Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T27E4_7
(432 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17562034|ref|NP_505355.1| heat shock protein (16.3 kD) (hsp-1... 286 5e-77
gi|156335|gb|AAA28067.1| heat shock protein 16-48a [Caenorhabdit... 282 1e-75
gi|123542|sp|P06581|HS16_CAEEL Heat shock protein HSP16-41 >gnl|... 271 2e-72
gi|6757|emb|CAA25731.1| C-terminal fragment of hsp 16-48 [Caenor... 271 2e-72
gi|156339|gb|AAA28070.1| heat shock protein 16-41 266 5e-71
gi|39594516|emb|CAE72094.1| Hypothetical protein CBG19185 [Caeno... 253 4e-67
gi|39589882|emb|CAE60880.1| Hypothetical protein CBG04592 [Caeno... 247 4e-65
gi|39589894|emb|CAE60892.1| Hypothetical protein CBG04607 [Caeno... 234 2e-61
gi|39594518|emb|CAE72096.1| Hypothetical protein CBG19187 [Caeno... 225 2e-58
gi|39589892|emb|CAE60890.1| Hypothetical protein CBG04605 [Caeno... 210 6e-54
gi|32566121|ref|NP_872116.1| heat shock protein (hsp-16.41) [Cae... 179 1e-44
gi|780186|emb|CAA25732.1| unnamed protein product [Caenorhabditi... 178 2e-44
gi|33413599|gb|AAN05752.1| heat shock protein 20 [Haemonchus con... 128 3e-29
gi|46020007|emb|CAG25499.1| heat shock protein 20 [Ostertagia os... 121 3e-27
gi|17562028|ref|NP_503507.1| heat shock protein (hsp-16.2) [Caen... 119 2e-26
gi|39594517|emb|CAE72095.1| Hypothetical protein CBG19186 [Caeno... 118 3e-26
gi|156334|gb|AAA28066.1| heat shock protein 16-1 [Caenorhabditis... 118 3e-26
gi|17562026|ref|NP_505354.1| heat shock protein (hsp-16.1) [Caen... 118 3e-26
gi|39589881|emb|CAE60879.1| Hypothetical protein CBG04591 [Caeno... 118 3e-26
gi|39589895|emb|CAE60893.1| Hypothetical protein CBG04608 [Caeno... 115 1e-25
gi|39594515|emb|CAE72093.1| Hypothetical protein CBG19184 [Caeno... 115 2e-25
gi|585269|sp|Q07160|HS20_NIPBR HEAT SHOCK PROTEIN HOMOLOG (HSP20... 114 4e-25
gi|17559396|ref|NP_506586.1| alpha crystallin family member (5O9... 111 3e-24
gi|39589893|emb|CAE60891.1| Hypothetical protein CBG04606 [Caeno... 106 1e-22
gi|17554792|ref|NP_499316.1| stress Induced Protein SIP-1, heat ... 105 1e-22
gi|39591876|emb|CAE71454.1| Hypothetical protein CBG18371 [Caeno... 102 2e-21
gi|266715|sp|P29779|OV22_ONCVO SMALL HEAT SHOCK PROTEIN OV25-2 88 3e-17
gi|345387|pir||S29693 OV25-2 protein - nematode (Onchocerca volv... 88 3e-17
gi|1362582|pir||S57399 small heat shock protein - nematode (Brug... 86 2e-16
gi|266714|sp|P29778|OV21_ONCVO SMALL HEAT SHOCK PROTEIN OV25-1 86 2e-16
gi|345386|pir||S29692 OV25-1 protein - nematode (Onchocerca volv... 86 2e-16
gi|17559394|ref|NP_506585.1| heat shock protein family member (5... 84 6e-16
gi|345374|pir||S29691 AV25 protein - nematode (Acanthocheilonema... 83 1e-15
gi|47226771|emb|CAG06613.1| unnamed protein product [Tetraodon n... 79 1e-14
gi|224130|prf||1010303P crystallin alphaA 79 1e-14
gi|1518125|gb|AAB07020.1| small heat shock protein [Brugia malayi] 79 3e-14
gi|45384008|ref|NP_990507.1| alpha B-crystallin [Gallus gallus] ... 78 4e-14
gi|6166128|sp|Q05713|CRAB_CHICK Alpha crystallin B chain (Alpha(... 78 4e-14
gi|224123|prf||1010303G crystallin alphaA 78 4e-14
gi|224121|prf||1010303E crystallin alphaA >gnl|BL_ORD_ID|254561 ... 78 4e-14
gi|50344359|emb|CAF02107.1| alphaB-crystallin [Macropus rufus] 77 6e-14
gi|224129|prf||1010303N crystallin alphaA 77 6e-14
gi|224118|prf||1010303B crystallin alphaA 77 7e-14
gi|50344355|emb|CAF02105.1| alphaB-crystallin [Tachyglossus acul... 77 1e-13
gi|224120|prf||1010303D crystallin alphaA >gnl|BL_ORD_ID|1815255... 77 1e-13
gi|6014726|sp|Q91312|CRAB_RANCA Alpha crystallin B chain (Alpha(... 77 1e-13
gi|6014722|sp|O93591|CRAA_ASTFA Alpha crystallin A chain >gnl|BL... 77 1e-13
gi|224128|prf||1010303M crystallin alphaA 77 1e-13
gi|117370|sp|P02505|CRAA_RHEAM Alpha crystallin A chain >gnl|BL_... 77 1e-13
gi|224131|prf||1010303Q crystallin alphaA 77 1e-13
gi|10946519|gb|AAG23866.1| alpha-A crystallin [Clarias fuscus] 77 1e-13
gi|50344361|emb|CAF02108.1| alphaB-crystallin [Elephas maximus] 76 1e-13
gi|544093|sp|Q05557|CRAB_ANAPL Alpha crystallin B chain (Alpha(B... 76 1e-13
gi|50730021|ref|XP_416753.1| PREDICTED: similar to Alpha crystal... 76 1e-13
gi|224117|prf||1010303A crystallin alphaA 76 1e-13
gi|224125|prf||1010303J crystallin alphaA 76 1e-13
gi|117344|sp|P02504|CRAA_CHICK Alpha crystallin A chain >gnl|BL_... 76 1e-13
gi|50344353|emb|CAF02104.1| alphaB-crystallin [Ornithorhynchus a... 76 2e-13
gi|3913361|sp|O12984|CRAA_ANAPL ALPHA CRYSTALLIN A CHAIN >gnl|BL... 76 2e-13
gi|30584657|gb|AAP36581.1| Homo sapiens crystallin, alpha B [syn... 75 2e-13
gi|4503057|ref|NP_001876.1| crystallin, alpha B; heat-shock 20 k... 75 2e-13
