Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T05E7_4
(1146 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508869|ref|NP_491787.1| very Early Transcript VET-1, anti-a... 755 0.0
gi|19746885|ref|NP_608021.1| streptococcal protective antigen [S... 75 3e-12
gi|8996050|gb|AAD42939.2| protective antigen [Streptococcus pyog... 75 3e-12
gi|48111808|ref|XP_396309.1| similar to hypothetical protein [Ap... 74 8e-12
gi|16804929|ref|NP_472958.1| hypothetical protein [Plasmodium fa... 73 1e-11
gi|34875952|ref|XP_223734.2| similar to hypothetical protein [Ra... 72 2e-11
gi|6321812|ref|NP_011888.1| Myo1 is a type II myosin, is localiz... 71 4e-11
gi|47219280|emb|CAG11742.1| unnamed protein product [Tetraodon n... 71 5e-11
gi|23481897|gb|EAA18039.1| hypothetical protein [Plasmodium yoel... 71 5e-11
gi|46228494|gb|EAK89364.1| coiled coil protein [Cryptosporidium ... 70 7e-11
gi|13928946|ref|NP_113871.1| SMC1 structural maintenance of chro... 70 7e-11
gi|2462783|gb|AAB71984.1| M-protein [Streptococcus equi] 70 9e-11
gi|12003423|gb|AAG43570.1| skeletal muscle myosin heavy chain My... 70 9e-11
gi|30581135|ref|NP_006297.2| SMC1 structural maintenance of chro... 70 1e-10
gi|2135244|pir||I54383 chromosome segregation protein smc1 [simi... 70 1e-10
gi|30172566|ref|NP_777039.1| SMC1 structural maintenance of chro... 70 1e-10
gi|2370078|emb|CAB09784.1| dJ339A18.1 (KIAA0178 (ortholog of Fug... 70 1e-10
gi|34365245|emb|CAE45960.1| hypothetical protein [Homo sapiens] 70 1e-10
gi|39963673|gb|AAH64368.1| SMC1L1 protein [Homo sapiens] 70 1e-10
gi|9790237|ref|NP_062684.1| SMC1 structural maintenance of chrom... 69 2e-10
gi|3093478|gb|AAC38445.1| fibrinogen-binding protein [Streptococ... 69 2e-10
gi|47222635|emb|CAG03000.1| unnamed protein product [Tetraodon n... 69 3e-10
gi|7489885|pir||T14867 interaptin - slime mold (Dictyostelium di... 69 3e-10
gi|29837126|emb|CAD58850.2| SMC1 protein cohesin subunit [Gallus... 69 3e-10
gi|31874020|emb|CAD97928.1| hypothetical protein [Homo sapiens] 69 3e-10
gi|36031016|ref|NP_060487.2| CTCL tumor antigen L14-2 [Homo sapi... 69 3e-10
gi|23508767|ref|NP_701435.1| hypothetical protein [Plasmodium fa... 68 3e-10
gi|47211795|emb|CAF93709.1| unnamed protein product [Tetraodon n... 68 3e-10
gi|47211792|emb|CAF93706.1| unnamed protein product [Tetraodon n... 68 3e-10
gi|31198815|ref|XP_308355.1| ENSANGP00000009410 [Anopheles gambi... 68 3e-10
gi|31198813|ref|XP_308354.1| ENSANGP00000024069 [Anopheles gambi... 68 3e-10
gi|27806363|ref|NP_776634.1| uveal autoantigen with coiled-coil ... 68 3e-10
gi|50749815|ref|XP_421767.1| PREDICTED: similar to CTCL tumor an... 68 3e-10
gi|10438291|dbj|BAB15219.1| unnamed protein product [Homo sapiens] 68 5e-10
gi|47216948|emb|CAG04890.1| unnamed protein product [Tetraodon n... 68 5e-10
gi|46432411|gb|EAK91894.1| hypothetical protein CaO19.13673 [Can... 68 5e-10
gi|39587824|emb|CAE67842.1| Hypothetical protein CBG13429 [Caeno... 68 5e-10
gi|50286051|ref|XP_445454.1| unnamed protein product [Candida gl... 68 5e-10
gi|28436771|gb|AAH46691.1| Smc1l1-prov protein [Xenopus laevis] 68 5e-10
gi|42658064|ref|XP_376656.1| hypothetical protein FLJ22037 [Homo... 68 5e-10
gi|42658517|ref|XP_379895.1| similar to superfast myosin heavy c... 68 5e-10
gi|20806787|ref|NP_621958.1| ATPase involved in DNA repair [Ther... 67 6e-10
gi|23508673|ref|NP_701342.1| MAEBL, putative [Plasmodium falcipa... 67 8e-10
gi|677198|gb|AAB00143.1| putative 67 8e-10
gi|20094208|ref|NP_614055.1| Uncharacterized protein [Methanopyr... 67 8e-10
gi|33622302|ref|NP_891949.1| desmoplakin [Cryptophlebia leucotre... 67 8e-10
gi|13786876|pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy M... 67 8e-10
gi|34495238|gb|AAQ73469.1| erythrocyte binding protein 3 [Plasmo... 67 8e-10
gi|34495237|gb|AAQ73468.1| erythrocyte binding protein 2 [Plasmo... 67 8e-10
gi|21739826|emb|CAD38940.1| hypothetical protein [Homo sapiens] 67 1e-09
gi|35038601|ref|NP_919268.1| hypothetical protein DKFZp761A078 [... 67 1e-09
gi|50290619|ref|XP_447742.1| unnamed protein product [Candida gl... 67 1e-09
gi|50368680|gb|AAH76678.1| Unknown (protein for MGC:79657) [Xeno... 67 1e-09
gi|50734052|ref|XP_418957.1| PREDICTED: similar to Desmoplakin (... 66 1e-09
gi|1903280|emb|CAA98620.1| USO1 [Saccharomyces cerevisiae] 66 1e-09
gi|11321579|ref|NP_003793.1| myosin, heavy polypeptide 13, skele... 66 1e-09
gi|15594898|ref|NP_212687.1| B. burgdorferi predicted coding reg... 66 1e-09
gi|6320145|ref|NP_010225.1| involved intracellular protein trans... 66 1e-09
gi|137175|sp|P25386|USO1_YEAST Intracellular protein transport p... 66 1e-09
gi|34906186|ref|NP_914440.1| putative MAR-binding protein MFP1 [... 66 1e-09
gi|6093461|sp|P79293|MYH7_PIG Myosin heavy chain, cardiac muscle... 66 1e-09
gi|46047435|ref|NP_996769.1| sarcoma antigen NY-SAR-41 [Homo sap... 66 2e-09
gi|127774|sp|P08799|MYS2_DICDI Myosin II heavy chain, non muscle... 66 2e-09
gi|24660442|gb|AAH39612.1| MYO18A protein [Homo sapiens] 66 2e-09
