Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T27F2_2
(468 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17564820|ref|NP_505949.1| baculovirus Inhibitory Repeat famil... 325 3e-88
gi|39592102|emb|CAE75322.1| Hypothetical protein CBG23296 [Caeno... 137 1e-31
gi|17557418|ref|NP_506362.1| baculovirus Inhibitory Repeat famil... 97 1e-19
gi|39590550|emb|CAE66290.1| Hypothetical protein CBG11537 [Caeno... 83 2e-15
gi|48104155|ref|XP_392920.1| similar to apoptosis inhibitor surv... 81 9e-15
gi|35902992|ref|NP_919378.1| baculoviral IAP repeat-containing 5... 65 6e-10
gi|22651695|gb|AAM44085.1| survivin/XBIR1 [Xenopus laevis] >gnl|... 62 5e-09
gi|21898548|gb|AAM76714.1| survivin [Xenopus laevis] 62 5e-09
gi|47226058|emb|CAG04432.1| unnamed protein product [Tetraodon n... 61 7e-09
gi|31221273|ref|XP_317026.1| ENSANGP00000019173 [Anopheles gambi... 61 7e-09
gi|34785189|gb|AAH56739.1| Birc5a protein [Danio rerio] 61 7e-09
gi|25990777|gb|AAN76690.1| survivin [Xenopus laevis] 61 9e-09
gi|21624645|ref|NP_660196.1| survivin 2 [Danio rerio] >gnl|BL_OR... 60 1e-08
gi|27762629|gb|AAO20085.1| SIX [Xenopus laevis] 60 2e-08
gi|21355525|ref|NP_650608.1| CG12265-PA [Drosophila melanogaster... 58 8e-08
gi|11560097|ref|NP_071610.1| baculoviral IAP repeat-containing 5... 57 1e-07
gi|12084648|pdb|1F3H|A Chain A, X-Ray Crystal Structure Of The H... 57 1e-07
gi|49456439|emb|CAG46540.1| BIRC5 [Homo sapiens] 57 2e-07
gi|4502145|ref|NP_001159.1| baculoviral IAP repeat-containing pr... 57 2e-07
gi|42662100|dbj|BAD11155.1| survivin-3B protein [Homo sapiens] 57 2e-07
gi|6753090|ref|NP_033819.1| baculoviral IAP repeat-containing 5;... 56 2e-07
gi|4588770|gb|AAD26201.1| survivin121 [Mus musculus] >gnl|BL_ORD... 56 2e-07
gi|14194234|gb|AAK56308.1| survivin delta [Gallus gallus] 56 3e-07
gi|49022775|dbj|BAD23994.1| survivin [Felis catus] 56 3e-07
gi|46576602|sp|Q8I009|BIR5_CANFA Baculoviral IAP repeat-containi... 56 3e-07
gi|11992273|gb|AAG42494.1| survivin [Gallus gallus] 55 4e-07
gi|47228701|emb|CAG07433.1| unnamed protein product [Tetraodon n... 55 7e-07
gi|47523080|ref|NP_999306.1| apoptosis inhibitor survivin [Sus s... 55 7e-07
gi|47604907|dbj|BAD20570.1| survivin [Canis familiaris] 55 7e-07
gi|49258200|ref|NP_001001855.1| baculoviral IAP repeat-containin... 54 1e-06
gi|47207023|emb|CAF91622.1| unnamed protein product [Tetraodon n... 51 1e-05
gi|49085464|ref|XP_404852.1| hypothetical protein AN0715.2 [Aspe... 49 3e-05
gi|21703226|gb|AAM76110.1| inhibitor of apoptosis protein-like p... 48 6e-05
gi|29567173|ref|NP_818735.1| inhibitor of apoptosis protein 3 [A... 47 1e-04
gi|31199163|ref|XP_308529.1| ENSANGP00000016010 [Anopheles gambi... 46 2e-04
gi|9964335|ref|NP_064803.1| inhibitor of apoptosis protein [Amsa... 46 2e-04
