Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T26C11_3
(1647 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17570091|ref|NP_508339.1| putative protein (XC460) [Caenorhab... 1056 0.0
gi|17536553|ref|NP_496527.1| patterned Expression Site PES-5, pu... 73 2e-11
gi|28829800|gb|AAO52302.1| similar to Homo sapiens (Human). Dent... 72 5e-11
gi|28829491|gb|AAO52024.1| similar to Dictyostelium discoideum (... 57 1e-06
gi|28829283|gb|AAO51825.1| similar to Dictyostelium discoideum (... 56 2e-06
gi|2952545|gb|AAC05577.1| coronin binding protein [Dictyostelium... 56 2e-06
gi|31209367|ref|XP_313650.1| ENSANGP00000003674 [Anopheles gambi... 55 5e-06
gi|28829852|gb|AAO52354.1| similar to Dictyostelium discoideum (... 54 1e-05
gi|28829323|gb|AAO51865.1| similar to Dictyostelium discoideum (... 53 2e-05
gi|50289503|ref|XP_447183.1| unnamed protein product [Candida gl... 53 2e-05
gi|531098|dbj|BAA06461.1| TED3 [Zinnia elegans] 53 2e-05
gi|2707270|gb|AAB92246.1| homeobox-containing protein [Dictyoste... 52 4e-05
gi|107415|pir||A35938 profilaggrin - human (fragments) 51 7e-05
gi|190394|gb|AAA63243.1| profilaggrin 51 7e-05
gi|28828243|gb|AAO50920.1| similar to Plasmodium falciparum (iso... 51 7e-05
gi|23509472|ref|NP_702139.1| hypothetical protein [Plasmodium fa... 51 7e-05
gi|28850409|gb|AAO53177.1| similar to Dictyostelium discoideum (... 51 9e-05
gi|28828501|gb|AAO51109.1| similar to Plasmodium falciparum (iso... 51 9e-05
gi|190406|gb|AAA36487.1| profilaggrin 50 2e-04
gi|42734064|gb|AAS38936.1| similar to Plasmodium falciparum (iso... 50 2e-04
gi|28850414|gb|AAO53180.1| hypothetical protein [Dictyostelium d... 50 2e-04
gi|28828959|gb|AAO51540.1| similar to Plasmodium falciparum. Pla... 50 2e-04
gi|190396|gb|AAA63244.1| profilaggrin 49 3e-04
gi|12314266|emb|CAC13171.1| dJ14N1.1.2 (profilaggrin 3' end) [Ho... 49 3e-04
gi|19424355|gb|AAL88717.1| similar to Plasmodium falciparum (iso... 49 3e-04
gi|39585066|emb|CAE62717.1| Hypothetical protein CBG06872 [Caeno... 49 4e-04
gi|23612668|ref|NP_704229.1| hypothetical protein [Plasmodium fa... 49 4e-04
gi|45550906|ref|NP_722689.2| CG4896-PC [Drosophila melanogaster]... 49 5e-04
gi|45550096|ref|NP_608583.5| CG4896-PD [Drosophila melanogaster]... 49 5e-04
gi|45198396|ref|NP_985425.1| AFL125Wp [Eremothecium gossypii] >g... 49 5e-04
gi|17536883|ref|NP_496526.1| putative nuclear protein (2M112) [C... 48 6e-04
gi|24647644|ref|NP_650611.1| CG4090-PA [Drosophila melanogaster]... 48 8e-04
gi|31201363|ref|XP_309629.1| ENSANGP00000011118 [Anopheles gambi... 48 8e-04
gi|50548953|ref|XP_501947.1| hypothetical protein [Yarrowia lipo... 48 8e-04
gi|7489085|pir||T10265 arabinogalactan-protein AGP2 - Persian to... 47 0.001
gi|23509755|ref|NP_702422.1| hypothetical protein [Plasmodium fa... 47 0.001
gi|28828075|gb|AAO50758.1| similar to Plasmodium falciparum (iso... 47 0.001
gi|6323826|ref|NP_013897.1| DNA damage-responsive protein, expre... 47 0.001
gi|171388|gb|AAA34563.1| DDR48 stress protein 47 0.001
gi|14993576|gb|AAK76360.1| deliriumA [Dictyostelium discoideum] 47 0.001
gi|23481897|gb|EAA18039.1| hypothetical protein [Plasmodium yoel... 47 0.001
gi|28829757|gb|AAO52259.1| similar to Oryza sativa (Rice). Putat... 47 0.001
gi|38099443|gb|EAA46790.1| hypothetical protein MG10484.4 [Magna... 47 0.002
gi|23508281|ref|NP_700950.1| hypothetical protein [Plasmodium fa... 47 0.002
gi|23490316|gb|EAA22124.1| Plasmodium vivax PV1H14195_P-related ... 47 0.002
gi|42733891|gb|AAS38807.1| hypothetical protein [Dictyostelium d... 47 0.002
gi|50543056|ref|XP_499694.1| hypothetical protein [Yarrowia lipo... 46 0.002
gi|23612984|ref|NP_704523.1| hypothetical protein [Plasmodium fa... 46 0.002
gi|23508608|ref|NP_701277.1| hypothetical protein [Plasmodium fa... 46 0.002
gi|39590611|emb|CAE64981.1| Hypothetical protein CBG09816 [Caeno... 46 0.002
gi|23613490|ref|NP_703334.1| hypothetical protein [Plasmodium fa... 46 0.003
gi|23612904|ref|NP_704443.1| hypothetical protein [Plasmodium fa... 46 0.003
gi|23508752|ref|NP_701420.1| hypothetical protein [Plasmodium fa... 46 0.003
gi|23510147|ref|NP_702813.1| DNA replication licensing factor, p... 45 0.004
gi|23612816|ref|NP_704355.1| ATP-dependant helicase, putative [P... 45 0.004
gi|28828651|gb|AAO51254.1| similar to Plasmodium falciparum. Hyp... 45 0.004
gi|28850298|gb|AAM45327.2| similar to Plasmodium falciparum. Hyp... 45 0.005
gi|23509835|ref|NP_702502.1| hypothetical protein [Plasmodium fa... 45 0.005
gi|19569878|gb|AAL92197.1| similar to Plasmodium falciparum (iso... 45 0.005
gi|24642136|ref|NP_511161.2| CG6146-PA [Drosophila melanogaster]... 45 0.007
gi|23507851|ref|NP_700521.1| hypothetical protein [Plasmodium fa... 45 0.007
gi|42733825|gb|AAS38743.1| similar to Dictyostelium discoideum (... 45 0.007
gi|28850383|gb|AAO53158.1| similar to Plasmodium falciparum (iso... 45 0.007
gi|50284807|ref|XP_444831.1| unnamed protein product [Candida gl... 45 0.007
gi|267147|sp|P30189|TOP1_DROME DNA topoisomerase I >gnl|BL_ORD_I... 45 0.007
gi|23507850|ref|NP_700520.1| hypothetical protein [Plasmodium fa... 45 0.007
