Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T05E12_3
(786 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563898|ref|NP_507324.1| tumor necrosis factor protein like ... 467 e-130
gi|17537789|ref|NP_494481.1| tumor necrosis factor protein like ... 107 4e-22
gi|39584625|emb|CAE72378.1| Hypothetical protein CBG19532 [Caeno... 105 1e-21
gi|34365970|gb|AAB66172.2| Hypothetical protein F22E5.6 [Caenorh... 103 4e-21
gi|17537787|ref|NP_494479.1| tumor necrosis factor protein like ... 100 3e-20
gi|17537783|ref|NP_494473.1| tumor necrosis factor protein like ... 100 3e-20
gi|17533427|ref|NP_494315.1| tumor necrosis factor protein like ... 100 6e-20
gi|49035198|gb|AAC68758.2| Hypothetical protein C40A11.4 [Caenor... 98 2e-19
gi|17533423|ref|NP_494320.1| tumor necrosis factor protein like ... 97 4e-19
gi|17531267|ref|NP_494231.1| tumor necrosis factor alpha-induced... 95 2e-18
gi|17531265|ref|NP_494230.1| tumor necrosis factor protein like ... 94 3e-18
gi|17532343|ref|NP_494195.1| tumor necrosis factor protein like ... 94 4e-18
gi|17532347|ref|NP_494197.1| tumor necrosis factor alpha-inducib... 93 6e-18
gi|17532349|ref|NP_494199.1| tumor necrosis factor protein like ... 93 6e-18
gi|17537777|ref|NP_494476.1| tumor necrosis factor protein like ... 92 1e-17
gi|7497242|pir||T33590 hypothetical protein C40A11.6 - Caenorhab... 92 2e-17
gi|49035209|gb|AAK72056.2| Hypothetical protein C17F4.8 [Caenorh... 90 6e-17
gi|17532341|ref|NP_494196.1| binding protein 1 like family membe... 85 2e-15
gi|7497238|pir||T33591 hypothetical protein C40A11.2 - Caenorhab... 85 2e-15
gi|33285212|gb|AAC68760.3| Hypothetical protein C40A11.2 [Caenor... 85 2e-15
gi|17537791|ref|NP_494482.1| tumor necrosis factor alpha-induced... 83 6e-15
gi|7510657|pir||T25976 hypothetical protein ZC239.14 - Caenorhab... 83 8e-15
gi|17531929|ref|NP_494485.1| tumor necrosis factor protein like ... 83 8e-15
gi|7496212|pir||T31922 hypothetical protein C17F4.4 - Caenorhabd... 83 8e-15
gi|32565260|ref|NP_494198.2| k+ channel tetramerisation containi... 82 1e-14
gi|7499686|pir||T32065 hypothetical protein F22E5.8 - Caenorhabd... 81 2e-14
gi|17534877|ref|NP_494292.1| k+ channel tetramerisation containi... 80 4e-14
gi|17534883|ref|NP_494291.1| k+ channel tetramerisation containi... 80 5e-14
gi|49035126|gb|AAB66105.2| Hypothetical protein K02F6.5 [Caenorh... 80 5e-14
gi|39596122|emb|CAE69758.1| Hypothetical protein CBG16039 [Caeno... 80 5e-14
gi|33300420|emb|CAE17930.1| Hypothetical protein T08G3.13 [Caeno... 72 1e-11
gi|39591890|emb|CAE71468.1| Hypothetical protein CBG18386 [Caeno... 72 1e-11
gi|7510660|pir||T25980 hypothetical protein ZC239.17 - Caenorhab... 72 2e-11
gi|32309479|gb|AAP79438.1| tumor necrosis factor alpha-induced p... 71 3e-11
gi|32564774|ref|NP_494474.2| k+ channel tetramerisation containi... 70 5e-11
gi|47027968|gb|AAT09002.1| potassium channel tetramerization dom... 70 5e-11