gi|47226243|emb|CAG08390.1| unnamed protein product [Tetraodon n... 46 3e-04
gi|46309401|ref|YP_006291.1| ORF53 [Agrotis segetum granulovirus... 46 3e-04
gi|9634331|ref|NP_037870.1| ORF110 iap-3 [Spodoptera exigua nucl... 45 4e-04
gi|50427521|ref|XP_462373.1| unnamed protein product [Debaryomyc... 45 4e-04
gi|48696814|ref|YP_024638.1| ORF99 [Ostreid herpesvirus 1] >gnl|... 44 0.001
gi|46401442|gb|AAS92269.1| IAP-3 [Anticarsia gemmatalis nucleopo... 44 0.001
gi|19075367|ref|NP_587866.1| cut17p [Schizosaccharomyces pombe] ... 44 0.001
gi|7416053|dbj|BAA93676.1| survivin-beta [Homo sapiens] 44 0.002
gi|37651380|ref|NP_932639.1| inhibitor of apoptosis protein 3 [C... 44 0.002
gi|15030166|gb|AAH11338.1| Birc3 protein [Mus musculus] 42 0.003
gi|2133636|pir||S69545 apoptosis inhibitor IAP homolog - fruit f... 42 0.003
gi|14602383|ref|NP_148801.1| ORF17 IAP-3 [Cydia pomonella granul... 42 0.003
gi|9629973|ref|NP_046191.1| inhibitor of apoptosis protein 3 [Or... 42 0.003
gi|2497244|sp|Q24307|IAP2_DROME Apoptosis 2 inhibitor (Inhibitor... 42 0.003
gi|17137140|ref|NP_477127.1| CG8293-PA [Drosophila melanogaster]... 42 0.003
gi|1184314|gb|AAC46988.1| inhibitor of apoptosis protein 42 0.003
gi|1160518|gb|AAC41610.1| apoptosis 2 inhibitor >gnl|BL_ORD_ID|1... 42 0.003
gi|6680696|ref|NP_031490.1| baculoviral IAP repeat-containing 3;... 42 0.003
gi|7447801|pir||S68452 apoptosis inhibitor diap - fruit fly (Dro... 42 0.003
gi|4758752|ref|NP_004527.1| baculoviral IAP repeat-containing 1;... 42 0.004
gi|1145606|gb|AAB08398.1| DIHA 42 0.004
gi|2135814|pir||A55478 neuronal apoptosis inhibitory protein - h... 42 0.004
gi|32766697|gb|AAH55246.1| Birc4 protein [Danio rerio] 42 0.006
gi|48843640|ref|YP_025208.1| inhibitor of apoptosis protein [Neo... 42 0.006
gi|28569275|gb|AAO43578.1| putative inhibitor of apoptosis [Chor... 42 0.006
gi|35902986|ref|NP_919377.1| baculoviral IAP repeat-containing 4... 42 0.006
gi|22788843|ref|NP_690557.1| inhibitor of apoptosis protein IAP ... 42 0.006
gi|50416842|gb|AAH78344.1| Unknown (protein for MGC:91873) [Dani... 42 0.006
gi|44680139|ref|NP_203127.3| baculoviral IAP repeat-containing 8... 41 0.010
gi|45946110|gb|AAH39318.1| Baculoviral IAP repeat-containing 8 [... 41 0.010
gi|21759009|sp|Q96P09|BIR8_HUMAN Baculoviral IAP repeat-containi... 41 0.010
gi|15680241|gb|AAH14475.1| Livin inhibitor of apoptosis, isoform... 41 0.010
gi|21536421|ref|NP_647478.1| livin inhibitor of apoptosis isofor... 41 0.010
gi|41387695|gb|AAS01729.1| baculoviral IAP repeat-containing 7 [... 41 0.010
gi|34810307|pdb|1OXN|A Chain A, Structure And Function Analysis ... 41 0.010
gi|47938181|gb|AAH71665.1| BIRC8 protein [Homo sapiens] 41 0.010
gi|11545910|ref|NP_071444.1| livin inhibitor of apoptosis isofor... 41 0.010