gi|11362271|pir||T47237 myosin II heavy chain [imported] - Naegl... 65 2e-09
gi|41386711|ref|NP_777152.1| myosin, heavy polypeptide 7, cardia... 65 2e-09
gi|8393807|ref|NP_058936.1| myosin heavy chain, polypeptide 7; m... 65 2e-09
gi|23508398|ref|NP_701067.1| hypothetical protein [Plasmodium fa... 65 2e-09
gi|45384404|ref|NP_990273.1| restin [Gallus gallus] >gnl|BL_ORD_... 65 2e-09
gi|42656010|ref|XP_057107.5| KIAA1937 protein [Homo sapiens] 65 3e-09
gi|17533741|ref|NP_494820.1| M protein repeat containing protein... 65 3e-09
gi|17533743|ref|NP_494821.1| M protein repeat containing protein... 65 3e-09
gi|32565065|ref|NP_872028.1| M protein repeat containing protein... 65 3e-09
gi|7494129|pir||T18296 myosin heavy chain - Entamoeba histolytic... 65 3e-09
gi|17533739|ref|NP_494819.1| M protein repeat containing protein... 65 3e-09
gi|9366632|emb|CAB95394.1| conserved hypothetical protein [Trypa... 65 4e-09
gi|23619203|ref|NP_705165.1| hypothetical malaria antigen [Plasm... 65 4e-09
gi|12060489|dbj|BAB20630.1| myosin heavy chain slow isoform [Sus... 65 4e-09
gi|18859641|ref|NP_542766.1| myosin, heavy polypeptide 7, cardia... 65 4e-09
gi|50746907|ref|XP_420670.1| PREDICTED: similar to Centromeric p... 65 4e-09
gi|15606061|ref|NP_213438.1| chromosome assembly protein homolog... 65 4e-09
gi|27803037|emb|CAD60740.1| unnamed protein product [Podospora a... 64 5e-09
gi|40789293|ref|NP_776123.2| centromere protein E; kinesin 10; k... 64 5e-09
gi|111999|pir||S21801 myosin heavy chain, neuronal [similarity] ... 64 7e-09
gi|24954682|gb|AAN64696.1| M protein [Streptococcus pyogenes] 64 7e-09
gi|1263014|gb|AAB03086.1| emm18.1 gene product 64 7e-09
gi|42761572|gb|AAS45390.1| similar to Babesia bigemina. 200 kDa ... 64 7e-09
gi|3041708|sp|P13540|MYH7_MESAU Myosin heavy chain, cardiac musc... 64 7e-09
gi|45190651|ref|NP_984905.1| AER045Cp [Eremothecium gossypii] >g... 64 7e-09
gi|29468|emb|CAA35940.1| beta-myosin heavy chain (1151 AA) [Homo... 64 7e-09
gi|3915779|sp|P13539|MYH6_MESAU Myosin heavy chain, cardiac musc... 64 7e-09
gi|191622|gb|AAA37161.1| alpha cardiac myosin heavy chain 64 7e-09
gi|191618|gb|AAA37159.1| alpha cardiac myosin heavy chain 64 7e-09
gi|6754774|ref|NP_034986.1| myosin, heavy polypeptide 6, cardiac... 64 7e-09
gi|21262188|gb|AAM44457.1| CTCL tumor antigen HD-CL-01 [Homo sap... 64 9e-09
gi|24641414|ref|NP_572750.2| CG32662-PA [Drosophila melanogaster... 64 9e-09
gi|50290563|ref|XP_447713.1| unnamed protein product [Candida gl... 64 9e-09
gi|27881642|gb|AAH43703.1| Myh9 protein [Mus musculus] 64 9e-09
gi|49523259|gb|AAH75407.1| Unknown (protein for MGC:89159) [Xeno... 64 9e-09
gi|47847498|dbj|BAD21421.1| mFLJ00279 protein [Mus musculus] 64 9e-09
gi|50419075|ref|XP_458060.1| unnamed protein product [Debaryomyc... 64 9e-09
gi|1814390|gb|AAB41890.1| slow myosin heavy chain 2 [Gallus gallus] 64 9e-09
gi|28277050|gb|AAH44834.1| Myh9 protein [Mus musculus] 64 9e-09
gi|21740028|emb|CAD39031.1| hypothetical protein [Homo sapiens] 64 9e-09
gi|32484326|gb|AAH54360.1| Myh9 protein [Mus musculus] 64 9e-09
gi|13543854|gb|AAH06075.1| Myh9 protein [Mus musculus] 64 9e-09
gi|46447651|ref|YP_009016.1| hypothetical protein pc2017 [Parach... 63 1e-08
gi|2144825|pir||MWRBCB myosin beta heavy chain, cardiac muscle [... 63 1e-08
gi|18310698|ref|NP_562632.1| chromosome partition protein [Clost... 63 1e-08
gi|6708502|gb|AAD09454.2| superfast myosin heavy chain [Felis ca... 63 1e-08
gi|29727|emb|CAA37068.1| cardiac beta myosin heavy chain [Homo s... 63 1e-08
gi|12053672|emb|CAC20413.1| beta-myosin heavy chain [Homo sapiens] 63 1e-08
gi|4557773|ref|NP_000248.1| myosin, heavy polypeptide 7, cardiac... 63 1e-08
gi|109322|pir||A41604 myosin heavy chain, smooth muscle, long sp... 63 1e-08
gi|1346644|sp|P35748|MYHB_RABIT Myosin heavy chain, smooth muscl... 63 1e-08
gi|28829494|gb|AAO52027.1| similar to Dictyostelium discoideum (... 63 1e-08
gi|1709211|sp|P54697|MYSJ_DICDI Myosin IJ heavy chain >gnl|BL_OR... 63 1e-08
gi|2905649|gb|AAC03547.1| cytoplasmic linker protein CLIP-170 [G... 63 1e-08
gi|6330911|dbj|BAA86570.1| KIAA1256 protein [Homo sapiens] 63 1e-08
gi|13560269|dbj|BAB40920.1| myosin heavy chain 2a [Bos taurus] 63 1e-08
gi|22325381|ref|NP_062541.2| intersectin 2 isoform 3; SH3 domain... 63 1e-08
gi|7542783|gb|AAF63600.1| intersectin 2 [Homo sapiens] 63 1e-08
gi|15620933|dbj|BAB67830.1| KIAA1937 protein [Homo sapiens] 63 1e-08
gi|28830050|gb|AAO52540.1| similar to Entamoeba histolytica. Myo... 63 1e-08
gi|6321569|ref|NP_011646.1| Protein of unknown function; green f... 63 1e-08
gi|7486519|pir||T05892 hypothetical protein F6H11.110 - Arabidop... 63 1e-08
gi|50557322|ref|XP_506069.1| hypothetical protein [Yarrowia lipo... 63 1e-08
gi|6056207|gb|AAF02824.1| hypothetical protein [Arabidopsis thal... 63 1e-08
gi|40218526|gb|AAR83180.1| LPXTG anchored putative adhesin [Stre... 63 1e-08
gi|18977539|ref|NP_578896.1| smc-like [Pyrococcus furiosus DSM 3... 63 1e-08