gi|7510665|pir||T25971 hypothetical protein ZC239.6 - Caenorhabd... 70 5e-11
gi|29840923|gb|AAP05924.1| similar to NM_031954 MSTP028 protein ... 70 5e-11
gi|13994353|ref|NP_114160.1| potassium channel tetramerisation d... 70 7e-11
gi|14042295|dbj|BAB55188.1| unnamed protein product [Homo sapiens] 70 7e-11
gi|29725637|ref|NP_080421.2| potassium channel tetramerization d... 69 9e-11
gi|17552822|ref|NP_499312.1| tumor necrosis factor protein like ... 69 9e-11
gi|50603619|gb|AAH77866.1| Unknown (protein for MGC:80602) [Xeno... 69 9e-11
gi|30578412|ref|NP_849194.1| potassium channel tetramerisation d... 69 1e-10
gi|16152040|gb|AAL14962.1| polymerase delta-interacting protein ... 69 1e-10
gi|15072406|gb|AAK27301.1| TNFAIP1-like protein [Homo sapiens] 69 1e-10
gi|50756506|ref|XP_415191.1| PREDICTED: similar to potassium cha... 69 1e-10
gi|38454208|ref|NP_942031.1| PDIP1 [Rattus norvegicus] >gnl|BL_O... 68 2e-10
gi|27370096|ref|NP_766335.1| potassium channel tetramerisation d... 68 2e-10
gi|47087317|ref|NP_998643.1| zgc:63846 [Danio rerio] >gnl|BL_ORD... 67 6e-10
gi|39579832|emb|CAE56658.1| Hypothetical protein CBG24423 [Caeno... 66 7e-10
gi|48106238|ref|XP_396071.1| similar to ENSANGP00000017088 [Apis... 65 2e-09
gi|49035170|gb|AAB66175.2| Hypothetical protein F22E5.11 [Caenor... 65 2e-09
gi|17533433|ref|NP_494317.1| tumor necrosis factor protein like ... 65 2e-09
gi|482321|pir||A41784 tumor necrosis factor-alpha-induced protei... 64 4e-09
gi|10863937|ref|NP_066960.1| tumor necrosis factor, alpha-induce... 64 4e-09
gi|47226516|emb|CAG08532.1| unnamed protein product [Tetraodon n... 64 4e-09
gi|50758428|ref|XP_415918.1| PREDICTED: similar to tumor necrosi... 64 5e-09
gi|17537779|ref|NP_494475.1| polymerase delta-interacting protei... 64 5e-09
gi|31216443|ref|XP_316233.1| ENSANGP00000017088 [Anopheles gambi... 62 1e-08
gi|33636730|ref|NP_891995.1| tumor necrosis factor, alpha-induce... 62 2e-08
gi|47224923|emb|CAG06493.1| unnamed protein product [Tetraodon n... 61 2e-08
gi|3114713|gb|AAC78826.1| Edp1 protein [Mus musculus] >gnl|BL_OR... 61 3e-08
gi|39597204|emb|CAE59431.1| Hypothetical protein CBG02803 [Caeno... 60 4e-08
gi|7510656|pir||T25977 hypothetical protein ZC239.13 - Caenorhab... 59 9e-08
gi|17533315|ref|NP_496768.1| tumor necrosis factor alpha-induced... 59 1e-07
gi|7505153|pir||T32393 hypothetical protein K02E7.4 - Caenorhabd... 59 1e-07
gi|41054225|ref|NP_956093.1| tumor necrosis factor, alpha-induce... 59 1e-07
gi|38048469|gb|AAR10137.1| similar to Drosophila melanogaster CG... 59 2e-07
gi|39581661|emb|CAE57169.1| Hypothetical protein CBG00003 [Caeno... 59 2e-07
gi|31543878|ref|NP_033421.2| tumor necrosis factor, alpha-induce... 58 2e-07
gi|19921650|ref|NP_610165.1| CG10465-PA [Drosophila melanogaster... 58 2e-07
gi|39585069|emb|CAE62720.1| Hypothetical protein CBG06877 [Caeno... 56 1e-06
