi|17541194|ref|NP_499905.1| COLlagen structural gene (col-101) ... 42 0.024
gi|39593349|emb|CAE64819.1| Hypothetical protein CBG09613 [Caeno... 42 0.024
gi|17567513|ref|NP_509121.1| COLlagen structural gene (35.0 kD) ... 42 0.024
gi|39581442|emb|CAE74724.1| Hypothetical protein CBG22542 [Caeno... 41 0.032
gi|39593181|emb|CAE64650.1| Hypothetical protein CBG09421 [Caeno... 41 0.032
gi|39581447|emb|CAE74729.1| Hypothetical protein CBG22547 [Caeno... 41 0.032
gi|17561542|ref|NP_506283.1| COLlagen structural gene (col-159) ... 41 0.042
gi|7504495|pir||T22827 hypothetical protein F57B1.4 - Caenorhabd... 41 0.042
gi|32567317|ref|NP_506284.2| COLlagen structural gene (30.3 kD) ... 41 0.042
gi|32563818|ref|NP_871912.1| ROLler: helically twisted, animals ... 40 0.054
gi|7494563|pir||T34507 cutical collagen 6 - Caenorhabditis elegans 40 0.054
gi|39595982|emb|CAE67485.1| Hypothetical protein CBG12990 [Caeno... 40 0.054
gi|17535689|ref|NP_495582.1| ROLler: helically twisted, animals ... 40 0.054
gi|84433|pir||JS0167 collagen col-6 - Caenorhabditis elegans >gn... 40 0.054
gi|39585576|emb|CAE65336.1| Hypothetical protein CBG10272 [Caeno... 40 0.071
gi|17536359|ref|NP_496665.1| COLlagen structural gene (col-85) [... 40 0.092
gi|7332272|gb|AAA17398.2| collagen [Caenorhabditis elegans] 40 0.092
gi|543967|sp|P35799|CCD2_CAEEL Cuticle collagen dpy-2 precursor 40 0.092
gi|7494560|pir||T37285 collagen dpy-2 - Caenorhabditis elegans 40 0.092
gi|17532741|ref|NP_495367.1| DumPY : shorter than wild-type DPY-... 40 0.092
gi|24583848|ref|NP_609552.1| CG17211-PA [Drosophila melanogaster... 39 0.12
gi|17543526|ref|NP_502966.1| predicted CDS, COLlagen structural ... 39 0.12
gi|39585885|emb|CAE61299.1| Hypothetical protein CBG05125 [Caeno... 39 0.21
gi|18402397|ref|NP_565703.1| WRKY family transcription factor [A... 39 0.21
gi|687634|gb|AAA62504.1| collagen 39 0.21
gi|32563747|ref|NP_494878.2| COLlagen structural gene (col-17) [... 39 0.21
gi|17542966|ref|NP_501617.1| COLlagen structural gene (col-120) ... 38 0.27
gi|20260804|gb|AAK54092.2| histidine kinase DhkL [Dictyostelium ... 38 0.35
gi|40882294|emb|CAF06117.1| related to PEST phosphatase interact... 38 0.35
gi|32407036|ref|XP_324120.1| hypothetical protein [Neurospora cr... 38 0.35
gi|22026908|ref|NP_611556.2| CG30389-PC [Drosophila melanogaster... 38 0.35
gi|15291219|gb|AAK92878.1| GH12043p [Drosophila melanogaster] >g... 38 0.35
gi|4335794|gb|AAD17458.1| cuticular collagen [Ascaris suum] 37 0.46
gi|28828422|gb|AAL96724.2| similar to Plasmodium falciparum. Hyp... 37 0.46
gi|13445276|emb|CAC35008.1| putative epidermal growth factor rec... 37 0.46
gi|39587231|emb|CAE57699.1| Hypothetical protein CBG00703 [Caeno... 37 0.46
gi|17535253|ref|NP_495759.1| COLlagen structural gene (29.4 kD) ... 37 0.46
gi|34328659|gb|AAO83656.1| putative protein Roco11 [Dictyosteliu... 37 0.60
gi|39590412|emb|CAE66151.1| Hypothetical protein CBG11381 [Caeno... 37 0.78
gi|17531401|ref|NP_493635.1| COLlagen structural gene (col-67Co)... 37 0.78
gi|39586900|emb|CAE62835.1| Hypothetical protein CBG07014 [Caeno... 37 0.78