gi|22330953|ref|NP_187629.2| kinesin motor protein-related [Arab... 63 1e-08
gi|15239130|ref|NP_201378.1| nuclear matrix constituent protein-... 63 1e-08
gi|23479124|gb|EAA16038.1| repeat organellar protein-related [Pl... 63 1e-08
gi|7416981|gb|AAF62393.1| catchin [Argopecten irradians] 62 2e-08
gi|15606308|ref|NP_213687.1| hypothetical protein aq_1006 [Aquif... 62 2e-08
gi|50752552|ref|XP_422827.1| PREDICTED: similar to Myosin heavy ... 62 2e-08
gi|23612343|ref|NP_703923.1| hypothetical protein [Plasmodium fa... 62 2e-08
gi|10045218|emb|CAC07818.1| tetrin A protein [Tetrahymena thermo... 62 2e-08
gi|3041706|sp|P13533|MYH6_HUMAN Myosin heavy chain, cardiac musc... 62 2e-08
gi|27764861|ref|NP_002462.1| myosin heavy chain 6; myosin heavy ... 62 2e-08
gi|24214915|ref|NP_712396.1| Chemotaxis motB protein [Leptospira... 62 2e-08
gi|4502781|ref|NP_001804.1| centromere protein E; Centromere aut... 62 2e-08
gi|382658|prf||1819485A CENP-E protein 62 2e-08
gi|31201125|ref|XP_309510.1| ENSANGP00000012681 [Anopheles gambi... 62 2e-08
gi|50421379|ref|XP_459239.1| unnamed protein product [Debaryomyc... 62 2e-08
gi|31204821|ref|XP_311359.1| ENSANGP00000016736 [Anopheles gambi... 62 2e-08
gi|2351221|dbj|BAA22068.1| myosin heavy chain [Cyprinus carpio] 62 2e-08
gi|50288085|ref|XP_446471.1| unnamed protein product [Candida gl... 62 2e-08
gi|23612484|ref|NP_704045.1| hypothetical protein [Plasmodium fa... 62 2e-08
gi|22122511|ref|NP_666146.1| meningioma expressed antigen 6 [Mus... 62 2e-08
gi|37956533|gb|AAP20593.1| effector protein B [Legionella pneumo... 62 3e-08
gi|20137006|ref|NP_071855.1| myosin heavy chain IX [Mus musculus... 62 3e-08
gi|236789|gb|AAB19995.1| myosin heavy chain=rod region [Aequipec... 62 3e-08
gi|7416979|gb|AAF62391.1| myosin heavy chain striated muscle spe... 62 3e-08
gi|3941320|gb|AAC82332.1| myosin [Schistosoma japonicum] 62 3e-08
gi|1085294|pir||PC4035 cell-cycle-dependent 350K nuclear protein... 62 3e-08
gi|6320562|ref|NP_010643.1| may be involved in connecting nuclea... 62 3e-08
gi|50806660|ref|XP_424476.1| PREDICTED: similar to Golgi autoant... 62 3e-08
gi|38347763|dbj|BAD01607.1| myosin heavy chain [Lethenteron japo... 62 3e-08
gi|24954555|gb|AAN64676.1| M protein [Streptococcus pyogenes] 62 3e-08
gi|28830036|gb|AAO52526.1| similar to Xenopus laevis (African cl... 62 3e-08
gi|476355|pir||A46762 myosin alpha heavy chain, cardiac muscle -... 62 3e-08
gi|38177589|gb|AAF00096.2| ventricular myosin heavy chain [Danio... 62 3e-08
gi|127773|sp|P24733|MYS_AEQIR Myosin heavy chain, striated muscl... 62 3e-08
gi|46229789|gb|EAK90607.1| SMC4'SMC4, chromosomal ATpase with gi... 61 4e-08
gi|18676506|dbj|BAB84905.1| FLJ00150 protein [Homo sapiens] 61 4e-08
gi|15605760|ref|NP_213137.1| putative protein [Aquifex aeolicus ... 61 4e-08
gi|48869678|ref|ZP_00322424.1| COG1196: Chromosome segregation A... 61 4e-08
gi|2498896|sp|Q60563|SCP1_MESAU Synaptonemal complex protein 1 (... 61 4e-08
gi|283896|pir||S18199 myosin heavy chain - chicken (fragment) >g... 61 4e-08
gi|48131565|ref|XP_393325.1| similar to LP08646p [Apis mellifera] 61 4e-08
gi|6682321|emb|CAB64663.1| pedal retractor muscle myosin heavy c... 61 4e-08
gi|6636514|gb|AAF20208.1| cingulin [Xenopus laevis] 61 4e-08
gi|27923756|sp|Q9PTD7|CING_XENLA Cingulin 61 4e-08
gi|50748610|ref|XP_421324.1| PREDICTED: similar to thyroid hormo... 61 4e-08
gi|18070853|emb|CAD20123.1| bA165P4.2 (centrosomal protein 1) [H... 61 4e-08
gi|12697534|emb|CAC28360.1| myosin heavy chain [Toxocara canis] 61 4e-08
gi|49641|emb|CAA30256.1| beta-myosin heavy chain (974 AA); S2 fr... 61 4e-08
gi|266596|sp|P29616|MYSC_CHICK Myosin heavy chain, cardiac muscl... 61 4e-08
gi|38158018|ref|NP_008949.3| centrosomal protein 1; centriole as... 61 4e-08
gi|8393804|ref|NP_058935.1| myosin heavy chain, polypeptide 6; m... 61 4e-08
gi|23480279|gb|EAA16880.1| hypothetical protein [Plasmodium yoel... 61 6e-08
gi|48894043|ref|ZP_00327241.1| COG0419: ATPase involved in DNA r... 61 6e-08
gi|2104553|gb|AAC31665.1| Myosin heavy chain (MHY11) (5'partial)... 61 6e-08
gi|21326823|dbj|BAC00527.1| caspase recruitment domain protein [... 61 6e-08
gi|7416983|gb|AAF62395.1| myosin heavy chain cardiac muscle spec... 61 6e-08
gi|497653|gb|AAC46490.1| myosin heavy chain >gnl|BL_ORD_ID|76853... 61 6e-08
gi|13549083|gb|AAK29628.1| Rho-associated coiled coil forming ki... 61 6e-08
gi|7416982|gb|AAF62394.1| myosin heavy chain cardiac muscle spec... 61 6e-08
gi|27529744|dbj|BAA74889.2| KIAA0866 protein [Homo sapiens] 61 6e-08
gi|13124879|ref|NP_002465.1| smooth muscle myosin heavy chain 11... 61 6e-08
gi|50417888|ref|XP_457732.1| unnamed protein product [Debaryomyc... 61 6e-08
gi|49618927|gb|AAT68048.1| chromosome adhesion protein SMC1-like... 61 6e-08
gi|4417214|dbj|BAA36971.1| smooth muscle myosin heavy chain [Hom... 61 6e-08
gi|45199155|ref|NP_986184.1| AFR637Wp [Eremothecium gossypii] >g... 61 6e-08