gi|34328655|gb|AAO83654.1| putative protein Roco9 [Dictyostelium... 45 0.007
gi|3220177|gb|AAC23559.1| epidermal filaggrin [Homo sapiens] 44 0.009
gi|49078454|ref|XP_402978.1| hypothetical protein UM05363.1 [Ust... 44 0.009
gi|41469651|gb|AAS07374.1| hypothetical protein [Oryza sativa (j... 44 0.009
gi|28829861|gb|AAL96744.2| similar to Dictyostelium discoideum (... 44 0.009
gi|23482242|gb|EAA18281.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 44 0.009
gi|23490091|gb|EAA21948.1| homeobox-containing protein [Plasmodi... 44 0.009
gi|23612441|ref|NP_704002.1| hypothetical protein [Plasmodium fa... 44 0.011
gi|28828728|gb|AAO51323.1| similar to Dictyostelium discoideum (... 44 0.011
gi|50750469|ref|XP_422008.1| PREDICTED: similar to peptidyl-prol... 44 0.011
gi|28828675|gb|AAO51278.1| similar to Plasmodium falciparum. Hyp... 44 0.011
gi|17556448|ref|NP_497615.1| rna helicase (3D862) [Caenorhabditi... 44 0.015
gi|23509391|ref|NP_702058.1| hypothetical protein [Plasmodium fa... 44 0.015
gi|23508249|ref|NP_700918.1| PfSNF2L [Plasmodium falciparum 3D7]... 44 0.015
gi|23480259|gb|EAA16868.1| hypothetical protein [Plasmodium yoel... 44 0.015
gi|23510226|ref|NP_702892.1| Plasmodium falciparum trophozoite a... 44 0.015
gi|26554099|ref|NP_758033.1| DNA topoisomerase IV subunit A [Myc... 44 0.015
gi|39586646|emb|CAE69366.1| Hypothetical protein CBG15462 [Caeno... 44 0.015
gi|11359727|pir||T18404 chromatin remodelling complex protein SN... 44 0.015
gi|38110687|gb|EAA56371.1| hypothetical protein MG06342.4 [Magna... 44 0.015
gi|23613074|ref|NP_703396.1| hypothetical protein [Plasmodium fa... 43 0.019
gi|48847365|ref|ZP_00301621.1| COG4932: Predicted outer membrane... 43 0.019
gi|23507835|ref|NP_700505.1| hypothetical protein [Plasmodium fa... 43 0.019
gi|6321874|ref|NP_011950.1| Serine/threonine kinase similar to c... 43 0.019
gi|49134098|ref|XP_413204.1| hypothetical protein AN9067.2 [Aspe... 43 0.025
gi|50422663|ref|XP_459908.1| unnamed protein product [Debaryomyc... 43 0.025
gi|28828645|gb|AAO51248.1| similar to Dictyostelium discoideum (... 43 0.025
gi|46440961|gb|EAL00262.1| hypothetical protein CaO19.5595 [Cand... 43 0.025
gi|23613209|ref|NP_703531.1| RNA-binding protein, putative [Plas... 43 0.025
gi|190404|gb|AAA63248.1| profilaggrin 42 0.033
gi|28828976|gb|AAO51556.1| similar to Plasmodium falciparum. Pro... 42 0.033
gi|47226837|emb|CAG06679.1| unnamed protein product [Tetraodon n... 42 0.033
gi|24643074|ref|NP_573311.1| CG15040-PA [Drosophila melanogaster... 42 0.033
gi|23612786|ref|NP_704325.1| hypothetical protein [Plasmodium fa... 42 0.033
gi|28975391|gb|AAO61781.1| chromo-helicase DNA-binding protein [... 42 0.033
gi|28829873|gb|AAO52370.1| similar to Plasmodium falciparum (iso... 42 0.033
gi|37540584|ref|XP_068121.2| similar to hornerin [Homo sapiens] 42 0.033
gi|47086105|ref|NP_998436.1| zgc:85971 [Danio rerio] >gnl|BL_ORD... 42 0.033
gi|7494254|pir||T18497 hypothetical protein C0780w - malaria par... 42 0.033
gi|28828241|gb|AAO50918.1| similar to Plasmodium falciparum. Hyp... 42 0.033
gi|39583527|emb|CAE73985.1| Hypothetical protein CBG21616 [Caeno... 42 0.033
gi|23612938|ref|NP_704477.1| hypothetical protein [Plasmodium fa... 42 0.033
gi|16805261|ref|NP_473289.1| hypothetical protein [Plasmodium fa... 42 0.033
gi|7489897|pir||T14577 protein kinase YakA (EC 2.7.1.-) - slime ... 42 0.043
gi|23613613|ref|NP_704634.1| exoribonuclease, putative [Plasmodi... 42 0.043
gi|42733612|gb|AAO51072.2| similar to Plasmodium falciparum. Hyp... 42 0.043
gi|23489733|gb|EAA21671.1| hypothetical protein [Plasmodium yoel... 42 0.043
gi|23509723|ref|NP_702390.1| hypothetical protein [Plasmodium fa... 42 0.043
gi|20066260|gb|AAM09367.1| similar to Dictyostelium discoideum (... 42 0.057
gi|38455526|gb|AAR20863.1| histone acetyltransferase [Plasmodium... 42 0.057
gi|23613753|ref|NP_704774.1| hypothetical protein [Plasmodium fa... 42 0.057
gi|23509871|ref|NP_702538.1| hypothetical protein [Plasmodium fa... 42 0.057
gi|32414851|ref|XP_327905.1| predicted protein [Neurospora crass... 42 0.057
gi|23619533|ref|NP_705495.1| malaria antigen [Plasmodium falcipa... 42 0.057
gi|23482551|gb|EAA18503.1| hypothetical protein [Plasmodium yoel... 42 0.057
gi|42734008|gb|AAO52611.2| similar to Plasmodium falciparum (iso... 42 0.057
gi|23508755|ref|NP_701423.1| hypothetical protein [Plasmodium fa... 42 0.057
gi|28829755|gb|AAO52257.1| similar to Plasmodium falciparum (iso... 42 0.057
gi|50365342|ref|YP_053767.1| ATP-dependent RNA helicase [Mesopla... 42 0.057
gi|23612782|ref|NP_704321.1| histone acetyltransferase Gcn5, put... 42 0.057
gi|38099215|gb|EAA46590.1| hypothetical protein MG08933.4 [Magna... 42 0.057
gi|46139911|ref|XP_391646.1| hypothetical protein FG11470.1 [Gib... 42 0.057
gi|16805257|ref|NP_473285.1| hypothetical protein [Plasmodium fa... 42 0.057
gi|28829347|gb|AAO51889.1| similar to Dictyostelium discoideum (... 41 0.074
gi|23619203|ref|NP_705165.1| hypothetical malaria antigen [Plasm... 41 0.074