gi|31200117|ref|XP_309006.1| ENSANGP00000020144 [Anopheles gambi... 37 0.78
gi|17533807|ref|NP_496361.1| COLlagen structural gene (30.9 kD) ... 36 1.0
gi|50550303|ref|XP_502624.1| hypothetical protein [Yarrowia lipo... 36 1.0
gi|39597359|emb|CAE59587.1| Hypothetical protein CBG02988 [Caeno... 36 1.3
gi|16122300|ref|NP_405613.1| exported high-affinity zinc uptake ... 36 1.3
gi|34881305|ref|XP_228502.2| similar to hypothetical protein FLJ... 36 1.3
gi|31201295|ref|XP_309595.1| ENSANGP00000010937 [Anopheles gambi... 35 1.7
gi|31074957|gb|AAP42142.1| RNA-binding protein 6 [Trypanosoma cr... 35 1.7
gi|32407080|ref|XP_324139.1| hypothetical protein [Neurospora cr... 35 1.7
gi|39979199|emb|CAE85570.1| related to histone acetyltransferase... 35 1.7
gi|17510331|ref|NP_491088.1| COLlagen structural gene (col-48) [... 35 1.7
gi|39595524|emb|CAE60562.1| Hypothetical protein CBG04191 [Caeno... 35 1.7
gi|21703896|ref|NP_663424.1| ISG12 [Mus musculus] >gnl|BL_ORD_ID... 35 1.7
gi|31211929|ref|XP_314949.1| ENSANGP00000018805 [Anopheles gambi... 35 1.7
gi|17864374|ref|NP_524764.1| CG11387-PA [Drosophila melanogaster... 35 2.3
gi|39584712|emb|CAE72465.1| Hypothetical protein CBG19638 [Caeno... 35 2.3
gi|39584624|emb|CAE72377.1| Hypothetical protein CBG19530 [Caeno... 35 2.3
gi|45550821|ref|NP_651286.2| CG6892-PA [Drosophila melanogaster]... 35 2.3
gi|49075886|ref|XP_401975.1| hypothetical protein UM04360.1 [Ust... 35 2.3
gi|45553507|ref|NP_996290.1| CG6892-PB [Drosophila melanogaster]... 35 2.3
gi|39586769|emb|CAE65811.1| Hypothetical protein CBG10919 [Caeno... 35 2.3
gi|84431|pir||JS0169 collagen col-14 - Caenorhabditis elegans >g... 35 2.3
gi|46109562|ref|XP_381839.1| hypothetical protein FG01663.1 [Gib... 35 2.3
gi|38103775|gb|EAA50436.1| hypothetical protein MG04195.4 [Magna... 35 3.0
gi|25146680|ref|NP_741733.1| UNCoordinated locomotion UNC-2, vol... 35 3.0
gi|28850285|gb|AAM45304.2| similar to Dictyostelium discoideum (... 35 3.0
gi|32452978|gb|AAP82641.1| Uncoordinated protein 2, isoform d [C... 35 3.0
gi|30059171|gb|AAP13107.1| high voltage activated calcium channe... 35 3.0
gi|28631398|gb|AAO49696.1| similar to Plasmodium falciparum (iso... 35 3.0
gi|7506937|pir||T16778 hypothetical protein T02C5.4 - Caenorhabd... 35 3.0
gi|24653867|ref|NP_611040.1| CG12964-PA [Drosophila melanogaster... 35 3.0
gi|25146677|ref|NP_741732.1| UNCoordinated locomotion UNC-2, vol... 35 3.0
gi|17567621|ref|NP_509162.1| COLlagen structural gene (col-173) ... 35 3.0
gi|4185888|emb|CAA21827.1| EG:EG0007.4 [Drosophila melanogaster] 34 3.9
gi|543968|sp|P35800|CCDA_CAEEL Cuticle collagen dpy-10 precursor... 34 3.9
gi|16769402|gb|AAL28920.1| LD29423p [Drosophila melanogaster] 34 3.9
gi|46436526|gb|EAK95887.1| hypothetical protein CaO19.3568 [Cand... 34 3.9
gi|34851361|ref|XP_238039.2| similar to C230068E13 protein [Ratt... 34 3.9
gi|24640869|ref|NP_572579.2| CG1343-PA [Drosophila melanogaster]... 34 3.9
gi|10998378|gb|AAG25917.1| putative GAL4-like transcriptional ac... 34 3.9
gi|7494559|pir||T28887 collagen dpy-10 - Caenorhabditis elegans 34 3.9