gi|23509114|ref|NP_701782.1| hypothetical protein [Plasmodium fa... 61 6e-08
gi|45382109|ref|NP_990097.1| myosin heavy chain [Gallus gallus] ... 61 6e-08
gi|13124875|ref|NP_074035.1| smooth muscle myosin heavy chain 11... 61 6e-08
gi|7416980|gb|AAF62392.1| myosin heavy chain catch (smooth) musc... 61 6e-08
gi|27695730|gb|AAH43115.1| 0610010D24Rik protein [Mus musculus] ... 60 7e-08
gi|47214961|emb|CAG10783.1| unnamed protein product [Tetraodon n... 60 7e-08
gi|19922172|ref|NP_610875.1| CG4840-PA [Drosophila melanogaster]... 60 7e-08
gi|3435244|gb|AAC32373.1| centriole associated protein CEP110 [H... 60 7e-08
gi|14017750|dbj|BAB47396.1| atrial myosin heacy chain [Gallus ga... 60 7e-08
gi|10045222|emb|CAC07820.1| tetrin C protein [Tetrahymena thermo... 60 7e-08
gi|4456475|emb|CAB36967.1| rfg5 protein [Homo sapiens] 60 7e-08
gi|50751436|ref|XP_422397.1| PREDICTED: similar to hypothetical ... 60 7e-08
gi|50738301|ref|XP_419285.1| PREDICTED: hypothetical protein XP_... 60 7e-08
gi|32422023|ref|XP_331455.1| hypothetical protein [Neurospora cr... 60 7e-08
gi|18606388|gb|AAH23021.1| Golgi autoantigen, golgin subfamily a... 60 7e-08
gi|32469749|sp|Q8TBA6|GOA5_HUMAN Golgi autoantigen, golgin subfa... 60 7e-08
gi|806513|dbj|BAA09068.1| myosin heavy chain [Cyprinus carpio] 60 7e-08
gi|47059089|ref|NP_080957.2| DVL-binding protein DAPLE [Mus musc... 60 7e-08
gi|50405259|ref|YP_054351.1| Guanylate nucleotide binding protei... 60 7e-08
gi|19074177|ref|NP_584783.1| MYOSIN HEAVY CHAIN [Encephalitozoon... 60 9e-08
gi|42661119|ref|XP_113947.2| KIAA0565 gene product [Homo sapiens] 60 9e-08
gi|806511|dbj|BAA09067.1| myosin heavy chain [Cyprinus carpio] 60 9e-08
gi|29246787|gb|EAA38371.1| GLP_375_25300_33276 [Giardia lamblia ... 60 9e-08
gi|50730729|ref|XP_417014.1| PREDICTED: similar to Chromosome 13... 60 9e-08
gi|7485354|pir||T05409 hypothetical protein F10M6.170 - Arabidop... 60 9e-08
gi|50308363|ref|XP_454183.1| unnamed protein product [Kluyveromy... 60 9e-08
gi|31088222|dbj|BAC76893.1| SMC1 alpha [Oryzias latipes] 60 9e-08
gi|49903415|gb|AAH76824.1| Unknown (protein for IMAGE:6642631) [... 60 9e-08
gi|13430502|gb|AAK25873.1| unknown protein [Arabidopsis thaliana] 60 9e-08
gi|39591600|emb|CAE71177.1| Hypothetical protein CBG18034 [Caeno... 60 9e-08
gi|18417960|ref|NP_567889.1| centromeric protein-related [Arabid... 60 9e-08
gi|1589173|prf||2210342A myosin:SUBUNIT=heavy chain 60 9e-08
gi|18309198|ref|NP_561132.1| probable exonuclease [Clostridium p... 60 9e-08
gi|47214148|emb|CAG07925.1| unnamed protein product [Tetraodon n... 60 9e-08
gi|21907898|dbj|BAC05679.1| myosin heavy chain 2a [Equus caballus] 60 9e-08
gi|2351219|dbj|BAA22067.1| myosin heavy chain [Cyprinus carpio] 60 9e-08
gi|50751217|ref|XP_422300.1| PREDICTED: similar to Tpr [Gallus g... 60 1e-07
gi|7507640|pir||T24806 hypothetical protein T10G3.5 - Caenorhabd... 60 1e-07
gi|23957777|ref|NP_473326.2| hypothetical protein [Plasmodium fa... 60 1e-07
gi|25150872|ref|NP_506347.2| similar to early endosome-associate... 60 1e-07
gi|127758|sp|P05659|MYSN_ACACA Myosin II heavy chain, non muscle... 60 1e-07
gi|39595022|emb|CAE70890.1| Hypothetical protein CBG17681 [Caeno... 60 1e-07
gi|45384060|ref|NP_990605.1| MHC mRNA [Gallus gallus] >gnl|BL_OR... 60 1e-07
gi|48894044|ref|ZP_00327242.1| COG0419: ATPase involved in DNA r... 60 1e-07
gi|23478426|gb|EAA15516.1| hypothetical protein [Plasmodium yoel... 60 1e-07
gi|3915778|sp|P10587|MYHB_CHICK Myosin heavy chain, gizzard smoo... 60 1e-07
gi|26325538|dbj|BAC26523.1| unnamed protein product [Mus musculus] 60 1e-07
gi|15217624|ref|NP_176615.1| myosin heavy chain-related [Arabido... 60 1e-07
gi|47211793|emb|CAF93707.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|49483397|ref|YP_040621.1| putative chromosome partition prote... 60 1e-07
gi|345377|pir||A45627 myosin heavy chain [similarity] - nematode... 60 1e-07
gi|50290531|ref|XP_447697.1| unnamed protein product [Candida gl... 60 1e-07
gi|21282846|ref|NP_645934.1| chromosome segregation SMC protein ... 60 1e-07
gi|50749030|ref|XP_426454.1| PREDICTED: similar to RIKEN cDNA 54... 60 1e-07
gi|11276949|pir||A59282 nonmuscle myosin II heavy chain A - Afri... 59 2e-07
gi|50547193|ref|XP_501066.1| hypothetical protein [Yarrowia lipo... 59 2e-07
gi|47220115|emb|CAF99028.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|34875216|ref|XP_225259.2| similar to Desmoplakin (DP) (250/21... 59 2e-07
gi|33468583|emb|CAE30366.1| SI:dZ204D19.2 (novel protein similar... 59 2e-07
gi|26330708|dbj|BAC29084.1| unnamed protein product [Mus musculus] 59 2e-07
gi|7305095|ref|NP_038775.1| golgi autoantigen, golgin subfamily ... 59 2e-07
gi|6649910|gb|AAF21628.1| Sumiko [Mus musculus] 59 2e-07
gi|26337435|dbj|BAC32403.1| unnamed protein product [Mus musculus] 59 2e-07
gi|6677761|ref|NP_033098.1| Rho-associated coiled-coil forming k... 59 2e-07
gi|19075736|ref|NP_588236.1| putative nuclear pore complex-assoc... 59 2e-07