gi|24653847|ref|NP_725458.1| CG8174-PA [Drosophila melanogaster]... 41 0.074
gi|23619311|ref|NP_705273.1| hypothetical protein [Plasmodium fa... 41 0.074
gi|10242347|gb|AAG15387.1| SR protein kinase 1 [Drosophila melan... 41 0.074
gi|28828403|gb|AAM09320.2| similar to Dictyostelium discoideum (... 41 0.074
gi|28828585|gb|AAO51188.1| similar to Dictyostelium discoideum (... 41 0.074
gi|28828660|gb|AAO51263.1| similar to Plasmodium falciparum (iso... 41 0.074
gi|4098582|gb|AAD00328.1| RBM1 [Sminthopsis macroura] 41 0.074
gi|23509783|ref|NP_702450.1| hypothetical protein [Plasmodium fa... 41 0.074
gi|28829282|gb|AAO51824.1| similar to Plasmodium falciparum (iso... 41 0.074
gi|23612647|ref|NP_704208.1| hypothetical protein [Plasmodium fa... 41 0.074
gi|23612632|ref|NP_704193.1| ubiquitin carboxyl-terminal hydrola... 41 0.074
gi|28510494|ref|XP_110955.2| similar to hypothetical protein DKF... 41 0.074
gi|23508081|ref|NP_700751.1| hypothetical protein, conserved [Pl... 41 0.074
gi|23612987|ref|NP_704526.1| hypothetical protein [Plasmodium fa... 41 0.074
gi|49485657|ref|YP_042878.1| clumping factor [Staphylococcus aur... 41 0.074
gi|23613219|ref|NP_703541.1| hypothetical protein [Plasmodium fa... 41 0.074
gi|24653851|ref|NP_725459.1| CG8174-PC [Drosophila melanogaster]... 41 0.074
gi|50732165|ref|XP_418510.1| PREDICTED: similar to huntingtin in... 41 0.074
gi|50546531|ref|XP_500735.1| hypothetical protein [Yarrowia lipo... 41 0.074
gi|27819757|gb|AAL25498.2| SD03158p [Drosophila melanogaster] 41 0.097
gi|23478957|gb|EAA15908.1| putative replication A protein [Plasm... 41 0.097
gi|28828277|gb|AAL93580.2| similar to Plasmodium falciparum. Hyp... 41 0.097
gi|33862529|ref|NP_894089.1| Hemolysin-type calcium-binding regi... 41 0.097
gi|29500803|gb|AAO75106.1| ComB [Dictyostelium discoideum] 41 0.097
gi|28829832|gb|AAO52334.1| similar to Plasmodium falciparum (iso... 41 0.097
gi|16805229|ref|NP_473257.1| binding protein, putative; hypothet... 41 0.097
gi|7406675|emb|CAB85631.1| putative ripening-related protein [Vi... 41 0.097
gi|23481235|gb|EAA17572.1| similar to splicing factor, arginine/... 41 0.097
gi|23509537|ref|NP_702204.1| hypothetical protein [Plasmodium fa... 41 0.097
gi|49481396|ref|YP_038778.1| spore germination protein [Bacillus... 41 0.097
gi|23507955|ref|NP_700625.1| hypothetical protein [Plasmodium fa... 41 0.097
gi|42733859|gb|AAS38777.1| similar to Plasmodium falciparum (iso... 41 0.097
gi|23486965|gb|EAA20930.1| hypothetical protein [Plasmodium yoel... 41 0.097
gi|17544254|ref|NP_500082.1| CaLPain family member (86.3 kD) (cl... 41 0.097
gi|42518229|ref|NP_964159.1| hypothetical protein LJ0143 [Lactob... 41 0.097
gi|22074306|gb|AAL08115.1| serine-aspartate repeat protein [Stap... 41 0.097
gi|28828782|gb|AAO51377.1| similar to Plasmodium falciparum (iso... 41 0.097
gi|28850430|gb|AAO53194.1| similar to Plasmodium falciparum. Hyp... 41 0.097
gi|45550970|ref|NP_723771.2| CG5792-PB [Drosophila melanogaster]... 41 0.097
gi|23481167|gb|EAA17525.1| AT hook motif, putative [Plasmodium y... 41 0.097
gi|23619442|ref|NP_705404.1| hypothetical protein [Plasmodium fa... 41 0.097
gi|9757420|emb|CAC03100.1| erythrocyte membrane-associated antig... 40 0.13
gi|478663|pir||S23692 erythrocyte membrane-associated antigen (c... 40 0.13
gi|16805007|ref|NP_473036.1| hypothetical protein [Plasmodium fa... 40 0.13
gi|50305209|ref|XP_452563.1| unnamed protein product [Kluyveromy... 40 0.13
gi|39581712|emb|CAE71045.1| Hypothetical protein CBG17887 [Caeno... 40 0.13
gi|48141171|ref|XP_397192.1| similar to ENSANGP00000010721 [Apis... 40 0.13
gi|28828422|gb|AAL96724.2| similar to Plasmodium falciparum. Hyp... 40 0.13
gi|23619373|ref|NP_705335.1| hypothetical protein [Plasmodium fa... 40 0.13
gi|23484370|gb|EAA19724.1| NUDIX domain, putative [Plasmodium yo... 40 0.13
gi|26553691|ref|NP_757625.1| hypothetical protein MYPE2390 [Myco... 40 0.13
gi|19923672|ref|NP_036922.2| dentin sailophosphoprotein; Dentin ... 40 0.13
gi|28828411|gb|AAL96711.2| similar to Arabidopsis thaliana (Mous... 40 0.13
gi|23508973|ref|NP_701641.1| hypothetical protein [Plasmodium fa... 40 0.13
gi|23482633|gb|EAA18561.1| hypothetical protein [Plasmodium yoel... 40 0.13
gi|14133659|gb|AAK54093.1| histidine kinase DhkM [Dictyostelium ... 40 0.13
gi|15426274|ref|NP_203562.1| haor [Helicoverpa armigera nuclear ... 40 0.13
gi|39589370|emb|CAE74399.1| Hypothetical protein CBG22131 [Caeno... 40 0.13
gi|23612202|ref|NP_703782.1| homologue of human HSPC025 [Plasmod... 40 0.13
gi|42733783|gb|AAS38704.1| similar to Dictyostelium discoideum (... 40 0.16
gi|23613415|ref|NP_703259.1| asparagine-rich antigen Pfa35-2 [Pl... 40 0.16
gi|17553036|ref|NP_497948.1| prion-like Q/N-rich domain protein ... 40 0.16
gi|47682580|gb|AAH70649.1| MGC82187 protein [Xenopus laevis] 40 0.16
gi|23510201|ref|NP_702867.1| erythrocyte membrane-associated ant... 40 0.16
gi|32488012|emb|CAE02875.1| OSJNBb0022F23.12 [Oryza sativa (japo... 40 0.16
gi|23612755|ref|NP_704294.1| ubiquitin-protein ligase 1, putativ... 40 0.16