gi|13027446|ref|NP_076477.1| inhibitor of apoptosis protein 1 [R... 40 0.013
gi|29726782|pdb|1NW9|A Chain A, Structure Of Caspase-9 In An Inh... 40 0.013
gi|32528299|ref|NP_001158.2| baculoviral IAP repeat-containing p... 40 0.013
gi|2134780|pir||S69544 apoptosis inhibitor IAP homolog - human >... 40 0.013
gi|1184320|gb|AAC50373.1| X-linked inhibitor of apotosis protein 40 0.013
gi|33622285|ref|NP_891932.1| iap [Cryptophlebia leucotreta granu... 40 0.013
gi|13096716|pdb|1G3F|A Chain A, Nmr Structure Of A 9 Residue Pep... 40 0.013
gi|15826317|pdb|1F9X|A Chain A, Average Nmr Solution Structure O... 40 0.013
gi|13096729|pdb|1G73|C Chain C, Crystal Structure Of Smac Bound ... 40 0.013
gi|11890721|gb|AAG41193.1| inhibitor of apoptosis protein 3 [Rat... 40 0.017
gi|11890719|gb|AAG41192.1| inhibitor of apoptosis protein 3 [Rat... 40 0.017
gi|31199161|ref|XP_308528.1| ENSANGP00000016568 [Anopheles gambi... 40 0.017
gi|33622218|ref|NP_891863.1| iap-3 [Cryptophlebia leucotreta gra... 40 0.017
gi|32698628|ref|NP_872543.1| iap-3 [Adoxophyes orana granuloviru... 40 0.017
gi|47523444|ref|NP_999346.1| putative inhibitor of apoptosis [Su... 40 0.017
gi|11560028|ref|NP_071567.1| baculoviral IAP repeat-containing 4... 40 0.017
gi|10765281|gb|AAG22969.1| inhibitor of apoptosis protein 3 [Rat... 40 0.017
gi|31199159|ref|XP_308527.1| ENSANGP00000009540 [Anopheles gambi... 40 0.022
gi|21759007|sp|Q95M72|BIR8_PANTR Baculoviral IAP repeat-containi... 40 0.022
gi|48843551|ref|YP_025124.1| inhibitor of apoptosis; iap [Neodip... 39 0.029
gi|2497241|sp|Q60989|BIR4_MOUSE Baculoviral IAP repeat-containin... 39 0.029
gi|22000680|gb|AAM88215.1| IAP-like protein [Xenopus laevis] 39 0.038
gi|6753088|ref|NP_033818.1| baculoviral IAP repeat-containing 4;... 39 0.038
gi|33414037|gb|AAP04483.1| inhibitor of apoptosis protein [Danio... 39 0.050
gi|35902971|ref|NP_919376.1| baculoviral IAP repeat-containing 3... 39 0.050
gi|47227150|emb|CAG00512.1| unnamed protein product [Tetraodon n... 39 0.050
gi|50417488|gb|AAH77368.1| Unknown (protein for MGC:81484) [Xeno... 39 0.050
gi|37359682|emb|CAE47763.1| SI:bZ1P14.6.2 (baculoviral IAP repea... 39 0.050
gi|30387263|ref|NP_848342.1| inhibitor of apoptosis 3 [Choriston... 38 0.065
gi|6680698|ref|NP_031491.1| baculoviral IAP repeat-containing 2;... 38 0.065
gi|2497239|sp|Q62210|BIR2_MOUSE Baculoviral IAP repeat-containin... 38 0.065
gi|18138294|ref|NP_542729.1| iap-3 [Helicoverpa zea single nucle... 38 0.065
gi|12597588|ref|NP_075172.1| iap-3 [Heliocoverpa armigera nucleo... 38 0.065
gi|21759006|sp|Q95M71|BIR8_GORGO Baculoviral IAP repeat-containi... 38 0.085
gi|31200751|ref|XP_309323.1| ENSANGP00000017960 [Anopheles gambi... 38 0.085
gi|27903492|gb|AAO24632.1| inhibitor of apoptosis protein-1 [Ict... 38 0.085