gi|47225394|emb|CAG11877.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|47219440|emb|CAG10804.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|50510551|dbj|BAD32261.1| mKIAA0619 protein [Mus musculus] 59 2e-07
gi|16030073|emb|CAC93883.1| SMC protein [Lactococcus lactis subs... 59 2e-07
gi|37534452|ref|NP_921528.1| putative centromere protein [Oryza ... 59 2e-07
gi|5360746|dbj|BAA82144.1| myosin heavy chain 2a [Sus scrofa] 59 2e-07
gi|34864546|ref|XP_342068.1| similar to oocyte-testis gene 1 [Ra... 59 2e-07
gi|19879404|gb|AAK85118.1| non-muscle myosin II heavy chain [Lol... 59 2e-07
gi|7511962|pir||T13030 microtubule binding protein D-CLIP-190 - ... 59 2e-07
gi|12667788|ref|NP_002464.1| myosin, heavy polypeptide 9, non-mu... 59 2e-07
gi|23480825|gb|EAA17280.1| hypothetical protein [Plasmodium yoel... 59 2e-07
gi|1174758|sp|Q01173|TPM1_XENLA Tropomyosin 1 alpha chain (Alpha... 59 2e-07
gi|50510675|dbj|BAD32323.1| mKIAA0866 protein [Mus musculus] 59 2e-07
gi|34526505|dbj|BAC85130.1| FLJ00279 protein [Homo sapiens] 59 2e-07
gi|47575800|ref|NP_001001244.1| myosin heavy chain [Xenopus trop... 59 2e-07
gi|30260188|ref|NP_005104.2| Golgi autoantigen, golgin subfamily... 59 2e-07
gi|20070691|gb|AAH26142.1| Myh11 protein [Mus musculus] 59 2e-07
gi|13431676|sp|O08638|MYHB_MOUSE Myosin heavy chain, smooth musc... 59 2e-07
gi|39595021|emb|CAE70889.1| Hypothetical protein CBG17679 [Caeno... 59 2e-07
gi|15924224|ref|NP_371758.1| chromosome segregation SMC protein ... 59 2e-07
gi|47228659|emb|CAG07391.1| unnamed protein product [Tetraodon n... 59 2e-07
gi|20891813|ref|XP_147228.1| myosin heavy chain 11, smooth muscl... 59 2e-07
gi|23485476|gb|EAA20445.1| hypothetical protein [Plasmodium yoel... 59 2e-07
gi|7305295|ref|NP_038635.1| myosin heavy chain 11, smooth muscle... 59 2e-07
gi|14591553|ref|NP_143635.1| chromosome assembly protein [Pyroco... 59 2e-07
gi|3024609|sp|Q15431|SCP1_HUMAN Synaptonemal complex protein 1 (... 59 3e-07
gi|34878904|ref|NP_003167.2| synaptonemal complex protein 1 [Hom... 59 3e-07
gi|48096868|ref|XP_394789.1| similar to CG9170-PA [Apis mellifera] 59 3e-07
gi|47226278|emb|CAG09246.1| unnamed protein product [Tetraodon n... 59 3e-07
gi|34536017|dbj|BAC87508.1| unnamed protein product [Homo sapiens] 59 3e-07
gi|46229652|gb|EAK90470.1| hypothetical low complexity protein w... 59 3e-07
gi|46433735|gb|EAK93166.1| hypothetical protein CaO19.6148 [Cand... 59 3e-07
gi|23619332|ref|NP_705294.1| hypothetical protein [Plasmodium fa... 59 3e-07
gi|42659545|ref|XP_374779.1| ankyrin repeat domain 26 [Homo sapi... 59 3e-07
gi|50756261|ref|XP_415085.1| PREDICTED: similar to Golgi autoant... 59 3e-07
gi|33413774|gb|AAN39445.1| normocyte binding protein 2a [Plasmod... 59 3e-07
gi|1345731|sp|P49454|CENF_HUMAN CENP-F kinetochore protein (Cent... 59 3e-07
gi|189036|gb|AAA36349.1| nonmuscle myosin heavy chain (NMHC) 59 3e-07
gi|20178336|sp|P21107|TPM3_MOUSE Tropomyosin alpha 3 chain (Trop... 59 3e-07
gi|14521425|ref|NP_126901.1| purine NTPase, putative [Pyrococcus... 59 3e-07
gi|32566139|ref|NP_506065.2| MYOsin heavy chain structural gene,... 59 3e-07
gi|40789039|dbj|BAA83026.2| KIAA1074 protein [Homo sapiens] 59 3e-07
gi|20094127|ref|NP_613974.1| SMC1-family ATPase involved in DNA ... 59 3e-07
gi|1708901|sp|P50468|M21_STRPY M protein, serotype 2.1 precursor... 59 3e-07
gi|46431250|gb|EAK90848.1| hypothetical protein CaO19.2629 [Cand... 59 3e-07
gi|625305|pir||A61231 myosin heavy chain nonmuscle form A - human 59 3e-07
gi|7521921|pir||T30534 chromosome segregation protein SMC1 homol... 59 3e-07
gi|23510054|ref|NP_702720.1| hypothetical protein [Plasmodium fa... 59 3e-07
gi|48096459|ref|XP_392462.1| similar to CG18255-PA [Apis mellifera] 59 3e-07
gi|5817598|gb|AAD52842.1| myosin heavy chain [Pecten maximus] 59 3e-07
gi|7494144|pir||T18372 repeat organellar protein - Plasmodium ch... 59 3e-07
gi|50419711|ref|XP_458383.1| unnamed protein product [Debaryomyc... 59 3e-07
gi|11384448|pir||S02771 myosin heavy chain A [similarity] - Caen... 59 3e-07
gi|23509080|ref|NP_701748.1| hypothetical protein [Plasmodium fa... 58 4e-07
gi|25149352|ref|NP_741539.1| myosin heavy chain (5G32) [Caenorha... 58 4e-07
gi|7496266|pir||T34107 hypothetical protein C18C4.5 - Caenorhabd... 58 4e-07
gi|23484817|gb|EAA20018.1| hypothetical protein [Plasmodium yoel... 58 4e-07
gi|27545303|ref|NP_775383.1| laminin, beta 4 [Danio rerio] >gnl|... 58 4e-07
gi|7494317|pir||E71606 hypothetical protein PFB0765w - malaria p... 58 4e-07
gi|23593319|ref|NP_703169.1| hypothetical protein [Plasmodium fa... 58 4e-07
gi|46249876|gb|AAH68827.1| LOC414564 protein [Xenopus laevis] 58 4e-07
gi|32423201|ref|XP_332038.1| predicted protein [Neurospora crass... 58 4e-07
gi|33620941|gb|AAM29663.2| Hypothetical protein C18C4.5b [Caenor... 58 4e-07
gi|20178268|sp|P58773|TPM1_COTJA Tropomyosin 1 alpha chain (Alph... 58 4e-07
gi|38344252|emb|CAE04334.2| OSJNBa0008M17.5 [Oryza sativa (japon... 58 4e-07