gi|46361233|emb|CAG25094.1| unnamed protein product [Plasmodium ... 40 0.16
gi|4530579|gb|AAD22102.1| Pad-1 [Neurospora crassa] 40 0.16
gi|41629688|ref|NP_013695.2| Polymerase suppressor 2; Suppressor... 40 0.16
gi|46431067|gb|EAK90721.1| hypothetical protein CaO19.64 [Candid... 40 0.16
gi|23613190|ref|NP_703512.1| hypothetical protein [Plasmodium fa... 40 0.16
gi|23612383|ref|NP_703963.1| hypothetical protein [Plasmodium fa... 40 0.16
gi|24583962|ref|NP_609589.1| CG5787-PA [Drosophila melanogaster]... 40 0.16
gi|1709868|sp|P50109|PSP2_YEAST PSP2 protein (Mitochondrial regu... 40 0.16
gi|7510079|pir||T31616 hypothetical protein Y50E8A.l - Caenorhab... 40 0.16
gi|21282493|ref|NP_645581.1| fibrinogen-binding protein [Staphyl... 40 0.16
gi|23507981|ref|NP_700651.1| erythrocyte membrane-associated ant... 40 0.16
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 40 0.16
gi|50423787|ref|XP_460478.1| unnamed protein product [Debaryomyc... 40 0.16
gi|23509252|ref|NP_701919.1| hypothetical protein [Plasmodium fa... 40 0.16
gi|28829080|gb|AAO51644.1| similar to Dictyostelium discoideum (... 40 0.22
gi|19682983|gb|AAL92608.1| similar to Leishmania major. Hypothet... 40 0.22
gi|16768996|gb|AAL28717.1| LD13761p [Drosophila melanogaster] 40 0.22
gi|2134051|pir||I51235 DEAD box protein - African clawed frog (f... 40 0.22
gi|26517854|gb|AAN78319.1| cGMP-specific phosphodiesterase [Dict... 40 0.22
gi|23613778|ref|NP_704799.1| protein kinase, putative [Plasmodiu... 40 0.22
gi|42408182|dbj|BAD09319.1| putative splicing factor, arginine/s... 40 0.22
gi|48865011|ref|ZP_00318878.1| COG1388: FOG: LysM repeat [Oenoco... 40 0.22
gi|15923801|ref|NP_371335.1| fibrinogen-binding protein [Staphyl... 40 0.22
gi|23509711|ref|NP_702378.1| hypothetical protein [Plasmodium fa... 40 0.22
gi|42733890|gb|AAS38806.1| similar to Mus musculus (Mouse). 16 d... 40 0.22
gi|28829677|gb|AAO52193.1| similar to Plasmodium falciparum (iso... 40 0.22
gi|23619129|ref|NP_705091.1| hypothetical protein [Plasmodium fa... 40 0.22
gi|22788759|ref|NP_690471.1| hypothetical protein HZV_52 [Heliot... 40 0.22
gi|20129299|ref|NP_609082.1| CG10354-PA [Drosophila melanogaster... 40 0.22
gi|23508367|ref|NP_701036.1| hypothetical protein [Plasmodium fa... 40 0.22
gi|39588254|emb|CAE68179.1| Hypothetical protein CBG13839 [Caeno... 40 0.22
gi|23508981|ref|NP_701649.1| myosin d [Plasmodium falciparum 3D7... 39 0.28
gi|7489907|pir||S71629 sensory transduction histidine kinase dhk... 39 0.28
gi|1136289|gb|AAC47300.1| histidine kinase A 39 0.28
gi|28829783|gb|AAO52285.1| similar to Leishmania major. Ppg3 [Di... 39 0.28
gi|23618972|ref|NP_704934.1| sodium/hydrogen exchanger, putative... 39 0.28
gi|30230651|gb|AAP20874.1| sombrero SmbA [Dictyostelium discoideum] 39 0.28
gi|7489910|pir||T14004 trfA protein - slime mold (Dictyostelium ... 39 0.28
gi|23619590|ref|NP_705552.1| hypothetical protein [Plasmodium fa... 39 0.28
gi|39595425|emb|CAE60463.1| Hypothetical protein CBG04074 [Caeno... 39 0.28
gi|23613381|ref|NP_703225.1| ring-infected erythrocyte surface a... 39 0.28
gi|23477966|gb|EAA15181.1| CCAAT-box DNA binding protein subunit... 39 0.28
gi|23479056|gb|EAA15988.1| RNA recognition motif, putative [Plas... 39 0.28
gi|28829482|gb|AAL92370.2| similar to Dictyostelium discoideum (... 39 0.28
gi|23613124|ref|NP_703446.1| hypothetical protein [Plasmodium fa... 39 0.28
gi|28829361|gb|AAO51903.1| similar to Arabidopsis thaliana (Mous... 39 0.28
gi|23508911|ref|NP_701579.1| hypothetical protein [Plasmodium fa... 39 0.28
gi|11036632|ref|NP_055023.1| dentin sialophosphoprotein prepropr... 39 0.28
gi|19552423|ref|NP_600425.1| transcription termination factor [C... 39 0.28
gi|28377650|ref|NP_784542.1| ribonuclease R [Lactobacillus plant... 39 0.28
gi|23508731|ref|NP_701399.1| hypothetical protein [Plasmodium fa... 39 0.28
gi|23613567|ref|NP_704588.1| hypothetical protein [Plasmodium fa... 39 0.28
gi|14210646|gb|AAK55493.1| putative RNA-binding protein [Aedes a... 39 0.28
gi|23509596|ref|NP_702263.1| hypothetical protein [Plasmodium fa... 39 0.28
gi|23510035|ref|NP_702701.1| protease, putative [Plasmodium falc... 39 0.28
gi|31208407|ref|XP_313170.1| ENSANGP00000024051 [Anopheles gambi... 39 0.37
gi|19113886|ref|NP_592974.1| putative dual specificity protein k... 39 0.37
gi|28828882|gb|AAO51477.1| similar to Plasmodium falciparum (is... 39 0.37
gi|23508110|ref|NP_700780.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|346312|pir||A45135 profilaggrin - human (fragment) >gnl|BL_OR... 39 0.37
gi|41352095|gb|AAS00714.1| serine-aspartate repeat family protei... 39 0.37
gi|34935490|ref|XP_243381.2| similar to RTl1 [Rattus norvegicus] 39 0.37
gi|2230824|emb|CAA73551.1| STATa protein [Dictyostelium discoideum] 39 0.37
gi|23612349|ref|NP_703929.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|23478681|gb|EAA15702.1| hypothetical protein [Plasmodium yoel... 39 0.37
gi|50307001|ref|XP_453478.1| unnamed protein product [Kluyveromy... 39 0.37
gi|46105082|ref|XP_380345.1| hypothetical protein FG00169.1 [Gib... 39 0.37