gi|50255834|gb|EAL18566.1| hypothetical protein CNBJ2070 [Crypto... 37 0.11
gi|49250339|gb|AAH74562.1| Unknown (protein for MGC:69222) [Xeno... 37 0.11
gi|45479593|gb|AAS66751.1| inhibitor of apoptosis-1 like protein... 37 0.14
gi|10765285|gb|AAG22971.1| inhibitor of apoptosis protein 2 [Rat... 37 0.14
gi|38541348|gb|AAH62055.1| Apoptosis inhibitor 2 [Rattus norvegi... 37 0.14
gi|26050064|gb|AAN77911.1| BIRC1B protein [Mus musculus] 37 0.14
gi|11120700|ref|NP_068520.1| apoptosis inhibitor 2 [Rattus norve... 37 0.14
gi|6754790|ref|NP_035002.1| baculoviral IAP repeat-containing 1b... 37 0.14
gi|26245337|gb|AAN77587.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|26245333|gb|AAN77585.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|26245331|gb|AAN77584.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|5932003|gb|AAD56759.1| neuronal apoptosis inhibitory protein-... 37 0.14
gi|26245339|gb|AAN77588.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|12643314|sp|Q9JIB6|BIRF_MOUSE Baculoviral IAP repeat-containi... 37 0.14
gi|26023804|gb|AAN77617.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|50758779|ref|XP_417413.1| PREDICTED: similar to Baculoviral I... 37 0.14
gi|26245335|gb|AAN77586.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|26023802|gb|AAN77615.1| neuronal apoptosis inhibitory protein... 37 0.14
gi|26023796|gb|AAN77613.1| baculoviral IAP repeat-containing 1b ... 37 0.14
gi|50545427|ref|XP_500251.1| hypothetical protein [Yarrowia lipo... 37 0.14
gi|47213170|emb|CAF94075.1| unnamed protein product [Tetraodon n... 37 0.19
gi|6435634|pdb|1QBH|A Chain A, Solution Structure Of A Baculovir... 37 0.19
gi|25140579|gb|AAN73272.1| pRb-interacting protein RbBP-36 [Homo... 37 0.19
gi|26337375|dbj|BAC32373.1| unnamed protein product [Mus musculus] 37 0.19
gi|4502141|ref|NP_001157.1| baculoviral IAP repeat-containing pr... 37 0.19
gi|26348323|dbj|BAC37801.1| unnamed protein product [Mus musculus] 37 0.19
gi|30387269|ref|NP_848348.1| inhibitor of apoptosis 1 [Choriston... 37 0.19
gi|4502139|ref|NP_001156.1| baculoviral IAP repeat-containing pr... 37 0.19
gi|3978244|gb|AAC83232.1| inhibitor of apoptosis protein-1 [Homo... 37 0.19
gi|7512287|pir||S68449 apoptosis inhibitor hiap-1 - human >gnl|B... 37 0.19
gi|10048468|ref|NP_031592.1| baculoviral IAP repeat-containing 6... 37 0.19
gi|5669090|gb|AAD46161.1| API2-MLT fusion protein [Homo sapiens] 37 0.19
gi|10442822|ref|NP_057336.1| baculoviral IAP repeat-containing 6... 37 0.19
gi|27902277|ref|NP_035001.1| baculoviral IAP repeat-containing 1... 36 0.25
gi|7512288|pir||S68450 apoptosis inhibitor hiap-2 - human >gnl|B... 36 0.25
gi|17863909|gb|AAL46972.1| inhibitor of apotosis protein 1-like ... 36 0.25
gi|34853492|ref|XP_226742.2| baculoviral IAP repeat-containing 1... 36 0.25