gi|42476190|ref|NP_060004.2| myosin, heavy polypeptide 2, skelet... 58 4e-07
gi|13431716|sp|Q9UKX2|MYH2_HUMAN Myosin heavy chain, skeletal mu... 58 4e-07
gi|16758658|ref|NP_446266.1| Rho interacting protein 3 [Rattus n... 58 4e-07
gi|23490716|gb|EAA22427.1| hypothetical protein [Plasmodium yoel... 58 4e-07
gi|2687853|emb|CAA99729.1| RAD50 homologue hsRAD50 [Homo sapiens] 58 4e-07
gi|48097142|ref|XP_393700.1| similar to ENSANGP00000020478 [Apis... 58 4e-07
gi|25149347|ref|NP_741538.1| myosin heavy chain (5G32) [Caenorha... 58 4e-07
gi|39582082|emb|CAE63725.1| Hypothetical protein CBG08250 [Caeno... 58 4e-07
gi|1352713|sp|P49054|PAM_STRPY Plasminogen-binding group A stept... 58 4e-07
gi|21489941|ref|NP_659210.1| myosin, heavy polypeptide 2, skelet... 58 5e-07
gi|42782320|ref|NP_979567.1| LPXTG-motif cell wall anchor domain... 58 5e-07
gi|34867583|ref|XP_216765.2| similar to RET-II [Rattus norvegicus] 58 5e-07
gi|806515|dbj|BAA09069.1| myosin heavy chain [Cyprinus carpio] 58 5e-07
gi|39752677|ref|NP_945346.1| chromosome 18 open reading frame 34... 58 5e-07
gi|2129174|pir||A64505 P115 homolog - Methanococcus jannaschii 58 5e-07
gi|15669839|ref|NP_248653.1| chromosome segretation protein (smc... 58 5e-07
gi|48098685|ref|XP_392107.1| similar to CG4832-PA [Apis mellifera] 58 5e-07
gi|730093|sp|P39922|MYS3_HYDAT Myosin heavy chain, clone 203 >gn... 58 5e-07
gi|25072201|ref|NP_739563.1| oocyte-testis gene 1 [Mus musculus]... 58 5e-07
gi|23612730|ref|NP_704269.1| hypothetical protein [Plasmodium fa... 58 5e-07
gi|47223930|emb|CAG06107.1| unnamed protein product [Tetraodon n... 58 5e-07
gi|211226|gb|AAA48610.1| alpha-tropomyosin 58 5e-07
gi|47937522|gb|AAH72095.1| Unknown (protein for MGC:79010) [Xeno... 58 5e-07
gi|4503469|ref|NP_003557.1| early endosome antigen 1, 162kD; ear... 58 5e-07
gi|3205211|gb|AAC19403.1| non-muscle myosin heavy chain [Bos tau... 58 5e-07
gi|13431711|sp|Q90339|MYSS_CYPCA Myosin heavy chain, fast skelet... 58 5e-07
gi|32408715|ref|XP_324838.1| hypothetical protein [Neurospora cr... 58 5e-07
gi|25404512|pir||F96673 hypothetical protein F13O11.30 [imported... 58 5e-07
gi|42559523|sp|Q9BMM8|MYSP_SARSC Paramyosin >gnl|BL_ORD_ID|66920... 58 5e-07
gi|6981236|ref|NP_037326.1| myosin, heavy polypeptide 9; Myosin,... 58 5e-07
gi|47229709|emb|CAG06905.1| unnamed protein product [Tetraodon n... 58 5e-07
gi|23487793|gb|EAA21147.1| protein mix-1, putative [Plasmodium y... 58 5e-07
gi|28829086|gb|AAO51650.1| similar to Kaposi's sarcoma-associate... 58 5e-07
gi|15217810|ref|NP_176681.1| expressed protein [Arabidopsis thal... 58 5e-07
gi|28571853|ref|NP_651216.2| CG6129-PB [Drosophila melanogaster]... 57 6e-07
gi|47229710|emb|CAG06906.1| unnamed protein product [Tetraodon n... 57 6e-07
gi|15919888|dbj|BAB69456.1| mitotic kinesin-related protein [Hom... 57 6e-07
gi|47777455|gb|AAT38088.1| putative MAR binding protein [Oryza s... 57 6e-07
gi|31208633|ref|XP_313283.1| ENSANGP00000010426 [Anopheles gambi... 57 6e-07
gi|34870892|ref|XP_340820.1| similar to Myosin heavy chain, skel... 57 6e-07
gi|88933|pir||A24199 tropomyosin NM, skeletal muscle - human >gn... 57 6e-07
gi|27819643|ref|NP_777288.1| rho-associated, coiled-coil contain... 57 6e-07
gi|10944718|emb|CAC14169.1| C3VS protein [Canis familiaris] 57 6e-07
gi|21429746|gb|AAM50551.1| AT16851p [Drosophila melanogaster] 57 6e-07
gi|6807925|emb|CAB70720.1| hypothetical protein [Homo sapiens] 57 6e-07
gi|28571855|ref|NP_788730.1| CG6129-PC [Drosophila melanogaster]... 57 6e-07
gi|2674350|gb|AAB88727.1| M-phase phosphoprotein-1 [Homo sapiens] 57 6e-07
gi|6981478|ref|NP_037154.1| Rho-associated coiled-coil forming k... 57 6e-07
gi|23613660|ref|NP_704681.1| hypothetical protein [Plasmodium fa... 57 6e-07
gi|10437384|dbj|BAB15043.1| unnamed protein product [Homo sapiens] 57 6e-07
gi|136085|sp|P06753|TPM3_HUMAN Tropomyosin alpha 3 chain (Tropom... 57 6e-07
gi|7512524|pir||T17272 hypothetical protein DKFZp434B0435.1 - hu... 57 6e-07
gi|46049114|ref|NP_057279.2| M-phase phosphoprotein 1; mitotic k... 57 6e-07
gi|50417842|gb|AAH78228.1| Unknown (protein for MGC:101063) [Dan... 57 6e-07
gi|30021331|ref|NP_832962.1| surface protein [Bacillus cereus AT... 57 6e-07
gi|915306|gb|AAB50272.1| paramyosin-related protein 57 6e-07
gi|30984034|gb|AAP40331.1| M-phase phosphoprotein 1 [Homo sapiens] 57 6e-07
gi|1408192|gb|AAB03660.1| myosin heavy chain [Placopecten magell... 57 6e-07
gi|48106337|ref|XP_396089.1| similar to CG5020-PB [Apis mellifera] 57 6e-07
gi|11276953|pir||A59294 skeletal myosin - nematode (Onchocerca v... 57 6e-07
gi|23489781|gb|EAA21707.1| hypothetical protein [Plasmodium yoel... 57 6e-07
gi|34857050|ref|XP_215573.2| similar to SMC4 protein [Rattus nor... 57 6e-07
gi|47207986|emb|CAF91457.1| unnamed protein product [Tetraodon n... 57 6e-07
gi|46109064|ref|XP_381590.1| hypothetical protein FG01414.1 [Gib... 57 8e-07
gi|42520333|ref|NP_966248.1| hypothetical protein WD0462 [Wolbac... 57 8e-07
gi|30911061|gb|AAP41926.1| hypothetical protein [Homo sapiens] 57 8e-07