gi|24640871|ref|NP_727360.1| CG1343-PB [Drosophila melanogaster]... 34 3.9
gi|5851948|emb|CAB55429.1| C2H2 zinc finger transcription factor... 34 3.9
gi|17551374|ref|NP_510617.1| COLlagen structural gene (col-186) ... 34 3.9
gi|24639632|ref|NP_572152.2| CG4857-PB [Drosophila melanogaster]... 34 3.9
gi|32565701|ref|NP_495366.2| collagen triple helix repeat family... 34 3.9
gi|687636|gb|AAA62505.1| collagen [Caenorhabditis elegans] 34 5.1
gi|39590294|emb|CAE66032.1| Hypothetical protein CBG11227 [Caeno... 34 5.1
gi|24641144|ref|NP_572666.1| CG11203-PA [Drosophila melanogaster... 34 5.1
gi|24668567|ref|NP_649391.1| CG11440-PA [Drosophila melanogaster... 30 6.0
gi|6425135|gb|AAF08316.1| bZIP transcription factor mafB [Xenopu... 33 6.6
gi|50414684|gb|AAH77255.1| MafB protein [Xenopus laevis] 33 6.6
gi|45549358|ref|NP_572685.2| CG11122-PA [Drosophila melanogaster... 33 6.6
gi|42627815|tpe|CAE00399.1| TPA: putative ISG12(b2) protein [Mus... 33 6.6
gi|24654940|ref|NP_612073.1| CG13908-PA [Drosophila melanogaster... 33 6.6
gi|21428982|gb|AAM50210.1| GH28840p [Drosophila melanogaster] 33 6.6
gi|28574486|ref|NP_609637.2| CG16970-PA [Drosophila melanogaster... 33 6.6
gi|39590295|emb|CAE66033.1| Hypothetical protein CBG11229 [Caeno... 33 8.7
gi|49899749|gb|AAH76786.1| Unknown (protein for MGC:83700) [Xeno... 33 8.7
gi|31210231|ref|XP_314082.1| ENSANGP00000010404 [Anopheles gambi... 33 8.7
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 33 8.7
gi|39591241|emb|CAE73294.1| Hypothetical protein CBG20714 [Caeno... 33 8.7
gi|544374|sp|P36417|GBF_DICDI G-box binding factor (GBF) >gnl|BL... 33 8.7
>gi|17539484|ref|NP_501527.1| COLlagen structural gene (col-3)
[Caenorhabditis elegans]
gi|17542596|ref|NP_501526.1| COLlagen structural gene (28.7 kD)
(col-117) [Caenorhabditis elegans]
gi|7508660|pir||T25407 hypothetical protein T28C6.4 -
Caenorhabditis elegans
gi|3880306|emb|CAA90995.1| C. elegans COL-117 protein
(corresponding sequence T28C6.4) [Caenorhabditis
elegans]
gi|3880308|emb|CAA90997.1| C. elegans COL-3 protein (corresponding
sequence T28C6.6) [Caenorhabditis elegans]
gi|33188211|gb|AAP97868.1| COLlagen structural gene, probable
cuticle component, from embryo to adult (28.7 kD)
(col-117) [Caenorhabditis elegans]
gi|33188215|gb|AAP97870.1| COLlagen structural gene, probable
cuticle component, from embryo to adult (28.7 kD)
(col-3) [Caenorhabditis elegans]
Length = 299
Score = 142 bits (358), Expect = 1e-32
Identities = 69/87 (79%), Positives = 69/87 (79%)
Frame = +1
Query: 1 MDLEQRIKAYRFXXXXXXXXXXXXXXXXXXTLPMVYNYVHHVKRTMHSEINFCKGSAKDI 180
MDLEQRIKAYRF TLPMVYNYVHHVKRTMHSEINFCKGSAKDI
Sbjct: 1 MDLEQRIKAYRFVAYSAVAFSVVAVISVCVTLPMVYNYVHHVKRTMHSEINFCKGSAKDI 60
Query: 181 WSEVNHLKAIPSGNRTARQAGYDAGVT 261
WSEVNHLKAIPSGNRTARQAGYDAGVT
Sbjct: 61 WSEVNHLKAIPSGNRTARQAGYDAGVT 87
Score = 67.0 bits (162), Expect = 5e-10
Identities = 29/29 (100%), Positives = 29/29 (100%)
Frame = +1
Query: 811 TSGGAGEKGICPKYCAIDGGVFFEDGTRR 897
TSGGAGEKGICPKYCAIDGGVFFEDGTRR
Sbjct: 271 TSGGAGEKGICPKYCAIDGGVFFEDGTRR 299