gi|117359|sp|P02477|CRAA_PHOPH Alpha crystallin A chain >gnl|BL_... 75 2e-13
gi|224119|prf||1010303C crystallin alphaA 75 2e-13
gi|3913363|sp|O12988|CRAA_COLLI ALPHA CRYSTALLIN A CHAIN >gnl|BL... 75 2e-13
gi|2852648|gb|AAC19161.1| unknown [Homo sapiens] 75 2e-13
gi|3913373|sp|Q90497|CRAA_EUDEL ALPHA CRYSTALLIN A CHAIN >gnl|BL... 75 3e-13
gi|13162243|emb|CAC33095.1| alphaB-crystallin [Nannospalax ehren... 75 4e-13
gi|57580|emb|CAA42911.1| alpha B-crystallin [Rattus rattus] 74 5e-13
gi|50344357|emb|CAF02106.1| alphaB-crystallin [Didelphis marsupi... 74 5e-13
gi|30387800|gb|AAP31996.1| alpha B-crystallin [Rattus sp.] 74 5e-13
gi|16905067|ref|NP_037067.1| crystallin, alpha B; Crystallin, al... 74 5e-13
gi|117343|sp|P02479|CRAA_CERSI Alpha crystallin A chain >gnl|BL_... 74 5e-13
gi|23308655|ref|NP_694482.1| crystallin, alpha A; [a]A-crystalli... 74 5e-13
gi|27805849|ref|NP_776715.1| crystallin, alpha polypeptide 2 [Bo... 74 6e-13
gi|117386|sp|P05811|CRAB_MESAU Alpha crystallin B chain (Alpha(B... 74 6e-13
gi|117348|sp|P02478|CRAA_HORSE Alpha crystallin A chain >gnl|BL_... 74 6e-13
gi|2119188|pir||I48171 alpha-crystallin B chain - golden hamster... 74 6e-13
gi|6753530|ref|NP_034094.1| crystallin, alpha B; crystallin, alp... 74 8e-13
gi|6014723|sp|O73919|CRAA_ORYLA ALPHA CRYSTALLIN A CHAIN >gnl|BL... 74 8e-13
gi|117354|sp|P02484|CRAA_MANJA Alpha crystallin A chain >gnl|BL_... 74 8e-13
gi|117373|sp|P02476|CRAA_TAPIN Alpha crystallin A chain >gnl|BL_... 74 8e-13
gi|50344351|emb|CAF02103.1| alphaA-crystallin [Lygodactylus pict... 74 8e-13
gi|50344349|emb|CAF02102.1| alphaA-crystallin [Sphenodon punctatus] 73 1e-12
gi|117339|sp|P02487|CRAA_BRAVA Alpha crystallin A chain >gnl|BL_... 73 1e-12
gi|6014724|sp|Q91311|CRAA_RANCA Alpha crystallin A chain >gnl|BL... 73 1e-12
gi|123569|sp|P15991|HSB1_CRILO Heat-shock protein beta-1 (HspB1)... 73 1e-12
gi|729207|sp|P41316|CRAB_RABIT Alpha crystallin B chain (Alpha(B... 73 1e-12
gi|7441290|pir||JC5971 alpha-b crystallin - pig 73 1e-12
gi|46576644|sp|Q9EPF3|CRAB_SPAJD Alpha crystallin B chain (Alpha... 72 2e-12
gi|4503055|ref|NP_000385.1| crystallin, alpha A; crystallin, alp... 72 2e-12
gi|117356|sp|P02492|CRAA_OCHPR Alpha crystallin A chain >gnl|BL_... 72 2e-12
gi|117336|sp|P02482|CRAA_ARTJA Alpha crystallin A chain >gnl|BL_... 72 2e-12
gi|1706114|sp|P02493|CRAA_RABIT Alpha crystallin A chain >gnl|BL... 72 2e-12
gi|71464|pir||CYRBAA alpha-crystallin chain A - rabbit >gnl|BL_O... 72 2e-12
gi|117342|sp|P02491|CRAA_CAVPO Alpha crystallin A chain >gnl|BL_... 72 2e-12
gi|27805855|ref|NP_776714.1| crystallin, alpha A [Bos taurus] >g... 72 2e-12
gi|117347|sp|P02471|CRAA_GIRCA Alpha crystallin A chain >gnl|BL_... 72 2e-12
gi|117358|sp|P02495|CRAA_PERPO Alpha crystallin A chain >gnl|BL_... 72 2e-12
gi|117337|sp|P02474|CRAA_BALAC Alpha crystallin A chain >gnl|BL_... 72 2e-12
gi|13431419|sp|P82531|CRAA_PTEPO Alpha crystallin A chain 72 2e-12
gi|71455|pir||CYMQAA alpha-crystallin chain A - rhesus macaque (... 72 2e-12
gi|117345|sp|P02486|CRAA_CHOHO Alpha crystallin A chain >gnl|BL_... 72 3e-12
gi|117350|sp|P02494|CRAA_EULFU Alpha crystallin A chain >gnl|BL_... 72 3e-12
gi|117346|sp|P02503|CRAA_DIDMA Alpha crystallin A chain >gnl|BL_... 72 3e-12
gi|117360|sp|P02475|CRAA_PIG Alpha crystallin A chain >gnl|BL_OR... 72 3e-12
gi|117382|sp|P02480|CRAA_URSUR Alpha crystallin A chain >gnl|BL_... 71 4e-12
gi|117383|sp|P02481|CRAA_ZALCA Alpha crystallin A chain >gnl|BL_... 71 4e-12
gi|13431421|sp|P82533|CRAA_ERIEU Alpha crystallin A chain 71 4e-12
gi|117353|sp|P02502|CRAA_MACRU Alpha crystallin A chain >gnl|BL_... 71 4e-12
gi|49036077|gb|AAG30945.2| heat shock protein hsp20.4 [Bombyx mori] 71 5e-12
gi|117351|sp|P02498|CRAA_LOXAF Alpha crystallin A chain >gnl|BL_... 71 5e-12
gi|117381|sp|P02506|CRAA_TUPTE Alpha crystallin A chain >gnl|BL_... 71 5e-12
gi|1706113|sp|P02488|CRAA_MACMU Alpha crystallin A chain 71 5e-12
gi|31199317|ref|XP_308606.1| ENSANGP00000018891 [Anopheles gambi... 71 5e-12
gi|387134|gb|AAA37471.1| alpha-A-crystallin 70 7e-12
gi|15928913|gb|AAH14920.1| Unknown (protein for IMAGE:3906970) [... 70 7e-12
gi|4504517|ref|NP_001531.1| heat shock 27kDa protein 1; heat sho... 70 7e-12
gi|117341|sp|P02473|CRAA_CANFA Alpha crystallin A chain >gnl|BL_... 70 7e-12
gi|19526477|ref|NP_036666.2| crystallin, alpha A; Crystallin, al... 70 7e-12
gi|117340|sp|P02472|CRAA_CAMDR Alpha crystallin A chain >gnl|BL_... 70 7e-12
gi|662841|gb|AAA62175.1| heat shock protein 27 [Homo sapiens] 70 7e-12
gi|50344345|emb|CAF02100.1| alphaA-crystallin [Ornithorhynchus a... 70 9e-12
gi|224133|prf||1010303T crystallin alphaA 70 9e-12
gi|117335|sp|P06904|CRAA_ALLMI Alpha crystallin A chain >gnl|BL_... 70 9e-12