gi|31414576|dbj|BAC77268.1| UsoAp [Emericella nidulans] 57 8e-07
gi|48102332|ref|XP_392766.1| similar to 309 kDa centrosomal prot... 57 8e-07
gi|23480572|gb|EAA17097.1| hypothetical protein [Plasmodium yoel... 57 8e-07
gi|50415820|gb|AAH78168.1| LOC55580 protein [Homo sapiens] 57 8e-07
gi|15602639|ref|NP_245711.1| HyaE [Pasteurella multocida Pm70] >... 57 8e-07
gi|42784346|ref|NP_981593.1| endopeptidase lytE, putative [Bacil... 57 8e-07
gi|15625568|gb|AAL04164.1| Run- and FYVE-domain containing prote... 57 8e-07
gi|214606|gb|AAA49907.1| myosin heavy chain B 57 8e-07
gi|27923753|sp|P59242|CING_MOUSE Cingulin 57 8e-07
gi|50510881|dbj|BAD32426.1| mKIAA1319 protein [Mus musculus] 57 8e-07
gi|27503680|gb|AAH42459.1| Cgn protein [Mus musculus] 57 8e-07
gi|49085444|ref|XP_404843.1| hypothetical protein AN0706.2 [Aspe... 57 8e-07
gi|24850107|ref|NP_060457.2| RUN and FYVE domain-containing 2; R... 57 8e-07
gi|2274851|dbj|BAA21515.1| 3-7 gene product [Homo sapiens] 57 8e-07
gi|50745035|ref|XP_419954.1| PREDICTED: similar to Rho-associate... 57 8e-07
gi|7959341|dbj|BAA96061.1| KIAA1537 protein [Homo sapiens] 57 8e-07
gi|38566922|emb|CAE76225.1| related to putative cytoplasmic stru... 57 8e-07
gi|15643938|ref|NP_228987.1| chromosome segregation SMC protein,... 57 8e-07
gi|477266|pir||A48467 myosin heavy chain - nematode (Brugia mala... 57 8e-07
gi|38077877|ref|XP_131052.3| cingulin [Mus musculus] 57 8e-07
gi|38082284|ref|XP_355709.1| similar to Centromeric protein E (C... 57 8e-07
gi|23613557|ref|NP_704578.1| hypothetical protein [Plasmodium fa... 57 8e-07
gi|39582440|emb|CAE74824.1| Hypothetical protein CBG22662 [Caeno... 57 8e-07
gi|8923838|ref|NP_060041.1| hypothetical protein LOC55580 [Homo ... 57 8e-07
gi|29436380|gb|AAH49849.1| MYH9 protein [Homo sapiens] 57 8e-07
gi|29251543|gb|EAA43024.1| GLP_170_182668_185370 [Giardia lambli... 57 8e-07
gi|34222508|sp|Q15075|EEA1_HUMAN Early endosome antigen 1 (Endos... 57 8e-07
gi|50405118|ref|YP_054210.1| hypothetical protein, coiled-coil d... 57 8e-07
gi|39962871|gb|AAH64474.1| Cgn protein [Mus musculus] 57 8e-07
gi|39580127|emb|CAE56798.1| Hypothetical protein CBG24610 [Caeno... 57 8e-07
gi|32419136|ref|XP_330046.1| hypothetical protein [Neurospora cr... 57 8e-07
gi|50758577|ref|XP_417323.1| PREDICTED: similar to centrosomal p... 57 1e-06
gi|50409256|ref|XP_456854.1| unnamed protein product [Debaryomyc... 57 1e-06
gi|50405277|ref|YP_054369.1| hypothetical protein, coiled-coil d... 57 1e-06
gi|25406838|pir||A86188 hypothetical protein [imported] - Arabid... 57 1e-06
gi|19924131|ref|NP_597816.1| RAD50 homolog isoform 2; RAD50 (S. ... 57 1e-06
gi|1236759|emb|CAA58041.1| 256 kD golgin [Homo sapiens] 57 1e-06
gi|45383668|ref|NP_989559.1| myosin, heavy polypeptide 2, skelet... 57 1e-06
gi|32407187|ref|XP_324183.1| hypothetical protein [Neurospora cr... 57 1e-06
gi|37748633|gb|AAH60037.1| LOC55580 protein [Homo sapiens] 57 1e-06
gi|104776|pir||S24348 myosin heavy chain, embryonic and adult sk... 57 1e-06
gi|19924129|ref|NP_005723.2| RAD50 homolog isoform 1; RAD50 (S. ... 57 1e-06
gi|46227257|gb|EAK88207.1| Low complexity hypothetical protein [... 57 1e-06
gi|2760351|gb|AAB95253.1| myosin heavy chain [Girardia tigrina] 57 1e-06
gi|50302181|ref|XP_451024.1| unnamed protein product [Kluyveromy... 57 1e-06
gi|30679235|ref|NP_172024.2| myosin-related [Arabidopsis thaliana] 57 1e-06
gi|48893180|ref|ZP_00326449.1| COG1196: Chromosome segregation A... 57 1e-06
gi|48104261|ref|XP_392929.1| similar to ENSANGP00000017553 [Apis... 57 1e-06
gi|37536608|ref|NP_922606.1| putative kinesin-related protein [O... 57 1e-06
gi|6715600|ref|NP_002069.2| golgi autoantigen, golgin subfamily ... 57 1e-06
gi|48130462|ref|XP_396665.1| similar to hypothetical protein [Ap... 57 1e-06
gi|45382693|ref|NP_990808.1| myosin heavy chain, nonmuscle [Gall... 57 1e-06
gi|1173565|gb|AAC51791.1| golgin-245 [Homo sapiens] >gnl|BL_ORD_... 57 1e-06
gi|28872786|ref|NP_060719.3| CDK5 regulatory subunit associated ... 56 1e-06
gi|32470592|sp|P55937|GOA3_MOUSE Golgi autoantigen, golgin subfa... 56 1e-06
gi|39104485|dbj|BAC65567.3| mKIAA0445 protein [Mus musculus] 56 1e-06
gi|48133166|ref|XP_393334.1| similar to myosin heavy chain 2, mu... 56 1e-06
gi|37515173|gb|AAQ91890.1| Hypothetical protein ZC8.4d [Caenorha... 56 1e-06
gi|48111039|ref|XP_396284.1| similar to SMC2 protein [Apis melli... 56 1e-06
gi|7510855|pir||T29999 hypothetical protein ZC8.4 - Caenorhabdit... 56 1e-06
gi|25151529|ref|NP_508848.2| major antigen like (273.8 kD) (XF61... 56 1e-06
gi|34868391|ref|XP_342838.1| similar to SMC2 protein [Rattus nor... 56 1e-06
gi|207352|gb|AAA21803.1| minor striated-muscle alpha tropomyosin 56 1e-06
gi|24308155|ref|NP_060473.1| uveal autoantigen with coiled-coil ... 56 1e-06
gi|12045072|ref|NP_072883.1| cytadherence accessory protein (hmw... 56 1e-06
gi|20521940|dbj|BAB13387.2| KIAA1561 protein [Homo sapiens] 56 1e-06