gi|9631408|ref|NP_048313.1| ORF MSV242 putative inhibitor of apo... 36 0.25
gi|15042062|gb|AAK81891.1| IAP-like protein 3 [Homo sapiens] 36 0.25
gi|34853608|ref|XP_226743.2| similar to neuronal apoptosis inhib... 36 0.32
gi|45383007|ref|NP_989919.1| inhibitor of apoptosis protein 3 [G... 36 0.32
gi|50731127|ref|XP_417179.1| PREDICTED: similar to IAP homolog [... 35 0.42
gi|26245343|gb|AAN60206.1| neuronal apoptosis inhibitory protein... 35 0.42
gi|5932004|gb|AAD56760.1| neuronal apoptosis inhibitory protein-... 35 0.42
gi|5932010|gb|AAD56763.1| neuronal apoptosis inhibitory protein ... 35 0.42
gi|12585188|sp|Q9JIB3|BIRG_MOUSE Baculoviral IAP repeat-containi... 35 0.42
gi|12643316|sp|Q9QWK5|BIRA_MOUSE Baculoviral IAP repeat-containi... 35 0.42
gi|12643317|sp|Q9R016|BIRE_MOUSE Baculoviral IAP repeat-containi... 35 0.42
gi|9082151|gb|AAF82752.1| neuronal apoptosis inhibitory protein ... 35 0.42
gi|6679008|ref|NP_032696.1| baculoviral IAP repeat-containing 1a... 35 0.42
gi|28489089|ref|XP_283820.1| similar to livin inhibitor of apopt... 35 0.42
gi|2497240|sp|Q90660|BIR_CHICK Inhibitor of apoptosis protein (I... 35 0.42
gi|7021390|gb|AAF35320.1| inhibitor of apoptosis 1 [Gallus gallus] 35 0.42
gi|7021388|gb|AAF35319.1| inhibitor of apoptosis 1 [Gallus gallus] 35 0.42
gi|5932014|gb|AAD56765.1| neuronal apoptosis inhibitory protein ... 35 0.55
gi|26245347|gb|AAN60208.1| neuronal apoptosis inhibitory protein... 35 0.55
gi|26023795|gb|AAN77612.1| baculoviral IAP repeat-containing 1e ... 35 0.55
gi|26023803|gb|AAN77616.1| neuronal apoptosis inhibitory protein... 35 0.55
gi|9055286|ref|NP_035000.1| baculoviral IAP repeat-containing 1e... 35 0.55
gi|26245353|gb|AAN60211.1| neuronal apoptosis inhibitory protein... 35 0.55
gi|26050066|gb|AAN77912.1| BIRC1E protein [Mus musculus] 35 0.55
gi|10120972|pdb|1C9Q|A Chain A, Average Nmr Solution Structure O... 35 0.55
gi|22788840|ref|NP_690554.1| inhibitor of apoptosis protein [Hel... 35 0.55
gi|13786994|pdb|1I3O|E Chain E, Crystal Structure Of The Complex... 35 0.55
gi|7021325|gb|AAF35285.1| inhibitor of apoptosis protein [Spodop... 35 0.72
gi|18655901|pdb|1KMC|C Chain C, Crystal Structure Of The Caspase... 35 0.72
gi|13786998|pdb|1I4O|C Chain C, Crystal Structure Of The XiapCAS... 35 0.72
gi|24286571|gb|AAN46650.1| inhibitor of apoptosis protein [Bomby... 35 0.72
gi|14248546|gb|AAK57560.1| inhibitor of apoptosis protein [Bomby... 35 0.72
gi|20150096|pdb|1I51|E Chain E, Crystal Structure Of Caspase-7 C... 35 0.72
gi|14602331|ref|NP_148878.1| ORF94 IAP [Cydia pomonella granulov... 35 0.72
gi|19569774|gb|AAL92171.1| inhibitor of apotosis protein 1-like ... 35 0.72
gi|24664967|ref|NP_524101.2| CG12284-PA [Drosophila melanogaster... 34 0.94