gi|117355|sp|P02483|CRAA_MUSVI Alpha crystallin A chain >gnl|BL_... 70 9e-12
gi|3121936|sp|Q91517|CRAA_TRASC ALPHA CRYSTALLIN A CHAIN >gnl|BL... 70 9e-12
gi|48103834|ref|XP_395659.1| similar to ENSANGP00000018891 [Apis... 70 1e-11
gi|1170367|sp|P42930|HSB1_RAT Heat-shock protein beta-1 (HspB1) ... 70 1e-11
gi|424145|gb|AAA18336.1| heat shock protein HSP27 70 1e-11
gi|547679|sp|P14602|HSB1_MOUSE Heat-shock protein beta-1 (HspB1)... 70 1e-11
gi|424147|gb|AAA18337.1| heat shock protein 27 70 1e-11
gi|7305173|ref|NP_038588.1| heat shock protein 1; heat shock pro... 70 1e-11
gi|14010865|ref|NP_114176.1| heat shock 27kDa protein 1; Heat sh... 70 1e-11
gi|224126|prf||1010303K crystallin alphaA 70 1e-11
gi|11120618|gb|AAG30944.1| heat shock protein hsp20.8 [Bombyx mo... 70 1e-11
gi|117372|sp|P02485|CRAA_TAMME Alpha crystallin A chain >gnl|BL_... 69 2e-11
gi|19168452|dbj|BAB85811.1| newt alpha A-crystallin [Cynops pyrr... 69 2e-11
gi|117361|sp|P02499|CRAA_PROCA Alpha crystallin A chain >gnl|BL_... 69 2e-11
gi|117368|sp|P02508|CRAA_RANTE ALPHA CRYSTALLIN A CHAIN >gnl|BL_... 69 2e-11
gi|50344347|emb|CAF02101.1| alphaA-crystallin [Elephas maximus] 69 2e-11
gi|48141961|ref|XP_397286.1| similar to ENSANGP00000018891 [Apis... 69 2e-11
gi|47678126|emb|CAE83570.1| small heat shock protein 24.1 [Branc... 69 2e-11
gi|4589828|dbj|BAA76897.1| alpha A crystallin [Xenopus laevis] 69 2e-11
gi|1170366|sp|P42929|HSB1_CANFA Heat-shock protein beta-1 (HspB1... 69 3e-11
gi|45384222|ref|NP_990621.1| inhibitor of actin polymerization [... 69 3e-11
gi|17550410|ref|NP_509045.1| heat shock protein (43.2 kD) (hsp-4... 68 3e-11
gi|39585802|emb|CAE61215.1| Hypothetical protein CBG05009 [Caeno... 68 3e-11
gi|49670440|gb|AAH75197.1| Unknown (protein for MGC:83413) [Xeno... 68 4e-11
gi|71468|pir||CYRTAM alpha-crystallin chain A, minor component -... 68 4e-11
gi|34146976|gb|AAQ62453.1| Heat shock protein protein 17, isofor... 68 4e-11
gi|10946521|gb|AAG23867.1| alpha-B crystallin [Clarias batrachus... 68 4e-11
gi|6016257|sp|O13224|HSB1_POELU Heat-shock protein beta-1 (HspB1... 68 4e-11
gi|15126735|gb|AAH12292.1| Heat shock 27kDa protein 1 [Homo sapi... 67 6e-11
gi|17561234|ref|NP_505165.1| heat shock protein (17.6 kD) (hsp-1... 67 6e-11
gi|17737499|ref|NP_523827.1| CG4533-PA [Drosophila melanogaster]... 67 8e-11
gi|117333|sp|P24623|CRA2_RAT Alpha crystallin A chain, minor com... 67 1e-10
gi|48095014|ref|XP_394333.1| similar to ENSANGP00000018891 [Apis... 67 1e-10
gi|117357|sp|P02501|CRAA_ORYAF Alpha crystallin A chain >gnl|BL_... 67 1e-10
gi|223333|prf||0708219B crystallin alphaA 67 1e-10
gi|6014725|sp|Q64211|CRAA_SPAEH Alpha crystallin A chain, major ... 67 1e-10
gi|117389|sp|P02512|CRAB_SQUAC Alpha crystallin B chain (Alpha(B... 67 1e-10
gi|16751540|gb|AAL27684.1| heat shock protein HSP27-like protein... 66 1e-10
gi|224122|prf||1010303F crystallin alphaA 66 2e-10
gi|41394383|gb|AAS02295.1| Hsp20/alpha-crystallin [Tigriopus jap... 65 2e-10
gi|47223753|emb|CAF98523.1| unnamed protein product [Tetraodon n... 65 2e-10
gi|545503|gb|AAB29956.1| HSP2Dt=small heat shock protein {C-term... 65 2e-10
gi|17553934|ref|NP_498776.1| heat shock protein (hsp-12.2) [Caen... 65 3e-10
gi|39594095|emb|CAE70205.1| Hypothetical protein CBG16680 [Caeno... 65 3e-10
gi|809074|emb|CAA24530.1| crystallin [Rattus norvegicus] 65 3e-10
gi|39590320|emb|CAE66059.1| Hypothetical protein CBG11272 [Caeno... 64 5e-10
gi|71469|pir||CYHYAM alpha-crystallin chain A, minor component -... 64 6e-10
gi|2459696|gb|AAC36146.1| alpha-crystallin cognate protein 25 [P... 64 6e-10
gi|117334|sp|P15990|CRA2_SPAEH Alpha crystallin A chain, minor c... 64 8e-10
gi|21389433|ref|NP_653218.1| heat shock protein, alpha-crystalli... 64 8e-10
gi|45786106|gb|AAH68046.1| Heat shock protein, alpha-crystallin-... 64 8e-10
gi|30794510|ref|NP_038529.1| crystallin, alpha A; lens opacity 1... 63 1e-09
gi|32697971|emb|CAA83227.2| Hypothetical protein ZK1128.7 [Caeno... 63 1e-09
gi|117331|sp|P02497|CRA2_MESAU Alpha crystallin A chain, minor c... 63 1e-09
gi|2655270|gb|AAB87967.1| small heat shock/alpha-crystallin prot... 63 1e-09
gi|40795763|gb|AAR91597.1| intracellular estradiol-binding prote... 62 2e-09
gi|91319|pir||S02143 stress protein, 25K - mouse 62 2e-09
gi|47227157|emb|CAG00519.1| unnamed protein product [Tetraodon n... 62 2e-09
gi|10242308|gb|AAG15376.1| small heat shock protein [Anopheles g... 62 2e-09
gi|20302069|ref|NP_620242.1| heat shock 20-kDa protein [Rattus n... 62 2e-09
gi|48141959|ref|XP_393576.1| similar to ENSANGP00000018891 [Apis... 62 2e-09
gi|7441291|pir||T00703 probable alpha A-crystallin - human >gnl|... 62 3e-09