gi|23508961|ref|NP_701629.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|50423089|ref|XP_460123.1| unnamed protein product [Debaryomyc... 39 0.37
gi|39585964|emb|CAE68253.1| Hypothetical protein CBG13930 [Caeno... 39 0.37
gi|23509548|ref|NP_702215.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|39590156|emb|CAE61154.1| Hypothetical protein CBG04920 [Caeno... 39 0.37
gi|49072036|ref|XP_400307.1| hypothetical protein UM02692.1 [Ust... 39 0.37
gi|7521903|pir||T30290 AAS surface protein - Staphylococcus sapr... 39 0.37
gi|28829943|gb|AAO52434.1| similar to Arabidopsis thaliana (Mous... 39 0.37
gi|47210613|emb|CAG12466.1| unnamed protein product [Tetraodon n... 39 0.37
gi|28829856|gb|AAO52358.1| similar to Mus musculus (Mouse). 13 d... 39 0.37
gi|23619025|ref|NP_704987.1| hypothetical protein [Plasmodium fa... 39 0.37
gi|42783920|ref|NP_981167.1| spore germination protein GerHA [Ba... 39 0.37
gi|12314267|emb|CAC13172.1| dJ14N1.1.1 (profilaggrin 5' end) [Ho... 39 0.37
gi|45476906|sp|Q86YZ3|HORN_HUMAN Hornerin 39 0.48
gi|23613425|ref|NP_703269.1| pfAARP2 protein [Plasmodium falcipa... 39 0.48
gi|19075227|ref|NP_587727.1| hypothetical T/N-rich protein [Schi... 39 0.48
gi|23613137|ref|NP_703459.1| hypothetical protein [Plasmodium fa... 39 0.48
gi|1762998|gb|AAB39613.1| RING-finger protein [Helicoverpa armig... 39 0.48
gi|47551339|ref|NP_999980.1| zgc:85716 [Danio rerio] >gnl|BL_ORD... 39 0.48
gi|23619136|ref|NP_705098.1| hypothetical protein [Plasmodium fa... 39 0.48
gi|23479406|gb|EAA16244.1| fimbriae-associated protein Fap1 [Pla... 39 0.48
gi|23478507|gb|EAA15576.1| ADA2-like protein [Plasmodium yoelii ... 39 0.48
gi|23618971|ref|NP_704933.1| hypothetical protein [Plasmodium fa... 39 0.48
gi|19568020|gb|AAK26210.1| prion protein [Saccharomyces cerevisi... 39 0.48
gi|23619583|ref|NP_705545.1| hypothetical protein [Plasmodium fa... 39 0.48
gi|25028100|ref|NP_738154.1| conserved hypothetical protein [Cor... 39 0.48
gi|18376336|emb|CAD21082.1| RNA splicing factor Pad-1 [Neurospor... 39 0.48
gi|21324177|dbj|BAB98802.1| Hypothetical protein [Corynebacteriu... 39 0.48
gi|23480669|gb|EAA17165.1| homeobox-containing protein [Plasmodi... 39 0.48
gi|22218027|emb|CAD43736.1| serine protease [Staphylococcus warn... 39 0.48
gi|46123595|ref|XP_386351.1| hypothetical protein FG06175.1 [Gib... 39 0.48
gi|23509280|ref|NP_701947.1| hypothetical protein [Plasmodium fa... 39 0.48
gi|3668148|emb|CAA21105.1| SPCC1235.01 [Schizosaccharomyces pombe] 39 0.48
gi|39595673|emb|CAE67175.1| Hypothetical protein CBG12607 [Caeno... 39 0.48
gi|15595146|ref|NP_212935.1| translation initiation factor 2 (in... 39 0.48
gi|23612127|ref|NP_703707.1| hypothetical protein, expressed [Pl... 39 0.48
gi|19552625|ref|NP_600627.1| TPR-repeat-containing protein [Cory... 39 0.48
gi|1730077|sp|P18160|KYK1_DICDI Non-receptor tyrosine kinase spo... 39 0.48
gi|32404272|ref|XP_322749.1| hypothetical protein ( (AF130355) P... 39 0.48
gi|23508016|ref|NP_700686.1| 10b antigen, putative [Plasmodium f... 39 0.48
gi|23489719|gb|EAA21659.1| DEAD box polypeptide, Y chromosome-re... 39 0.48
gi|50543636|ref|XP_499984.1| hypothetical protein [Yarrowia lipo... 39 0.48
gi|28850410|gb|AAL92314.2| hypothetical protein [Dictyostelium d... 39 0.48
gi|10383762|ref|NP_009902.2| [PIN(+)] prion; Rnq1p [Saccharomyce... 39 0.48
gi|23612323|ref|NP_703903.1| iswi protein homologue [Plasmodium ... 39 0.48
gi|85022|pir||C29349 hypothetical protein 3 - fruit fly (Drosoph... 39 0.48
gi|23509717|ref|NP_702384.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|23509526|ref|NP_702193.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|28850455|gb|AAO53219.1| similar to Plasmodium falciparum (iso... 38 0.63
gi|50426247|ref|XP_461720.1| unnamed protein product [Debaryomyc... 38 0.63
gi|19568022|gb|AAK26211.1| prion protein [Saccharomyces cerevisiae] 38 0.63
gi|23490157|gb|EAA22000.1| Drosophila melanogaster RE68879p, put... 38 0.63
gi|19568026|gb|AAK26213.1| prion protein [Saccharomyces cerevisi... 38 0.63
gi|19568018|gb|AAK26209.1| prion protein [Saccharomyces cerevisiae] 38 0.63
gi|23509024|ref|NP_701692.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|19568016|gb|AAK26208.1| prion protein [Saccharomyces cerevisiae] 38 0.63
gi|42733812|gb|AAS38730.1| similar to Plasmodium falciparum. Hyp... 38 0.63
gi|17538109|ref|NP_495577.1| RiboNuclease H (2H817) [Caenorhabdi... 38 0.63
gi|38176087|gb|AAB93313.3| Hypothetical protein ZK1290.6 [Caenor... 38 0.63
gi|6320347|ref|NP_010427.1| Protein of unknown function; san1 mu... 38 0.63
gi|23612517|ref|NP_704078.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|23612460|ref|NP_704021.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|19568032|gb|AAK26216.1| prion protein [Saccharomyces cerevisiae] 38 0.63
gi|23612813|ref|NP_704352.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|31212783|ref|XP_315376.1| ENSANGP00000020934 [Anopheles gambi... 38 0.63
gi|23508433|ref|NP_701102.1| asparagine-rich protein [Plasmodium... 38 0.63