gi|17537773|ref|NP_494478.1| tumor necrosis factor alpha-induced... 55 1e-06
gi|32565279|ref|NP_494229.2| putative cytoplasmic protein family... 55 2e-06
gi|17537775|ref|NP_494477.1| k+ channel tetramerisation containi... 54 4e-06
gi|50728786|ref|XP_416282.1| PREDICTED: similar to hypothetical ... 53 6e-06
gi|39588595|emb|CAE58118.1| Hypothetical protein CBG01205 [Caeno... 53 8e-06
gi|17534879|ref|NP_494290.1| polymerase delta-interacting protei... 52 1e-05
gi|50539726|ref|NP_001002329.1| zgc:91884 [Danio rerio] >gnl|BL_... 52 1e-05
gi|7494820|pir||T31995 hypothetical protein B0281.4 - Caenorhabd... 52 1e-05
gi|17533435|ref|NP_494318.1| k+ channel tetramerisation containi... 52 1e-05
gi|38077843|ref|XP_110121.4| expressed sequence AA414907 [Mus mu... 52 2e-05
gi|21410256|gb|AAH31038.1| FLJ12242 protein [Homo sapiens] 52 2e-05
gi|34866908|ref|XP_217075.2| similar to hypothetical protein FLJ... 52 2e-05
gi|50731305|ref|XP_425657.1| PREDICTED: similar to KCTD11 protei... 52 2e-05
gi|13489099|ref|NP_078957.1| hypothetical protein FLJ12242 [Homo... 52 2e-05
gi|47225999|emb|CAG04373.1| unnamed protein product [Tetraodon n... 51 3e-05
gi|27369698|ref|NP_766097.1| potassium channel tetramerisation d... 51 3e-05
gi|34872042|ref|XP_341069.1| similar to RIKEN cDNA 9430010P06 [R... 51 3e-05
gi|26325874|dbj|BAC26691.1| unnamed protein product [Mus musculus] 51 3e-05
gi|21397267|gb|AAM51831.1| Putative FH protein interacting prote... 51 3e-05
gi|42659746|ref|XP_374915.1| similar to KCTD11 protein [Homo sap... 51 3e-05
gi|34857778|ref|XP_214992.2| similar to glucosyltransferase [Rat... 50 4e-05
gi|15240437|ref|NP_200311.1| potassium channel tetramerisation d... 50 7e-05
gi|47223165|emb|CAG11300.1| unnamed protein product [Tetraodon n... 50 7e-05
gi|30696554|ref|NP_851193.1| potassium channel tetramerisation d... 50 7e-05
gi|23308551|ref|NP_694578.1| potassium channel tetramerisation d... 49 9e-05
gi|29789207|ref|NP_082058.1| potassium channel tetramerisation d... 49 9e-05
gi|27503738|gb|AAH42482.1| KCTD7 protein [Homo sapiens] 49 9e-05
gi|22761296|dbj|BAC11531.1| unnamed protein product [Homo sapiens] 49 1e-04
gi|50754483|ref|XP_414405.1| PREDICTED: similar to potassium cha... 49 1e-04
gi|34869548|ref|XP_223921.2| similar to hypothetical protein MGC... 49 2e-04
gi|18606121|gb|AAH22893.1| KCTD6 protein [Homo sapiens] 49 2e-04
gi|39752849|gb|AAC67476.2| Hypothetical protein F58E1.13 [Caenor... 48 3e-04
gi|50759524|ref|XP_417677.1| PREDICTED: similar to potassium cha... 48 3e-04
gi|50400984|sp|Q80UN1|KDD9_MOUSE Potassium channel tetramerisati... 47 4e-04
gi|47221392|emb|CAF97310.1| unnamed protein product [Tetraodon n... 47 4e-04
gi|46329875|gb|AAH68518.1| Potassium channel tetramerisation dom... 47 4e-04
gi|39753959|ref|NP_060104.2| potassium channel tetramerisation d... 47 4e-04
gi|1136412|dbj|BAA11493.1| KIAA0176 [Homo sapiens] 47 5e-04