gi|39590666|emb|CAE65036.1| Hypothetical protein CBG09876 [Caeno... 62 3e-09
gi|17557147|ref|NP_499252.1| alpha crystallin (3L227) [Caenorhab... 61 4e-09
gi|1170369|sp|P42931|HS30_ONCTS HEAT SHOCK PROTEIN 30 (HSP 30) >... 61 4e-09
gi|55516|emb|CAA32818.1| unnamed protein product [Mus sp.] >gnl|... 61 4e-09
gi|50540408|ref|NP_001002670.1| zgc:91937 [Danio rerio] >gnl|BL_... 61 4e-09
gi|12743945|gb|AAK06407.1| alpha-crystallin [Bombyx mori] 61 5e-09
gi|1072001|pir||B39644 actin polymerization inhibitor - turkey (... 61 5e-09
gi|117371|sp|P02509|CRAA_SQUAC Alpha crystallin A chain >gnl|BL_... 61 5e-09
gi|29825385|gb|AAO92281.1| putative heat shock-related protein [... 60 7e-09
gi|31213211|ref|XP_315549.1| ENSANGP00000017611 [Anopheles gambi... 60 9e-09
gi|31213213|ref|XP_315550.1| ENSANGP00000017610 [Anopheles gambi... 60 9e-09
gi|31199323|ref|XP_308609.1| ENSANGP00000018813 [Anopheles gambi... 60 1e-08
gi|13431418|sp|P82530|CRAA_ELERU Alpha crystallin A chain 60 1e-08
gi|47225579|emb|CAG12062.1| unnamed protein product [Tetraodon n... 59 2e-08
gi|31199321|ref|XP_308608.1| ENSANGP00000019416 [Anopheles gambi... 59 2e-08
gi|20825064|ref|XP_145511.1| similar to heat shock 20-kDa protei... 59 3e-08
gi|13324714|ref|NP_077761.1| heat shock protein 2; heat shock 27... 58 4e-08
gi|18426864|ref|NP_569115.1| heat shock 27kD protein 2 [Rattus n... 58 4e-08
gi|4504519|ref|NP_001532.1| heat shock 27kDa protein 2; heat sho... 58 4e-08
gi|39850111|gb|AAH64051.1| Unknown (protein for MGC:73576) [Mus ... 58 4e-08
gi|31199319|ref|XP_308607.1| ENSANGP00000019412 [Anopheles gambi... 57 6e-08
gi|17737553|ref|NP_523999.1| CG4463-PA [Drosophila melanogaster]... 57 8e-08
gi|29743324|ref|XP_293276.1| similar to Heat shock 27 kDa protei... 57 1e-07
gi|39579361|emb|CAE56912.1| Hypothetical protein CBG24755 [Caeno... 57 1e-07
gi|1835585|gb|AAB46594.1| low molecular weight heat shock protei... 56 1e-07
gi|18858475|ref|NP_571232.1| crystallin, alpha B [Danio rerio] >... 56 1e-07
gi|17647527|ref|NP_523994.1| CG4190-PA [Drosophila melanogaster]... 56 2e-07
gi|129359|sp|P12812|P40_SCHMA Major egg antigen (P40) 56 2e-07
gi|48427994|sp|Q04757|HR29_HALRO Body wall muscle protein HR-29 ... 56 2e-07
gi|50760210|ref|XP_417935.1| PREDICTED: small heat shock protein... 56 2e-07
gi|2058737|gb|AAC63387.1| 23kDa heat shock protein ScHSP23 [Sarc... 56 2e-07
gi|71479|pir||CYFGAA alpha-crystallin chain A - edible frog (ten... 56 2e-07
gi|627088|pir||A54521 40k egg antigen (clone 10F5) - fluke (Schi... 55 2e-07
gi|161038|gb|AAA29903.1| major egg antigen 55 2e-07
gi|17509129|ref|NP_492770.1| crystallin alpha B family member (1... 55 4e-07
gi|71489|pir||HHFF23 heat shock protein 23 - fruit fly (Drosophi... 54 5e-07
gi|48374049|ref|NP_001001527.1| small heat shock protein B2 [Gal... 54 7e-07
gi|16751536|gb|AAL27682.1| HR-29-like protein [Ciona intestinalis] 54 9e-07
gi|71491|pir||HHFF27 heat shock protein 27 - fruit fly (Drosophi... 54 9e-07
gi|50760879|ref|XP_425870.1| PREDICTED: similar to heat shock 20... 54 9e-07
gi|47221507|emb|CAG08169.1| unnamed protein product [Tetraodon n... 53 1e-06
gi|38048135|gb|AAR09970.1| similar to Drosophila melanogaster Hs... 52 2e-06
gi|38426810|gb|AAR20447.1| protein kinase H11 [Macaca mulatta] 52 3e-06
gi|17647521|ref|NP_524000.1| CG4466-PA [Drosophila melanogaster]... 52 3e-06
gi|35182|emb|CAA34498.1| p24k-1 (AA 1-91) [Homo sapiens] 52 3e-06
gi|30583967|gb|AAP36232.1| Homo sapiens protein kinase H11 [synt... 51 6e-06
gi|22038137|gb|AAM90297.1| H11 kinase [Canis familiaris] 51 6e-06
gi|5901655|gb|AAD55359.1| protein kinase [Homo sapiens] 51 6e-06
gi|7657146|ref|NP_055180.1| heat shock 27kDa protein 8; protein ... 51 6e-06
gi|13507646|ref|NP_109629.1| heat shock protein 20-like protein;... 51 6e-06
gi|16758408|ref|NP_446064.1| crystallin, alpha C [Rattus norvegi... 51 6e-06
gi|1174256|gb|AAB04143.1| heat shock protein 30 50 7e-06
gi|38146755|gb|AAR11780.1| small 22kd heat shock protein [Chlamy... 50 7e-06
gi|49250492|gb|AAH74681.1| Unknown (protein for MGC:69432) [Xeno... 50 1e-05
gi|47606341|sp||P02500_3 [Segment 3 of 3] Alpha crystallin A chain 50 1e-05
gi|49903676|gb|AAH76806.1| Unknown (protein for MGC:83758) [Xeno... 50 1e-05
gi|4105494|gb|AAD02433.1| truncated hsp25 [Mus musculus] 50 1e-05
gi|241307|gb|AAB20722.1| estrogen receptor-related protein; HSP2... 50 1e-05
gi|17541102|ref|NP_501668.1| heat shock protein (12.6 kD) (hsp-1... 50 1e-05
gi|48096158|ref|XP_392405.1| similar to CG14207-PB [Apis mellifera] 50 1e-05
gi|19920346|ref|NP_608326.1| CG14207-PA [Drosophila melanogaster... 50 1e-05