gi|17554976|ref|NP_499280.1| myosin heavy (3L413) [Caenorhabditi... 56 1e-06
gi|4758648|ref|NP_004512.1| kinesin family member 5B; kinesin 1 ... 56 1e-06
gi|12240158|gb|AAG49576.1| uveal autoantigen [Bos taurus] 56 1e-06
gi|39590658|emb|CAE65028.1| Hypothetical protein CBG09866 [Caeno... 56 1e-06
gi|1079274|pir||JC2551 tropomyosin alpha chain - axolotl >gnl|BL... 56 1e-06
gi|31873344|emb|CAD97663.1| hypothetical protein [Homo sapiens] 56 1e-06
gi|92921|pir||B27407 tropomyosin alpha chain, striated muscle - rat 56 1e-06
gi|1351289|sp|P04692|TPM1_RAT Tropomyosin 1 alpha chain (Alpha-t... 56 1e-06
gi|17570563|ref|NP_508847.1| major antigen like (XF611) [Caenorh... 56 1e-06
gi|34870880|ref|XP_340818.1| myosin, heavy polypeptide 4 [Rattus... 56 1e-06
gi|1477559|gb|AAC47238.1| non-muscle myosin heavy chain II 56 1e-06
gi|47211645|emb|CAF92169.1| unnamed protein product [Tetraodon n... 56 1e-06
gi|45658257|ref|YP_002343.1| chromosome segregation protein [Lep... 56 1e-06
gi|39584073|emb|CAE66479.1| Hypothetical protein CBG11758 [Caeno... 56 1e-06
gi|38085189|ref|XP_355166.1| similar to CG5882-PA [Mus musculus] 56 1e-06
gi|32449692|gb|AAH54054.1| LOC230872 protein [Mus musculus] 56 1e-06
gi|24214009|ref|NP_711490.1| chromosome segregation protein [Lep... 56 1e-06
gi|23379831|gb|AAM88910.1| fast myosin heavy chain HCIII [Gallus... 56 1e-06
gi|11360366|pir||T42722 male-enhanced antigen-2 - mouse 56 1e-06
gi|26006473|ref|NP_742120.1| rootletin [Mus musculus] >gnl|BL_OR... 56 1e-06
gi|422615|pir||A47297 myosin heavy chain form B, nonmuscle - Afr... 56 1e-06
gi|23619130|ref|NP_705092.1| chromosome segregation protein, put... 56 2e-06
gi|31873449|emb|CAD97819.1| hypothetical protein [Homo sapiens] 56 2e-06
gi|39587788|emb|CAE67806.1| Hypothetical protein CBG13384 [Caeno... 56 2e-06
gi|553596|gb|AAA59888.1| cellular myosin heavy chain 56 2e-06
gi|212449|gb|AAA48985.1| nonmuscle myosin heavy chain 56 2e-06
gi|33578097|gb|AAQ22369.1| chromosomal segregation protein [Meth... 56 2e-06
gi|39597982|emb|CAE68674.1| Hypothetical protein CBG14578 [Caeno... 56 2e-06
gi|7512169|pir||T14156 kinesin-related protein - African clawed ... 56 2e-06
gi|45382679|ref|NP_990805.1| nonmuscle myosin heavy chain [Gallu... 56 2e-06
gi|38488753|ref|NP_942118.1| myosin, heavy polypeptide 6, cardia... 56 2e-06
gi|50511089|dbj|BAD32530.1| mKIAA1749 protein [Mus musculus] 56 2e-06
gi|2135241|pir||I38153 gene retII protein - human >gnl|BL_ORD_ID... 56 2e-06
gi|136087|sp|P13105|TPM1_RANTE Tropomyosin 1 alpha chain (Alpha-... 56 2e-06
gi|173241|gb|AAA35239.1| ZIP1 protein 56 2e-06
gi|6320491|ref|NP_010571.1| Synaptonemal complex (SC) protein th... 56 2e-06
gi|586122|sp|P22793|TRHY_SHEEP Trichohyalin >gnl|BL_ORD_ID|21738... 56 2e-06
gi|31239093|ref|XP_319960.1| ENSANGP00000016740 [Anopheles gambi... 56 2e-06
gi|41191863|ref|XP_209505.3| similar to KIAA0445 protein [Homo s... 56 2e-06
gi|212451|gb|AAA48987.1| nonmuscle myosin heavy chain 56 2e-06
gi|39592202|emb|CAE75423.1| Hypothetical protein CBG23416 [Caeno... 56 2e-06
gi|4928755|gb|AAD33718.1| myosin heavy chain [Amoeba proteus] 56 2e-06
gi|7499530|pir||T21174 hypothetical protein F20G4.3 - Caenorhabd... 56 2e-06
>gi|17508869|ref|NP_491787.1| very Early Transcript VET-1,
anti-apoptotic factor 1 like (vet-1) [Caenorhabditis
elegans]
gi|7507206|pir||T15246 hypothetical protein T05E7.5 - Caenorhabditis
elegans
gi|2088796|gb|AAB54217.1| Hypothetical protein T05E7.5
[Caenorhabditis elegans]
Length = 381
Score = 755 bits (1949), Expect = 0.0
Identities = 381/381 (100%), Positives = 381/381 (100%)
Frame = -1
Query: 1146 MTSLDPINILCSSTEDHHTMQRFSKIVNIDPYLDAVNSHHRSLSLFFRSNYSFSPNILKR 967
MTSLDPINILCSSTEDHHTMQRFSKIVNIDPYLDAVNSHHRSLSLFFRSNYSFSPNILKR
Sbjct: 1 MTSLDPINILCSSTEDHHTMQRFSKIVNIDPYLDAVNSHHRSLSLFFRSNYSFSPNILKR 60
Query: 966 TETMFAENPFFTPTESKLKSEIALLQMKLDDERFDHQKTRRELANSRLEISDLKGEAKCH 787
TETMFAENPFFTPTESKLKSEIALLQMKLDDERFDHQKTRRELANSRLEISDLKGEAKCH
Sbjct: 61 TETMFAENPFFTPTESKLKSEIALLQMKLDDERFDHQKTRRELANSRLEISDLKGEAKCH 120
Query: 786 DSELNRLYTIINNLEKKVEDLNGEHQKSLEKLKERLHEKDAFIEACEEFYDEKKINVNKM 607
DSELNRLYTIINNLEKKVEDLNGEHQKSLEKLKERLHEKDAFIEACEEFYDEKKINVNKM
Sbjct: 121 DSELNRLYTIINNLEKKVEDLNGEHQKSLEKLKERLHEKDAFIEACEEFYDEKKINVNKM 180
Query: 606 TLMKQEMELKRIKKNFEEYKERMTEVEKNLNEFIKRQSAICMGVRYELNMEKDSRERYFK 427
TLMKQEMELKRIKKNFEEYKERMTEVEKNLNEFIKRQSAICMGVRYELNMEKDSRERYFK
Sbjct: 181 TLMKQEMELKRIKKNFEEYKERMTEVEKNLNEFIKRQSAICMGVRYELNMEKDSRERYFK 240
Query: 426 EAQQLKQEKDVLVHEINEREVRILCLRSDILTLKSENNDTSKELDEMKNGTKALKHELEE 247
EAQQLKQEKDVLVHEINEREVRILCLRSDILTLKSENNDTSKELDEMKNGTKALKHELEE
Sbjct: 241 EAQQLKQEKDVLVHEINEREVRILCLRSDILTLKSENNDTSKELDEMKNGTKALKHELEE 300
Query: 246 TKKMKSEALSKYEESQKEFEQFNLKFQRLCTKFYEERVSSQTTSPKMKEHLASAKKRLSA 67
TKKMKSEALSKYEESQKEFEQFNLKFQRLCTKFYEERVSSQTTSPKMKEHLASAKKRLSA
Sbjct: 301 TKKMKSEALSKYEESQKEFEQFNLKFQRLCTKFYEERVSSQTTSPKMKEHLASAKKRLSA 360
Query: 66 IKETLQNEEDFDETGEVTNYQ 4
IKETLQNEEDFDETGEVTNYQ
Sbjct: 361 IKETLQNEEDFDETGEVTNYQ 381