gi|23508609|ref|NP_701278.1| hypothetical protein [Plasmodium fa... 38 0.63
gi|23479753|gb|EAA16495.1| Ubiquitin carboxyl-terminal hydrolase... 38 0.63
gi|1168519|sp|P04931|ARP_PLAFA ASPARAGINE-RICH PROTEIN (AG319) (... 38 0.63
gi|23482746|gb|EAA18637.1| hypothetical protein [Plasmodium yoel... 38 0.63
gi|83150|pir||S19355 hypothetical protein YCL028w - yeast (Sacch... 38 0.63
gi|6323588|ref|NP_013659.1| Hypothetical ORF; Yml053cp [Saccharo... 38 0.63
gi|17545671|ref|NP_519073.1| PUTATIVE ATP-DEPENDENT RNA HELICASE... 38 0.63
gi|40538999|gb|AAR87256.1| hypothetical protein [Oryza sativa (j... 38 0.63
gi|28828096|gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-... 38 0.63
gi|47216574|emb|CAG00609.1| unnamed protein product [Tetraodon n... 38 0.63
gi|23619075|ref|NP_705037.1| Plasmodium falciparum asparagine-ri... 38 0.63
gi|42780188|ref|NP_977435.1| lipoprotein, putative [Bacillus cer... 38 0.63
gi|7485168|pir||G71415 hypothetical protein - Arabidopsis thalia... 38 0.82
gi|39590703|emb|CAE65073.1| Hypothetical protein CBG09927 [Caeno... 38 0.82
gi|21240658|gb|AAM44369.1| putative protein contains similarity ... 38 0.82
gi|134874|sp|P16230|SRCH_RABIT Sarcoplasmic reticulum histidine-... 38 0.82
gi|541336|pir||S41539 fibrinogen-binding protein - Staphylococcu... 38 0.82
gi|28829829|gb|AAO52331.1| similar to Plasmodium falciparum. Hyp... 38 0.82
gi|39590526|emb|CAE66266.1| Hypothetical protein CBG11510 [Caeno... 38 0.82
gi|23509929|ref|NP_702596.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|1763002|gb|AAB39615.1| RING-finger protein [Helicoverpa armig... 38 0.82
gi|23482585|gb|EAA18526.1| hypothetical protein [Plasmodium yoel... 38 0.82
gi|23612911|ref|NP_704450.1| RNA helicase, putative [Plasmodium ... 38 0.82
gi|23613705|ref|NP_704726.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|21402779|ref|NP_658764.1| hypothetical protein predicted by G... 38 0.82
gi|132383|sp|P13830|RESA_PLAFF Ring-infected erythrocyte surface... 38 0.82
gi|42566815|ref|NP_193253.3| SET domain-containing protein [Arab... 38 0.82
gi|23509930|ref|NP_702597.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|29500764|gb|AAO75105.1| ComD [Dictyostelium discoideum] 38 0.82
gi|23481068|gb|EAA17458.1| putative splicing factor [Plasmodium ... 38 0.82
gi|39590770|emb|CAE65143.1| Hypothetical protein CBG10009 [Caeno... 38 0.82
gi|23478876|gb|EAA15847.1| hypothetical protein [Plasmodium yoel... 38 0.82
gi|16805190|ref|NP_473218.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|1778846|gb|AAB40930.1| rsc12 [Dictyostelium discoideum] 38 0.82
gi|23478750|gb|EAA15752.1| cyclophilin-RNA interacting protein [... 38 0.82
gi|7228696|gb|AAF42582.1| putative lipoprotein GNA2132 [Neisseri... 38 0.82
gi|17865460|sp|P97399|DSPP_MOUSE Dentin sialophosphoprotein prec... 38 0.82
gi|28378673|ref|NP_785565.1| translation initiation factor IF-2 ... 38 0.82
gi|23509895|ref|NP_702562.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|23612191|ref|NP_703771.1| trancription factor, putative [Plas... 38 0.82
gi|4322670|gb|AAD16120.1| dentin phosphoryn [Homo sapiens] 38 0.82
gi|23486190|gb|EAA20743.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 38 0.82
gi|23510187|ref|NP_702853.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|14486661|gb|AAK63227.1| merozoite surface protein 8 [Plasmodi... 38 0.82
gi|23613554|ref|NP_704575.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|29375843|ref|NP_814997.1| translation initiation factor IF-2 ... 38 0.82
gi|17570531|ref|NP_508324.1| predicted CDS, peptidase family A16... 38 0.82
gi|15926464|ref|NP_373997.1| fibrinogen-binding protein A, clump... 38 0.82
gi|46435701|gb|EAK95077.1| hypothetical protein CaO19.8206 [Cand... 38 0.82
gi|1762996|gb|AAB39612.1| RING-finger protein [Helicoverpa armig... 38 0.82
gi|49077800|ref|XP_402719.1| hypothetical protein UM05104.1 [Ust... 38 0.82
gi|1335718|emb|CAA28817.1| ring-infected eryrthrocyte surface an... 38 0.82
gi|41054323|ref|NP_956034.1| cyclin L ania-6a; wu:fd99b09 [Danio... 38 0.82
gi|23508666|ref|NP_701335.1| hypothetical protein [Plasmodium fa... 38 0.82
gi|49484836|ref|YP_042060.1| putative exported protein [Staphylo... 38 0.82
gi|46440246|gb|EAK99554.1| hypothetical protein CaO19.2457 [Cand... 38 0.82
gi|7503073|pir||T22033 hypothetical protein F40F8.5 - Caenorhabd... 38 0.82
gi|32565593|ref|NP_496388.2| putative protein, with a coiled coi... 38 0.82
gi|41690174|ref|ZP_00146706.1| COG1530: Ribonucleases G and E [P... 38 0.82
gi|1763000|gb|AAB39614.1| RING-finger protein [Helicoverpa armig... 37 1.1
gi|17561660|ref|NP_506383.1| RNA helicase (5O149) [Caenorhabditi... 37 1.1
gi|14133665|gb|AAK54095.1| histidine kinase DhkK [Dictyostelium ... 37 1.1
gi|17944470|gb|AAL48124.1| RH03791p [Drosophila melanogaster] 37 1.1
gi|23508909|ref|NP_701577.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|24580815|ref|NP_608582.2| CG4887-PA [Drosophila melanogaster]... 37 1.1
gi|46440335|gb|EAK99642.1| hypothetical protein CaO19.9993 [Cand... 37 1.1
gi|49098038|ref|XP_410479.1| hypothetical protein AN6342.2 [Aspe... 37 1.1