gi|24643312|ref|NP_728275.1| CG14207-PB [Drosophila melanogaster... 50 1e-05
gi|47606343|sp||P02507_2 [Segment 2 of 2] Alpha crystallin A chain 49 2e-05
gi|47221332|emb|CAF97250.1| unnamed protein product [Tetraodon n... 49 2e-05
gi|23208546|gb|AAN15790.1| heat shock-like protein [Galleria mel... 49 2e-05
gi|42524139|ref|NP_969519.1| probable HspC2 heat shock protein [... 49 3e-05
gi|32450600|gb|AAH54225.1| MGC64408 protein [Xenopus laevis] 49 3e-05
gi|25012203|gb|AAN71217.1| GM22862p [Drosophila melanogaster] 49 3e-05
gi|42522487|ref|NP_967867.1| small heat shock protein [Bdellovib... 49 3e-05
gi|41054471|ref|NP_955948.1| Unknown (protein for MGC:64202); wu... 48 4e-05
gi|156342|gb|AAA28072.1| heat shock protein; (hsp16-48) 48 4e-05
gi|39586355|emb|CAE74012.1| Hypothetical protein CBG21660 [Caeno... 48 4e-05
gi|17647519|ref|NP_523997.1| CG4183-PA [Drosophila melanogaster]... 48 4e-05
gi|50756697|ref|XP_415280.1| PREDICTED: similar to Heat-shock pr... 48 5e-05
gi|24762361|ref|NP_726354.1| CG4533-PB [Drosophila melanogaster]... 48 5e-05
gi|47221506|emb|CAG08168.1| unnamed protein product [Tetraodon n... 47 6e-05
gi|24661523|ref|NP_648304.1| CG4461-PA [Drosophila melanogaster]... 47 8e-05
gi|29170428|emb|CAD80062.1| small heat shock protein B3 [Physete... 47 8e-05
gi|24660381|ref|NP_648155.1| CG7409-PA [Drosophila melanogaster]... 47 1e-04
gi|21750828|dbj|BAC03846.1| unnamed protein product [Homo sapiens] 46 1e-04
gi|7529575|emb|CAB86671.1| dJ336M4.5 (cardiovascular heat shock ... 46 1e-04
gi|12743949|gb|AAK06409.1| alpha-crystallin [Bombyx mori] 46 1e-04
gi|7657202|ref|NP_055239.1| heat shock 27kDa protein family, mem... 46 1e-04
gi|29170454|emb|CAD80076.1| small heat shock protein B3 [Tupaia ... 46 2e-04
gi|49616575|gb|AAT67148.1| heat shock protein 28 [Toxoplasma gon... 46 2e-04
gi|71490|pir||HHFF26 heat shock protein 26 - fruit fly (Drosophi... 46 2e-04
gi|50344365|emb|CAF02110.1| alphaA-crystallin [Caiman crocodilus] 45 2e-04
gi|17550276|ref|NP_509009.1| heat shock protein (hsp-25) [Caenor... 45 3e-04
gi|232279|sp|P30218|HS3C_XENLA HEAT SHOCK PROTEIN 30C >gnl|BL_OR... 45 3e-04
gi|34872418|ref|XP_342967.1| similar to Heat-shock protein, beta... 45 3e-04
gi|39598163|emb|CAE68855.1| Hypothetical protein CBG14817 [Caeno... 45 3e-04
gi|28894835|gb|AAO61437.1| Heat shock protein protein 25, isofor... 45 3e-04
gi|3451480|emb|CAA72158.1| alpha-A-crystallin [Astyanax mexicanus] 45 3e-04
gi|5453688|ref|NP_006299.1| heat shock 27kDa protein 3; heat sho... 45 4e-04
gi|13929052|ref|NP_113938.1| heat shock 27kD protein family, mem... 44 5e-04
gi|12644226|sp|P35385|HSB7_MOUSE Heat-shock protein beta-7 (HspB... 44 5e-04
gi|123581|sp|P05812|HS6A_DROME Heat shock protein 67B1 >gnl|BL_O... 44 5e-04
gi|9910272|ref|NP_064344.1| heat shock protein 3; small heat sho... 44 5e-04
gi|17647523|ref|NP_523998.1| CG4167-PA [Drosophila melanogaster]... 44 7e-04
gi|31542970|ref|NP_038896.2| heat shock protein family, member 7... 44 7e-04
gi|38075302|ref|XP_357224.1| similar to heat shock 27kD protein ... 44 0.001
gi|29170438|emb|CAD80067.1| small heat shock protein B3 [Canis f... 44 0.001
gi|232280|sp|P30219|HS3D_XENLA HEAT SHOCK PROTEIN 30D >gnl|BL_OR... 43 0.001
gi|537532|gb|AAA60267.1| alpha-B-crystallin 43 0.001
gi|39580138|emb|CAE56258.1| Hypothetical protein CBG23899 [Caeno... 43 0.001
gi|39586354|emb|CAE74011.1| Hypothetical protein CBG21659 [Caeno... 43 0.002
gi|28634|emb|CAA32891.1| crystallin [Homo sapiens] 43 0.002
gi|26990030|ref|NP_745455.1| heat shock protein, putative [Pseud... 43 0.002
gi|29170436|emb|CAD80066.1| small heat shock protein B3 [Felis c... 42 0.002
gi|29170442|emb|CAD80070.1| small heat shock protein B3 [Dasypus... 42 0.002
gi|29170434|emb|CAD80065.1| small heat shock protein B3 [Manis s... 42 0.002
gi|17541100|ref|NP_501667.1| small heat shock protein, heat shoc... 42 0.002
gi|1206025|gb|AAB08736.1| p27 42 0.002
gi|29170472|emb|CAD80086.1| small heat shock protein B3 [Myoxus ... 42 0.002
gi|29170458|emb|CAD80078.1| small heat shock protein B3 [Ochoton... 42 0.002
gi|29169863|emb|CAD80069.1| small heat shock protein B3 [Bradypu... 42 0.003
gi|123562|sp|P19244|HS41_PEA 22.7 kDa class IV heat shock protei... 42 0.003
gi|477111|pir||A48113 heat shock protein HSP22.7 - garden pea 42 0.003
gi|29170432|emb|CAD80064.1| small heat shock protein B3 [Equus c... 42 0.003
gi|29170452|emb|CAD80075.1| small heat shock protein B3 [Cynocep... 42 0.003
gi|29170444|emb|CAD80071.1| small heat shock protein B3 [Procavi... 42 0.003
gi|23618982|ref|NP_704944.1| small heat shock protein, putative ... 42 0.003
gi|29170468|emb|CAD80084.1| small heat shock protein B3 [Erethiz... 42 0.003