gi|40255153|ref|NP_699162.2| potassium channel tetramerisation d... 47 5e-04
gi|39590888|emb|CAE65262.1| Hypothetical protein CBG10153 [Caeno... 47 5e-04
gi|50403777|sp|Q14681|KDD2_HUMAN Potassium channel tetramerisati... 47 5e-04
gi|47217202|emb|CAG11038.1| unnamed protein product [Tetraodon n... 47 6e-04
gi|31201379|ref|XP_309637.1| ENSANGP00000004083 [Anopheles gambi... 47 6e-04
gi|34881138|ref|XP_223057.2| similar to RIKEN cDNA E330032J19 [R... 46 8e-04
gi|33871013|gb|AAH13868.1| KCTD3 protein [Homo sapiens] 46 8e-04
gi|46255026|ref|NP_057205.2| potassium channel tetramerisation d... 46 8e-04
gi|28571504|ref|NP_649465.3| CG14647-PA [Drosophila melanogaster... 46 8e-04
gi|5360115|gb|AAD42876.1| NY-REN-45 antigen [Homo sapiens] 46 8e-04
gi|27369936|ref|NP_766238.1| potassium channel tetramerisation d... 46 8e-04
gi|23272394|gb|AAH33329.1| KCTD2 protein [Homo sapiens] 46 8e-04
gi|48099351|ref|XP_394892.1| similar to ENSANGP00000004083 [Apis... 46 8e-04
gi|38181770|gb|AAH61458.1| Kctd3 protein [Mus musculus] 46 8e-04
gi|49903979|gb|AAH76416.1| Zgc:101020 protein [Danio rerio] 46 0.001
gi|24639124|ref|NP_569926.2| CG32810-PB [Drosophila melanogaster... 45 0.001
gi|3292929|emb|CAA19832.1| EG:196F3.2 [Drosophila melanogaster] 45 0.001
gi|46309467|ref|NP_996932.1| Unknown (protein for MGC:77244); wu... 45 0.002
gi|37359818|dbj|BAC97887.1| mKIAA0176 protein [Mus musculus] 45 0.002
gi|30794420|ref|NP_081284.1| potassium channel tetramerisation d... 45 0.002
gi|34857847|ref|XP_218935.2| similar to hypothetical protein MGC... 45 0.002
gi|17534521|ref|NP_494046.1| putative cytoplasmic protein family... 44 0.003
gi|17861850|gb|AAL39402.1| GM03763p [Drosophila melanogaster] 44 0.003
gi|47217614|emb|CAG03011.1| unnamed protein product [Tetraodon n... 44 0.004
gi|31204239|ref|XP_311068.1| ENSANGP00000019957 [Anopheles gambi... 44 0.004
gi|50745453|ref|XP_420119.1| PREDICTED: similar to Hypothetical ... 44 0.004
gi|50755761|ref|XP_414889.1| PREDICTED: similar to Potassium cha... 44 0.004
gi|19354519|gb|AAH24588.1| Similar to hypothetical protein MGC23... 44 0.005
gi|9506651|ref|NP_061865.1| potassium channel tetramerisation do... 44 0.005
gi|34870500|ref|XP_220224.2| similar to RIKEN cDNA 2610030N08 [R... 44 0.005
gi|23509069|ref|NP_701737.1| hypothetical protein [Plasmodium fa... 44 0.005
gi|18044361|gb|AAH19929.1| KCTD11 protein [Homo sapiens] 43 0.007
gi|17534921|ref|NP_493993.1| k+ channel tetramerisation containi... 43 0.007
gi|7508724|pir||T26019 hypothetical protein VM106R.1 - Caenorhab... 43 0.007
gi|50370190|gb|AAH76863.1| Unknown (protein for MGC:84606) [Xeno... 43 0.009
gi|50604158|gb|AAH77515.1| Unknown (protein for MGC:82704) [Xeno... 43 0.009
gi|41150574|ref|XP_372680.1| similar to Hypothetical protein KIA... 43 0.009
gi|39581604|emb|CAE58389.1| Hypothetical protein CBG01518 [Caeno... 43 0.009