gi|42733613|gb|AAS38587.1| similar to Dictyostelium discoideum (... 37 1.1
gi|23612617|ref|NP_704178.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|23612437|ref|NP_703998.1| erythrocyte membrane-associated ant... 37 1.1
gi|23619251|ref|NP_705213.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|4741689|emb|CAB09569.2| hypothetical protein [Trypanosoma bru... 37 1.1
gi|23613101|ref|NP_703423.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|26984413|emb|CAD58865.1| putative stress protein [Agaricus bi... 37 1.1
gi|23479088|gb|EAA16013.1| hypothetical protein [Plasmodium yoel... 37 1.1
gi|23508769|ref|NP_701437.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|28829887|gb|AAO52384.1| similar to Plasmodium falciparum. Hyp... 37 1.1
gi|23479413|gb|EAA16250.1| RNA recognition motif, putative [Plas... 37 1.1
gi|28485813|ref|XP_130275.2| similar to matrin cyclophilin (matr... 37 1.1
gi|32408581|ref|XP_324772.1| hypothetical protein [Neurospora cr... 37 1.1
gi|42782493|ref|NP_979740.1| conserved hypothetical protein [Bac... 37 1.1
gi|3850821|emb|CAA77135.1| U2 snRNP auxiliary factor, large subu... 37 1.1
gi|4324420|gb|AAD16881.1| prespore-specific protein [Dictyosteli... 37 1.1
gi|23612140|ref|NP_703720.1| DNA repair protein RAD50, putative ... 37 1.1
gi|23482542|gb|EAA18497.1| hypothetical protein [Plasmodium yoel... 37 1.1
gi|23480096|gb|EAA16751.1| 1-phosphatidylinositol-4,5-bisphospha... 37 1.1
gi|23478331|gb|EAA15449.1| RNB-like protein, putative [Plasmodiu... 37 1.1
gi|7489884|pir||T08605 hypothetical protein HelE - slime mold (D... 37 1.1
gi|18496818|gb|AAL74250.1| ABC transporter AbcB3 [Dictyostelium ... 37 1.1
gi|467292|gb|AAA17387.1| glutamine-asparagine rich protein 37 1.1
gi|1709525|sp|P54673|P3K1_DICDI Phosphatidylinositol 3-kinase 1 ... 37 1.1
gi|23490246|gb|EAA22070.1| synthetic antigen of P.falciparum, pu... 37 1.1
gi|23509088|ref|NP_701756.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|28828950|gb|AAL92306.2| similar to Dictyostelium discoideum (... 37 1.1
gi|23508084|ref|NP_700754.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|23509617|ref|NP_702284.1| hypothetical protein, conserved [Pl... 37 1.1
gi|23613621|ref|NP_704642.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|23509014|ref|NP_701682.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|23612619|ref|NP_704180.1| hypothetical protein [Plasmodium fa... 37 1.1
gi|42733854|gb|AAS38772.1| similar to Dictyostelium discoideum (... 37 1.4
gi|23507966|ref|NP_700636.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|32413379|ref|XP_327169.1| hypothetical protein [Neurospora cr... 37 1.4
gi|4098580|gb|AAD00327.1| RBM1 [Macropus eugenii] 37 1.4
gi|23483493|gb|EAA19144.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|23487851|gb|EAA21161.1| putative peptidyl prolyl cis-trans is... 37 1.4
gi|23490968|gb|EAA22616.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|23507844|ref|NP_700514.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|23482650|gb|EAA18573.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|38567899|emb|CAE03654.2| OSJNBa0060N03.19 [Oryza sativa (japo... 37 1.4
gi|23480977|gb|EAA17393.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|23482180|gb|EAA18237.1| ERYTHROCYTE MEMBRANE PROTEIN PFEMP3 [... 37 1.4
gi|23479921|gb|EAA16622.1| Arabidopsis thaliana At3g58560/F14P22... 37 1.4
gi|23508775|ref|NP_701443.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|28829576|gb|AAO52093.1| similar to Plasmodium falciparum. Hyp... 37 1.4
gi|23619615|ref|NP_705577.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|23507943|ref|NP_700613.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|24650758|ref|NP_651599.1| CG5514-PB [Drosophila melanogaster]... 37 1.4
gi|23612148|ref|NP_703728.1| hypothetical protein, expressed [Pl... 37 1.4
gi|48108519|ref|XP_396203.1| similar to DNA topoisomerase I [Api... 37 1.4
gi|23508015|ref|NP_700685.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|16805041|ref|NP_473070.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|28829804|gb|AAO52306.1| similar to Plasmodium falciparum. Hyp... 37 1.4
gi|50554465|ref|XP_504641.1| hypothetical protein [Yarrowia lipo... 37 1.4
gi|23613462|ref|NP_703306.1| phosphatidylinositol-4-phosphate 5-... 37 1.4
gi|23619507|ref|NP_705469.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|39585102|emb|CAE62753.1| Hypothetical protein CBG06917 [Caeno... 37 1.4
gi|23613063|ref|NP_703385.1| P-type ATPase, putative [Plasmodium... 37 1.4
gi|139875|sp|P29126|XYNA_RUMFL Bifunctional endo-1,4-beta-xylana... 37 1.4
gi|28828689|gb|AAM33194.2| similar to Plasmodium falciparum (iso... 37 1.4
gi|6320199|ref|NP_010279.1| RNA Polymerase II transcriptional re... 37 1.4
gi|28828526|gb|AAO51134.1| similar to Dictyostelium discoideum (... 37 1.4
gi|23612609|ref|NP_704170.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|46439613|gb|EAK98929.1| hypothetical protein CaO19.10764 [Can... 37 1.4