gi|29170456|emb|CAD80077.1| small heat shock protein B3 [Oryctol... 42 0.003
gi|31200357|ref|XP_309126.1| ENSANGP00000022362 [Anopheles gambi... 42 0.003
gi|29170430|emb|CAD80063.1| small heat shock protein B3 [Sus scr... 42 0.003
gi|29170446|emb|CAD80072.1| small heat shock protein B3 [Orycter... 42 0.003
gi|31200361|ref|XP_309128.1| ENSANGP00000023810 [Anopheles gambi... 42 0.003
gi|31200359|ref|XP_309127.1| ENSANGP00000020554 [Anopheles gambi... 42 0.003
gi|29170466|emb|CAD80083.1| small heat shock protein B3 [Cavia p... 42 0.003
gi|232282|sp|P30236|HS41_SOYBN 22.0 kDa class IV heat shock prot... 42 0.003
gi|7159338|gb|AAF37726.1| LMW heat shock protein [Euphorbia esula] 41 0.005
gi|452947|gb|AAB28816.1| heat shock protein HSP72 homolog [Homo ... 41 0.005
gi|29170464|emb|CAD80082.1| small heat shock protein B3 [Castor ... 41 0.005
gi|46199559|ref|YP_005226.1| small heat shock protein [Thermus t... 41 0.005
gi|24661515|ref|NP_729477.1| CG32041-PB [Drosophila melanogaster... 41 0.005
gi|33285155|gb|AAF59604.2| Hypothetical protein Y55F3BR.6 [Caeno... 41 0.005
gi|29170440|emb|CAD80068.1| small heat shock protein B3 [Erinace... 41 0.006
gi|553897|gb|AAA37469.1| alpha-A crystallin 41 0.006
gi|29169865|emb|CAD80081.1| small heat shock protein B3 [Anomalu... 41 0.006
gi|31874067|emb|CAD97949.1| hypothetical protein [Homo sapiens] 41 0.006
gi|17065922|emb|CAD12371.1| putative HSP20 related protein [Echi... 40 0.008
gi|584634|emb|CAA26348.1| unnamed protein product [Xenopus laevis] 40 0.008
gi|29654474|ref|NP_820166.1| heat shock protein, Hsp20 family [C... 40 0.010
gi|7441305|pir||T07417 heat shock protein 20, chromoplast-associ... 40 0.010
gi|202620|gb|AAA40644.1| alpha A-crystallin 40 0.010
gi|47222772|emb|CAG01739.1| unnamed protein product [Tetraodon n... 40 0.010
gi|50344363|emb|CAF02109.1| alphaA-crystallin [Tupinambis teguixin] 40 0.010
gi|29170470|emb|CAD80085.1| small heat shock protein B3 [Trichys... 40 0.010
gi|29170474|emb|CAD80087.1| small heat shock protein B3 [Sciurus... 40 0.010
gi|2495334|sp|Q95661|HS2C_LYCES Small heat shock protein, chloro... 40 0.010
gi|2129835|pir||S65051 low molecular weight heat shock protein p... 40 0.013
gi|2129836|pir||S72398 low molecular weight heat shock protein p... 40 0.013
gi|31415968|gb|AAP50988.1| hypothetical protein [Oryza sativa (j... 40 0.013
gi|29170448|emb|CAD80073.1| small heat shock protein B3 [Macrosc... 40 0.013
gi|3184154|emb|CAA73114.1| heat shock protein 20 homolog [Taenia... 40 0.013
gi|32400230|emb|CAD80255.1| small heat shock protein [Taenia sag... 40 0.013
gi|34873844|ref|XP_343968.1| similar to small heat shock protein... 40 0.013
gi|29170460|emb|CAD80079.1| small heat shock protein B3 [Dipus s... 40 0.013
gi|15643142|ref|NP_228185.1| heat shock protein, class I [Thermo... 39 0.017
gi|1170368|sp|P46254|HS2M_PEA Heat shock 22 kDa protein, mitocho... 39 0.017
gi|47678124|emb|CAE83569.1| small heat shock protein B3 [Xenopus... 39 0.017
gi|41722891|ref|ZP_00149857.1| COG0071: Molecular chaperone (sma... 39 0.017
gi|123563|sp|P09887|HS2C_SOYBN Chloroplast small heat shock prot... 39 0.017
gi|7512479|pir||G01523 heat shock protein 27 - human 39 0.017
gi|19075661|ref|NP_588161.1| putative heat shock protein 16-Hsp2... 39 0.022
gi|47574924|ref|ZP_00244959.1| COG0071: Molecular chaperone (sma... 39 0.022
gi|202622|gb|AAA40645.1| alpha A-crystallin 39 0.022
gi|29170462|emb|CAD80080.1| small heat shock protein B3 [Dipodom... 39 0.022
gi|13124733|sp|P02515|HS22_DROME Heat shock protein 22 39 0.022
gi|71488|pir||HHFF22 heat shock protein 22 - fruit fly (Drosophi... 39 0.022
gi|38092035|ref|XP_126494.2| RIKEN cDNA 1700007H20 [Mus musculus] 39 0.029
gi|46576643|sp|Q9DAM3|HSB9_MOUSE Heat-shock protein beta-9 (HspB... 39 0.029
gi|15806134|ref|NP_294838.1| heat shock protein, HSP20 family [D... 39 0.029
gi|47216905|emb|CAG02077.1| unnamed protein product [Tetraodon n... 38 0.038
gi|29170450|emb|CAD80074.1| small heat shock protein B3 [Macropu... 38 0.050
gi|46199418|ref|YP_005085.1| small heat shock protein [Thermus t... 38 0.050
gi|15804285|ref|NP_290324.1| heat shock protein [Escherichia col... 37 0.085
gi|24115002|ref|NP_709512.1| heat shock protein [Shigella flexne... 37 0.085
gi|1333849|emb|CAA26697.1| unnamed protein product [Mesocricetus... 37 0.085
gi|2827909|gb|AAB99912.1| alpha-A-crystallin [Homo sapiens] 37 0.085
gi|30064996|ref|NP_839167.1| heat shock protein [Shigella flexne... 37 0.085
gi|232278|sp|P30222|HS2C_PETHY Small heat shock protein, chlorop... 37 0.085
gi|15234985|ref|NP_192763.1| 22.0 kDa ER small heat shock protei... 37 0.11
gi|226281|prf||1504307A alphaA crystallin 37 0.11