gi|47219253|emb|CAG11715.1| unnamed protein product [Tetraodon n... 42 0.011
gi|25152459|ref|NP_510217.2| DNA segment Chr 1 ERATO Doi 8 expre... 42 0.011
gi|39597372|emb|CAE59600.1| Hypothetical protein CBG03007 [Caeno... 42 0.019
gi|39596745|emb|CAE63364.1| Hypothetical protein CBG07773 [Caeno... 41 0.033
gi|30186134|gb|AAH51544.1| Kctd7 protein [Mus musculus] 41 0.033
gi|17564592|ref|NP_505177.1| k+ channel tetramerisation containi... 41 0.033
gi|38088808|ref|XP_133614.2| similar to hypothetical protein MGC... 41 0.033
gi|31204791|ref|XP_311344.1| ENSANGP00000021386 [Anopheles gambi... 40 0.043
gi|13365905|dbj|BAB39326.1| hypothetical protein [Macaca fascicu... 40 0.043
gi|34875254|ref|XP_344427.1| similar to AA675328 protein [Rattus... 40 0.043
gi|35903041|ref|NP_919386.1| leftover [Danio rerio] >gnl|BL_ORD_... 40 0.043
gi|24645528|ref|NP_649952.1| CG9467-PA [Drosophila melanogaster]... 40 0.056
gi|46228821|gb|EAK89691.1| POZ domain protein, related to tetram... 40 0.056
gi|31541865|ref|NP_080490.2| potassium channel tetramerisation d... 40 0.073
gi|47211185|emb|CAF92412.1| unnamed protein product [Tetraodon n... 40 0.073
gi|21355997|ref|NP_650926.1| CG10830-PA [Drosophila melanogaster... 40 0.073
gi|47228587|emb|CAG05407.1| unnamed protein product [Tetraodon n... 40 0.073
gi|38257144|ref|NP_940686.1| potassium channel tetramerisation d... 39 0.096
gi|50401158|sp|Q9D7X1|KDD4_MOUSE Potassium channel tetramerisati... 39 0.096
gi|12856910|dbj|BAB30826.1| unnamed protein product [Mus musculus] 39 0.096
gi|38087022|ref|XP_355918.1| similar to RIKEN cDNA 5430433B02 [M... 39 0.12
gi|50755256|ref|XP_425217.1| PREDICTED: similar to KIAA1317 prot... 39 0.12
gi|17553484|ref|NP_498381.1| k+ channel tetramerisation containi... 39 0.12
gi|50730895|ref|XP_417068.1| PREDICTED: similar to CLLD4-like pr... 39 0.12
gi|26449912|dbj|BAC42077.1| unknown protein [Arabidopsis thaliana] 39 0.16
gi|15232005|ref|NP_187515.1| potassium channel tetramerisation d... 39 0.16
gi|12847892|dbj|BAB27750.1| unnamed protein product [Mus musculus] 39 0.16
gi|17551116|ref|NP_508239.1| k+ channel tetramerisation containi... 39 0.16
gi|27700833|ref|XP_224261.1| similar to hypothetical protein BC0... 38 0.21
gi|34875337|ref|XP_343985.1| similar to KCTD2 protein [Rattus no... 38 0.21
gi|21733273|emb|CAD38633.1| hypothetical protein [Homo sapiens] 38 0.21
gi|13027592|ref|NP_076419.1| hypothetical protein MGC2376 [Homo ... 37 0.36
gi|26335191|dbj|BAC31296.1| unnamed protein product [Mus musculus] 37 0.36
gi|47222945|emb|CAF99101.1| unnamed protein product [Tetraodon n... 37 0.36
gi|31203331|ref|XP_310614.1| ENSANGP00000019366 [Anopheles gambi... 37 0.36
gi|38083670|ref|XP_356997.1| similar to KIAA1317 protein [Mus mu... 37 0.36
gi|34879324|ref|XP_225971.2| similar to KIAA1317 protein [Rattus... 37 0.47
gi|38198663|ref|NP_938167.1| potassium channel tetramerisation d... 37 0.47