gi|2497243|sp|Q24306|IAP1_DROME Apoptosis 1 inhibitor (Inhibitor... 34 0.94
gi|38105842|gb|EAA52220.1| hypothetical protein MG04912.4 [Magna... 34 0.94
gi|17943098|pdb|1JD6|A Chain A, Crystal Structure Of Diap1-Bir2H... 34 0.94
gi|46121709|ref|XP_385409.1| hypothetical protein FG05233.1 [Gib... 34 0.94
gi|21430572|gb|AAM50964.1| RE07981p [Drosophila melanogaster] 33 1.6
gi|45550729|ref|NP_649995.2| CG6303-PA [Drosophila melanogaster]... 33 1.6
gi|11068101|ref|NP_068317.1| PxORF98 peptide [Plutella xylostell... 33 2.1
gi|9629979|ref|NP_046197.1| inhibitor of apoptosis protein 1 [Or... 33 2.1
gi|6635437|gb|AAF19819.1| inhibitor of apoptosis protein [Tricho... 33 2.1
gi|46432494|gb|EAK91973.1| hypothetical protein CaO19.994 [Candi... 33 2.1
gi|15320690|ref|NP_203202.1| IAP-1 [Epiphyas postvittana nucleop... 33 2.7
gi|27923004|dbj|BAC55950.1| HcIAP-1 [Hyphantria cunea nucleopoly... 32 3.6
gi|20881240|ref|XP_125133.1| similar to Baculoviral IAP repeat-c... 32 3.6
gi|31206615|ref|XP_312274.1| ENSANGP00000002826 [Anopheles gambi... 32 3.6
gi|11991646|gb|AAG42316.1| apoptosis inhibitor ch-IAP1 [Gallus g... 32 4.6
gi|14591637|ref|NP_143719.1| hypothetical protein PH1893 [Pyroco... 32 4.6
gi|34534379|dbj|BAC86988.1| unnamed protein product [Homo sapiens] 32 6.1
gi|42662705|ref|XP_377071.1| similar to LINE-1 REVERSE TRANSCRIP... 32 6.1
gi|42662696|ref|XP_377072.1| similar to LINE-1 REVERSE TRANSCRIP... 32 6.1
gi|23577874|ref|NP_703017.1| inhibitor of apoptosis - 1 [Rachipl... 31 7.9
gi|37651379|ref|NP_932645.1| inhibitor of apoptosis protein 1 [C... 31 7.9
gi|15673865|ref|NP_268040.1| UDP-N-acetylglucosamine pyrophospho... 31 7.9
gi|50750417|ref|XP_426572.1| PREDICTED: similar to MGC52842 prot... 31 7.9
>gi|17564820|ref|NP_505949.1| baculovirus Inhibitory Repeat family
member, survivin (17.7 kD) (bir-1) [Caenorhabditis
elegans]
gi|7494532|pir||T37471 apoptosis inhibitor homolog T27F2.3 -
Caenorhabditis elegans
gi|2738001|gb|AAB94330.1| inhibitor of apoptosis homolog
[Caenorhabditis elegans]
gi|3880312|emb|CAA98553.1| Hypothetical protein T27F2.3
[Caenorhabditis elegans]
Length = 155
Score = 325 bits (832), Expect = 3e-88
Identities = 155/155 (100%), Positives = 155/155 (100%)
Frame = +1
Query: 1 MAPGTKKKSDMAKFTFYKDRLMTFKNFEYDRDPDAKCTSQAVAQAGFYCTGPQSGKCAFC 180
MAPGTKKKSDMAKFTFYKDRLMTFKNFEYDRDPDAKCTSQAVAQAGFYCTGPQSGKCAFC
Sbjct: 1 MAPGTKKKSDMAKFTFYKDRLMTFKNFEYDRDPDAKCTSQAVAQAGFYCTGPQSGKCAFC 60
Query: 181 NKELDFDPEDDPWYEHTKRDEPCEFVRIGKLDDSELTINDTVRLSQTAMIMTKLFEHEMM 360
NKELDFDPEDDPWYEHTKRDEPCEFVRIGKLDDSELTINDTVRLSQTAMIMTKLFEHEMM
Sbjct: 61 NKELDFDPEDDPWYEHTKRDEPCEFVRIGKLDDSELTINDTVRLSQTAMIMTKLFEHEMM 120
Query: 361 INNLSNHSSSDALFDQLKKVPNTASTTKSNSRRGK 465
INNLSNHSSSDALFDQLKKVPNTASTTKSNSRRGK
Sbjct: 121 INNLSNHSSSDALFDQLKKVPNTASTTKSNSRRGK 155