gi|8134495|sp|O69241|HSPD_BRAJA Small heat shock protein hspD >g... 37 0.11
gi|7441299|pir||T07031 low molecular weight heat shock protein h... 37 0.11
gi|84991|pir||A20647 heat shock protein 22 - fruit fly (Drosophi... 37 0.11
gi|38639431|gb|AAR25848.1| 17.5 kDa class I heat shock protein [... 37 0.11
gi|27380330|ref|NP_771859.1| small heat shock protein [Bradyrhiz... 37 0.11
gi|21592809|gb|AAM64758.1| heat shock protein, putative [Arabido... 36 0.14
gi|15218934|ref|NP_176195.1| 17.6 kDa class I heat shock protein... 36 0.14
gi|123583|sp|P22979|HS6C_DROME Heat shock protein 67B3 (Heat sho... 36 0.14
gi|24583222|ref|NP_609343.1| CG13133-PA [Drosophila melanogaster... 36 0.19
gi|16762514|ref|NP_458131.1| heat shock protein B [Salmonella en... 36 0.19
gi|15222395|ref|NP_172220.1| 17.8 kDa class I heat shock protein... 36 0.19
gi|21665905|emb|CAD36617.1| small heat-shock protein [Taenia sol... 36 0.19
gi|3122228|sp|Q39818|HS2M_SOYBN Heat shock 22 kDa protein, mitoc... 36 0.19
gi|48141957|ref|XP_393575.1| similar to ENSANGP00000018811 [Apis... 36 0.19
gi|23619263|ref|NP_705225.1| hypothetical protein [Plasmodium fa... 36 0.19
gi|46105595|ref|ZP_00185714.2| COG0071: Molecular chaperone (sma... 36 0.19
gi|45546955|ref|ZP_00187019.1| COG0071: Molecular chaperone (sma... 35 0.25
gi|123560|sp|P12811|HS2C_CHLRE CHLOROPLAST HEAT SHOCK 22 KD PROT... 35 0.25
gi|41059801|gb|AAR99375.1| small heat shock protein [Prunus pers... 35 0.25
gi|15082238|ref|NP_149971.1| heat shock protein, alpha-crystalli... 35 0.25
gi|48855680|ref|ZP_00309838.1| COG0071: Molecular chaperone (sma... 35 0.25
gi|39546375|ref|NP_462708.2| small heat shock protein [Salmonell... 35 0.32
gi|31559712|dbj|BAC77527.1| heat shock protein 26 [Drosophila tr... 35 0.32
gi|23473725|ref|ZP_00129020.1| COG0071: Molecular chaperone (sma... 35 0.32
gi|16422380|gb|AAL22667.1| small heat shock protein [Salmonella ... 35 0.32
gi|31559710|dbj|BAC77526.1| heat shock protein 23 [Drosophila tr... 35 0.32
gi|15790691|ref|NP_280515.1| Vng1771c [Halobacterium sp. NRC-1] ... 35 0.32
gi|9501702|emb|CAB99442.1| HspA protein [Stigmatella aurantiaca] 35 0.32
gi|548963|sp|Q06823|SP21_STIAU Spore protein SP21 >gnl|BL_ORD_ID... 35 0.32
gi|27381682|ref|NP_773211.1| small heat shock protein [Bradyrhiz... 35 0.42
gi|39998282|ref|NP_954233.1| heat shock protein, Hsp20 family [G... 35 0.42
gi|42528209|ref|NP_973307.1| BNR domain protein [Treponema denti... 34 0.55
gi|16120545|ref|NP_403858.1| bacterioferritin [Yersinia pestis] ... 34 0.55
gi|29841390|gb|AAP06422.1| similar to GenBank Accession Number P... 34 0.55
gi|18077633|emb|CAD12403.1| AC1 protein [Tomato yellow leaf curl... 34 0.72
gi|20338756|emb|CAD30054.1| Rep protein [Tomato yellow leaf curl... 34 0.72
gi|23479581|gb|EAA16372.1| hypothetical protein [Plasmodium yoel... 34 0.72
gi|553898|gb|AAA37470.1| alpha-A-ins crystallin 33 0.94
gi|109541|pir||B18860 alpha-crystallin chain A, minor component ... 33 0.94
gi|50344416|emb|CAH03768.1| Rep protein [Tomato yellow leaf curl... 33 0.94
gi|34496632|ref|NP_900847.1| probable small heat shock protein [... 33 0.94
gi|48852684|ref|ZP_00306868.1| COG0071: Molecular chaperone (sma... 33 1.2
gi|2119192|pir||I48183 alpha A crystallin - golden hamster (frag... 33 1.2
gi|44885890|dbj|BAD12046.1| heat shock protein 23 [Lucilia seric... 33 1.2
gi|1206023|gb|AAB08735.1| p27 33 1.2
gi|688439|gb|AAC37570.1| alpha-A-crystallin 33 1.2
gi|50838655|dbj|BAD34492.1| heat shock protein 25 [Gallus gallus] 33 1.2
gi|24114601|ref|NP_709111.1| bacterioferritin [Shigella flexneri... 33 1.6
gi|15803850|ref|NP_289884.1| putative iron storage homoprotein, ... 33 1.6
gi|23509015|ref|NP_701683.1| hypothetical protein [Plasmodium fa... 33 1.6
gi|50769084|ref|XP_423072.1| PREDICTED: similar to proteasome 26... 33 1.6
gi|46142349|ref|ZP_00148446.2| COG0834: ABC-type amino acid tran... 32 2.1
gi|50122953|ref|YP_052120.1| bacterioferritin [Erwinia carotovor... 32 2.1
gi|13509279|emb|CAC35354.1| alphaA-crystallin [Amblysomus hotten... 32 2.1
gi|26190416|emb|CAD32953.1| rhoptry protein [Plasmodium yoelii y... 32 2.7
gi|13195256|gb|AAK15625.1| 235 kDa rhoptry protein [Plasmodium y... 32 2.7
gi|41019386|gb|AAR98585.1| Rep protein [Tomato yellow leaf curl ... 32 2.7
gi|27380331|ref|NP_771860.1| small heat shock protein [Bradyrhiz... 32 2.7
gi|27380341|ref|NP_771870.1| small heat shock protein [Bradyrhiz... 32 2.7
gi|13568405|dbj|BAB40930.1| small heat shock protein [Thermococc... 32 2.7
gi|23509074|ref|NP_701742.1| hypothetical protein [Plasmodium fa... 32 2.7
gi|2119195|pir||B22175 heat shock protein X5 - African clawed fr... 32 2.7