gi|21699030|ref|NP_619617.1| Sh3kbp1 binding protein 1; SETA bin... 37 0.47
gi|38494368|gb|AAH61477.1| Sh3kbp1 binding protein 1 [Mus musculus] 37 0.47
gi|47216460|emb|CAG02111.1| unnamed protein product [Tetraodon n... 37 0.47
gi|50345110|ref|NP_001002224.1| zgc:92463 [Danio rerio] >gnl|BL_... 37 0.47
gi|50731299|ref|XP_417221.1| PREDICTED: similar to hypothetical ... 37 0.47
gi|34304089|ref|NP_899108.1| potassium channel tetramerisation d... 37 0.47
gi|34877405|ref|XP_344238.1| similar to hypothetical protein BC0... 37 0.47
gi|45430039|ref|NP_991377.1| CLLD4-like protein [Bos taurus] >gn... 37 0.47
gi|42657241|ref|XP_098368.4| KIAA1317 protein [Homo sapiens] 37 0.62
gi|46195444|ref|NP_996857.1| potassium channel regulator [Mus mu... 37 0.62
gi|7243015|dbj|BAA92555.1| KIAA1317 protein [Homo sapiens] 37 0.62
gi|37534712|ref|NP_921658.1| putative FH protein interacting pro... 37 0.62
gi|50776278|ref|XP_423258.1| PREDICTED: similar to potassium cha... 37 0.62
gi|40807368|ref|NP_955751.1| KCNRG [Homo sapiens] >gnl|BL_ORD_ID... 36 0.81
gi|46249626|gb|AAH68871.1| MGC82296 protein [Xenopus laevis] 36 0.81
gi|31982195|ref|NP_780728.2| potassium channel tetramerisation d... 36 0.81
gi|26335653|dbj|BAC31527.1| unnamed protein product [Mus musculus] 36 0.81
gi|26333089|dbj|BAC30262.1| unnamed protein product [Mus musculus] 36 0.81
gi|27734697|ref|NP_775876.1| potassium channel regulator [Homo s... 36 0.81
gi|15235765|ref|NP_194823.1| potassium channel tetramerisation d... 36 1.1
gi|39594850|emb|CAE70718.1| Hypothetical protein CBG17460 [Caeno... 36 1.1
gi|10834652|gb|AAG23756.1| PP203 [Homo sapiens] 36 1.1
gi|19923917|ref|NP_612401.1| hypothetical protein BC007653 [Homo... 36 1.1
gi|47226130|emb|CAG04504.1| unnamed protein product [Tetraodon n... 35 1.4
gi|48096421|ref|XP_394688.1| similar to ENSANGP00000021478 [Apis... 35 1.4
gi|22760899|dbj|BAC11374.1| unnamed protein product [Homo sapiens] 35 1.4
gi|50753551|ref|XP_414036.1| PREDICTED: similar to hypothetical ... 35 1.4
gi|28828292|gb|AAO50956.1| hypothetical protein [Dictyostelium d... 35 1.8
gi|38345531|emb|CAD41301.2| OSJNBa0020J04.6 [Oryza sativa (japon... 35 1.8
gi|42661083|ref|XP_085689.4| similar to KCTD11 protein [Homo sap... 35 1.8
gi|46135145|ref|ZP_00162442.2| COG2831: Hemolysin activation/sec... 35 1.8
gi|48840219|ref|ZP_00297147.1| COG0438: Glycosyltransferase [Met... 35 1.8
gi|23490772|gb|EAA22466.1| unnamed protein product, putative [Pl... 35 1.8
gi|29244318|ref|NP_808459.1| hypothetical protein 4922504H04 [Mu... 35 2.4
gi|47196248|emb|CAF89012.1| unnamed protein product [Tetraodon n... 35 2.4
gi|26349785|dbj|BAC38532.1| unnamed protein product [Mus musculus] 35 2.4
gi|29373795|gb|AAO45535.1| potassium channel Kv3.2 [Notoplana at... 35 2.4
gi|49522815|gb|AAH74581.1| CLLD4-like protein [Xenopus tropicalis] 34 3.1