gi|23612125|ref|NP_703705.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|37530562|ref|NP_919583.1| putative U1 small nuclear ribonucle... 37 1.4
gi|24650760|ref|NP_733240.1| CG5514-PA [Drosophila melanogaster]... 37 1.4
gi|23478899|gb|EAA15864.1| U5 snRNP 100 kD protein [Plasmodium y... 37 1.4
gi|50423563|ref|XP_460364.1| unnamed protein product [Debaryomyc... 37 1.4
gi|21428840|gb|AAM50139.1| GH07623p [Drosophila melanogaster] 37 1.4
gi|23508992|ref|NP_701660.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|23510212|ref|NP_702878.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|31217812|ref|XP_316510.1| ENSANGP00000013532 [Anopheles gambi... 37 1.4
gi|23510099|ref|NP_702765.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|23486663|gb|EAA20861.1| strong similarity to unknown protein-... 37 1.4
gi|31198265|ref|XP_308080.1| ENSANGP00000003083 [Anopheles gambi... 37 1.4
gi|48137452|ref|XP_393364.1| similar to SD21488p [Apis mellifera] 37 1.4
gi|1709903|sp|P54637|PTP3_DICDI Protein-tyrosine phosphatase 3 (... 37 1.4
gi|23612375|ref|NP_703955.1| cullin-like protein, putative [Plas... 37 1.4
gi|23509504|ref|NP_702171.1| hypothetical protein, conserved [Pl... 37 1.4
gi|23508932|ref|NP_701600.1| hypothetical protein [Plasmodium fa... 37 1.4
gi|23489822|gb|EAA21738.1| hypothetical protein [Plasmodium yoel... 37 1.4
gi|11362266|pir||JC7210 molluscan shell matrix protein N66 - Pin... 37 1.4
gi|6899836|dbj|BAA90540.1| N66 matrix protein [Pinctada maxima] 37 1.4
gi|17865451|sp|Q62598|DSPP_RAT Dentin sialophosphoprotein precur... 37 1.4
gi|23489341|gb|EAA21552.1| dentin phosphoryn [Plasmodium yoelii ... 37 1.8
gi|23510183|ref|NP_702849.1| hypothetical protein [Plasmodium fa... 37 1.8
gi|23480969|gb|EAA17387.1| hypothetical protein [Plasmodium yoel... 37 1.8
gi|23509023|ref|NP_701691.1| hypothetical protein [Plasmodium fa... 37 1.8
gi|23612936|ref|NP_704475.1| hypothetical protein [Plasmodium fa... 37 1.8
gi|39589728|emb|CAE66963.1| Hypothetical protein CBG12357 [Caeno... 37 1.8
gi|23613402|ref|NP_703246.1| hypothetical protein [Plasmodium fa... 37 1.8
gi|28829795|gb|AAO52297.1| similar to Plasmodium falciparum. Cel... 37 1.8
gi|4731916|gb|AAD28550.1| development protein DG1124 [Dictyostel... 37 1.8
gi|46228483|gb|EAK89353.1| hypothetical protein cgd8_1380 [Crypt... 37 1.8
gi|42733656|gb|AAS38618.1| similar to Dictyostelium discoideum (... 37 1.8
gi|3293557|gb|AAC25776.1| cold acclimation responsive protein CA... 37 1.8
gi|541957|pir||JQ2266 cold acclimation protein cas15 - alfalfa >... 37 1.8
gi|31793533|ref|NP_856026.1| PPE FAMILY PROTEIN [Mycobacterium b... 37 1.8
gi|9581801|emb|CAC00546.1| guanylyl cyclase [Plasmodium falciparum] 37 1.8
gi|23508435|ref|NP_701104.1| hypothetical protein [Plasmodium fa... 37 1.8
>gi|17570091|ref|NP_508339.1| putative protein (XC460) [Caenorhabditis
elegans]
gi|7508488|pir||T28910 hypothetical protein T26C11.4 - Caenorhabditis
elegans
gi|1086661|gb|AAC48213.1| Hypothetical protein T26C11.4
[Caenorhabditis elegans]
Length = 548
Score = 1056 bits (2732), Expect = 0.0
Identities = 521/548 (95%), Positives = 521/548 (95%)
Frame = -1
Query: 1647 MXXXXXXXXXXSEFEYLSCEESNVSQNPEEIDEDTIEEKPESDSVTKGNSEQVEHGSESV 1468
M SEFEYLSCEESNVSQNPEEIDEDTIEEKPESDSVTKGNSEQVEHGSESV
Sbjct: 1 MSQSTSSNSSQSEFEYLSCEESNVSQNPEEIDEDTIEEKPESDSVTKGNSEQVEHGSESV 60
Query: 1467 IKIVQSKASETVAVAQDYSNSEEKQDNRQVILSSKDWSTLLGRLKDGGLDVPRLLEGLNI 1288
IKIVQSKASETVAVAQDYSNSEEKQDNRQVILSSKDWSTLLGRLKDGGLDVPRLLEGLNI
Sbjct: 61 IKIVQSKASETVAVAQDYSNSEEKQDNRQVILSSKDWSTLLGRLKDGGLDVPRLLEGLNI 120
Query: 1287 RNEEIETNKLPDFEIKNEEAYILGRRLVIGTGTDNIAQNAQVAQNLSRPYSNQNGHQPLS 1108
RNEEIETNKLPDFEIKNEEAYILGRRLVIGTGTDNIAQNAQVAQNLSRPYSNQNGHQPLS
Sbjct: 121 RNEEIETNKLPDFEIKNEEAYILGRRLVIGTGTDNIAQNAQVAQNLSRPYSNQNGHQPLS 180
Query: 1107 SGFFFNSSPGRQHQPQGASNAGYDNGSRHCRGQDSFRSGRDDAARDQREFLXXXXXXXXX 928
SGFFFNSSPGRQHQPQGASNAGYDNGSRHCRGQDSFRSGRDDAARDQREFL
Sbjct: 181 SGFFFNSSPGRQHQPQGASNAGYDNGSRHCRGQDSFRSGRDDAARDQREFLSRSMRSSGS 240
Query: 927 XXXXXXXXSERDEARDRYIEHLSSNESTWMENSRNQSFNQNGGFRTRHEEDRSGSNHGHS 748
SERDEARDRYIEHLSSNESTWMENSRNQSFNQNGGFRTRHEEDRSGSNHGHS
Sbjct: 241 QRQDQGFQSERDEARDRYIEHLSSNESTWMENSRNQSFNQNGGFRTRHEEDRSGSNHGHS 300
Query: 747 NRDSKARRGQDSGFNHRRNVDSDGYNGGQNRDYFDDGFSNRTPNNYQDQRGPQTEKFQSK 568
NRDSKARRGQDSGFNHRRNVDSDGYNGGQNRDYFDDGFSNRTPNNYQDQRGPQTEKFQSK
Sbjct: 301 NRDSKARRGQDSGFNHRRNVDSDGYNGGQNRDYFDDGFSNRTPNNYQDQRGPQTEKFQSK 360
Query: 567 FLNCSNHNDEHSNIDESESSYQKNRDRSGYSNDGPHFNRAVPRCPPHDVSMSHGYKQGYQ 388
FLNCSNHNDEHSNIDESESSYQKNRDRSGYSNDGPHFNRAVPRCPPHDVSMSHGYKQGYQ
Sbjct: 361 FLNCSNHNDEHSNIDESESSYQKNRDRSGYSNDGPHFNRAVPRCPPHDVSMSHGYKQGYQ 420
Query: 387 SDETFDNDAESTSEFSFLYERKNQHGFRGEGSGFQRDCKLLTFTLKILGLNHPQTSPEVQ 208
SDETFDNDAESTSEFSFLYERKNQHGFRGEGSGFQRDCKLLTFTLKILGLNHPQTSPEVQ
Sbjct: 421 SDETFDNDAESTSEFSFLYERKNQHGFRGEGSGFQRDCKLLTFTLKILGLNHPQTSPEVQ 480
Query: 207 IADRQQADSVDLQAAVPKQNGDSSVPILQKAAPSRRVPRCARRGFERKICQGERSLRQMS 28
IADRQQADSVDLQAAVPKQNGDSSVPILQKAAPSRRVPRCARRGFERKICQGERSLRQMS
Sbjct: 481 IADRQQADSVDLQAAVPKQNGDSSVPILQKAAPSRRVPRCARRGFERKICQGERSLRQMS 540
Query: 27 GKALVARL 4
GKALVARL
Sbjct: 541 GKALVARL 548