gi|15219566|ref|NP_171879.1| guanylate-binding family protein [A... 32 2.7
gi|23480265|gb|EAA16872.1| 235 kDa rhoptry protein [Plasmodium y... 32 2.7
gi|5731905|emb|CAA44747.1| AL1 ORF [Tomato yellow leaf curl Thai... 32 3.6
gi|50545375|ref|XP_500225.1| hypothetical protein [Yarrowia lipo... 32 3.6
gi|31206949|ref|XP_312441.1| ENSANGP00000022164 [Anopheles gambi... 32 3.6
gi|9632884|ref|NP_049918.1| rep protein [Tomato yellow leaf curl... 32 3.6
gi|22788709|ref|NP_690101.1| Rep protein [Tomato leaf curl Vietn... 32 3.6
gi|4506751|ref|NP_002947.1| restin isoform a; cytoplasmic linker... 32 3.6
gi|15613043|ref|NP_241346.1| small heat shock protein [Bacillus ... 32 3.6
gi|4096392|gb|AAC99868.1| alpha A-crystallin [Sterna fuscata] 32 3.6
gi|4096394|gb|AAC99869.1| alpha A-crystallin [Columba livia] 32 3.6
gi|13509305|emb|CAC35358.1| alphaA-crystallin [Cavia porcellus] 32 3.6
gi|16805029|ref|NP_473058.1| hypothetical protein [Plasmodium fa... 32 3.6
gi|420071|pir||A43336 microtubule-vesicle linker CLIP-170 - huma... 32 3.6
gi|38044112|ref|NP_937883.1| restin isoform b; cytoplasmic linke... 32 3.6
gi|46113031|ref|ZP_00182183.2| COG0396: ABC-type transport syste... 31 4.7
gi|39582062|emb|CAE63705.1| Hypothetical protein CBG08220 [Caeno... 31 4.7
gi|41019393|gb|AAR98591.1| Rep protein [Tomato yellow leaf curl ... 31 4.7
gi|18077640|emb|CAD12409.1| AC1 protein [Tomato yellow leaf curl... 31 4.7
gi|41615132|ref|NP_963630.1| NEQ344 [Nanoarchaeum equitans Kin4-... 31 4.7
gi|46132071|ref|ZP_00202817.1| COG1012: NAD-dependent aldehyde d... 31 4.7
gi|11359991|pir||T46354 hypothetical protein DKFZp434F1016.1 - h... 31 4.7
gi|4096388|gb|AAC99866.1| alpha A-crystallin [Turdus merula] 31 4.7
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 31 4.7
gi|23488745|gb|EAA21389.1| hypothetical protein [Plasmodium yoel... 31 4.7
gi|5902012|ref|NP_008832.1| myosin IXA [Homo sapiens] >gnl|BL_OR... 31 4.7
gi|7489098|pir||T15044 heat shock protein 26, chloroplast - wood... 31 4.7
gi|17508059|ref|NP_492215.1| putative protein of eukaryotic orig... 31 6.1
gi|47155200|emb|CAG28768.1| AC1 protein [Tomato leaf curl China ... 31 6.1
gi|21594417|ref|NP_660168.1| AC1 protein [Tomato yellow leaf cur... 31 6.1
gi|40644611|emb|CAD90078.1| AC1 protein [Tomato leaf curl China ... 31 6.1
gi|20340277|ref|NP_620424.1| AC1 protein [Tobacco curly shoot vi... 31 6.1
gi|23098232|ref|NP_691698.1| hypothetical protein OB0777 [Oceano... 31 6.1
gi|15678879|ref|NP_275996.1| heat shock protein, class I [Methan... 31 6.1
gi|23097494|ref|NP_690960.1| DNA polymerase III delta subunit [O... 31 6.1
gi|20087008|gb|AAM10745.1| gag protein [Saccharomyces kluyveri] 30 8.0
gi|13472178|ref|NP_103745.1| small heat shock protein [Mesorhizo... 30 8.0
gi|16766732|ref|NP_462347.1| bacterioferrin [Salmonella typhimur... 30 8.0
gi|15828629|ref|NP_325989.1| LIPOPROTEIN [Mycoplasma pulmonis UA... 30 8.0
gi|10803427|emb|CAC13129.1| alpha-A crystallin chain [Micropotam... 30 8.0
gi|10803357|emb|CAC13112.1| alpha-A crystallin chain [Erinaceus ... 30 8.0
gi|64787|emb|CAA26347.1| unnamed protein product [Xenopus laevis] 30 8.0
gi|10803353|emb|CAC13113.1| alpha-A crystallin chain [Elephas ma... 30 8.0
gi|123574|sp|P04120|HS3A_XENLA HEAT SHOCK PROTEIN 30A >gnl|BL_OR... 30 8.0
gi|50260086|gb|EAL22749.1| hypothetical protein CNBB1970 [Crypto... 30 8.0
gi|50405583|ref|XP_456428.1| unnamed protein product [Debaryomyc... 30 8.0
>gi|17562034|ref|NP_505355.1| heat shock protein (16.3 kD)
(hsp-16.48) [Caenorhabditis elegans]
gi|17562036|ref|NP_505356.1| heat shock protein (16.3 kD)
(hsp-16.49) [Caenorhabditis elegans]
gi|123547|sp|P02513|HS17_CAEEL Heat shock protein HSP16-48
gi|2144813|pir||HHKW48 heat shock protein 16-48 - Caenorhabditis
elegans
gi|156337|gb|AAA28069.1| heat shock protein 16-48 [Caenorhabditis
elegans]
gi|1458269|gb|AAB04840.1| Heat shock protein protein 16.48
[Caenorhabditis elegans]
gi|1458270|gb|AAB04841.1| Heat shock protein protein 16.49
[Caenorhabditis elegans]
Length = 143
Score = 286 bits (733), Expect = 5e-77
Identities = 143/143 (100%), Positives = 143/143 (100%)
Frame = -1
Query: 432 MLMLRSPFSDSNVLDHFLDEITGSVQFPYWRNADHNSFNFSDNIGEIVNDESKFSVQLDV 253
MLMLRSPFSDSNVLDHFLDEITGSVQFPYWRNADHNSFNFSDNIGEIVNDESKFSVQLDV
Sbjct: 1 MLMLRSPFSDSNVLDHFLDEITGSVQFPYWRNADHNSFNFSDNIGEIVNDESKFSVQLDV 60
Query: 252 SHFKPEDLKIELDGRELKIEGIQEKKSEHGYSKRSFSKMILLPEDVDLTSVKSAISNEGK 73
SHFKPEDLKIELDGRELKIEGIQEKKSEHGYSKRSFSKMILLPEDVDLTSVKSAISNEGK
Sbjct: 61 SHFKPEDLKIELDGRELKIEGIQEKKSEHGYSKRSFSKMILLPEDVDLTSVKSAISNEGK 120
Query: 72 LQIEAPKKTNSSRSIPINFVAKH 4
LQIEAPKKTNSSRSIPINFVAKH
Sbjct: 121 LQIEAPKKTNSSRSIPINFVAKH 143