gi|50740290|ref|XP_419418.1| PREDICTED: similar to potassium cha... 34 3.1
gi|7503596|pir||T22320 hypothetical protein F46G10.1 - Caenorhab... 34 3.1
gi|45360945|ref|NP_988863.1| CLLD4-like protein [Xenopus tropica... 34 3.1
gi|47222919|emb|CAF99075.1| unnamed protein product [Tetraodon n... 34 4.0
gi|47211108|emb|CAF94964.1| unnamed protein product [Tetraodon n... 34 4.0
gi|21757260|dbj|BAC05072.1| unnamed protein product [Homo sapiens] 34 4.0
gi|23346589|ref|NP_694783.1| retinoic acid, EGF, and NGF upregul... 34 4.0
gi|34871653|ref|XP_343924.1| similar to REN [Rattus norvegicus] 34 4.0
gi|42660791|ref|XP_085367.3| similar to hypothetical protein 492... 34 4.0
gi|47220171|emb|CAG07312.1| unnamed protein product [Tetraodon n... 34 4.0
gi|47209705|emb|CAF95122.1| unnamed protein product [Tetraodon n... 34 4.0
gi|17228681|ref|NP_485229.1| hypothetical protein [Nostoc sp. PC... 33 5.2
gi|23619368|ref|NP_705330.1| conserved protein, putative [Plasmo... 33 5.2
gi|17567967|ref|NP_508383.1| potassium channel tetramerisation d... 33 5.2
gi|30425146|ref|NP_780638.1| potassium channel tetramerisation d... 33 5.2
gi|39592492|emb|CAE63569.1| Hypothetical protein CBG08057 [Caeno... 33 6.8
gi|39597667|emb|CAE68358.1| Hypothetical protein CBG14096 [Caeno... 33 6.8
gi|47224454|emb|CAG08704.1| unnamed protein product [Tetraodon n... 33 6.8
gi|1763619|gb|AAB39750.1| potassium channel alpha subunit [Polyo... 33 8.9
gi|50400892|sp|Q6WVG3|KD12_MOUSE Potassium channel tetramerisati... 33 8.9
gi|41149372|ref|XP_370541.1| similar to PaTched Related (104.4 k... 33 8.9
gi|34532356|dbj|BAC86399.1| unnamed protein product [Homo sapiens] 33 8.9
>gi|17563898|ref|NP_507324.1| tumor necrosis factor protein like
precursor family member (5R558) [Caenorhabditis elegans]
gi|7507198|pir||T24532 hypothetical protein T05E12.3 -
Caenorhabditis elegans
gi|4008382|emb|CAB04686.1| Hypothetical protein T05E12.3
[Caenorhabditis elegans]
Length = 261
Score = 467 bits (1202), Expect = e-130
Identities = 232/232 (100%), Positives = 232/232 (100%)
Frame = -1
Query: 741 RLQAQEIKLYVGGTEFTTSIKTLLNTESALKNYVVRYELKTERTPELITIDRSPKHFDTI 562
RLQAQEIKLYVGGTEFTTSIKTLLNTESALKNYVVRYELKTERTPELITIDRSPKHFDTI
Sbjct: 16 RLQAQEIKLYVGGTEFTTSIKTLLNTESALKNYVVRYELKTERTPELITIDRSPKHFDTI 75
Query: 561 LNFLRDGDVPLPVNELVLAEVRQEAEFFRLNGLIQLCDVKSATVKKVTISDCEAKNVFKD 382
LNFLRDGDVPLPVNELVLAEVRQEAEFFRLNGLIQLCDVKSATVKKVTISDCEAKNVFKD
Sbjct: 76 LNFLRDGDVPLPVNELVLAEVRQEAEFFRLNGLIQLCDVKSATVKKVTISDCEAKNVFKD 135
Query: 381 HFKPAIINDDQKMVEILANIDKKPVLIVSFYIPRNGLIHFPSGFTFKTFVELYQNRLDVY 202
HFKPAIINDDQKMVEILANIDKKPVLIVSFYIPRNGLIHFPSGFTFKTFVELYQNRLDVY
Sbjct: 136 HFKPAIINDDQKMVEILANIDKKPVLIVSFYIPRNGLIHFPSGFTFKTFVELYQNRLDVY 195
Query: 201 FKVTHYATDDEQPTSNWSFGIYGKRKDCDIIRSGPLLNFMADLEEKIQQYFA 46
FKVTHYATDDEQPTSNWSFGIYGKRKDCDIIRSGPLLNFMADLEEKIQQYFA
Sbjct: 196 FKVTHYATDDEQPTSNWSFGIYGKRKDCDIIRSGPLLNFMADLEEKIQQYFA 247