Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T03E6_7
(1014 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17563798|ref|NP_507199.1| CathePsin L (38.1 kD) (cpl-1) [Caen... 685 0.0
gi|39582386|emb|CAE74770.1| Hypothetical protein CBG22599 [Caeno... 676 0.0
gi|21483184|gb|AAF86584.1| cathepsin L cysteine protease [Haemon... 553 e-156
gi|21483188|gb|AAK77918.1| cathepsin L 1 [Dictyocaulus viviparus] 552 e-156
gi|21483190|gb|AAL14223.1| cathepsin L [Dictyocaulus viviparus] 551 e-155
gi|21483192|gb|AAL14224.1| cathepsin L [Haemonchus contortus] >g... 551 e-155
gi|2239107|emb|CAA70693.1| cathepsin L-like cysteine proteinase ... 428 e-118
gi|47076309|emb|CAD89795.1| putative cathepsin L protease [Meloi... 425 e-118
gi|46251290|gb|AAS84611.1| cathepsin L-like cysteine proteinase ... 423 e-117
gi|17224950|gb|AAL37181.1| cathepsin L-like protease [Ancylostom... 418 e-115
gi|22653679|sp|Q26636|CATL_SARPE Cathepsin L precursor >gnl|BL_O... 381 e-104
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ... 379 e-104
gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 0... 378 e-103
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0... 378 e-103
gi|31240547|ref|XP_320687.1| ENSANGP00000020002 [Anopheles gambi... 376 e-103
gi|34559455|gb|AAQ75437.1| cathepsin L-like protease [Helicoverp... 375 e-103
gi|7435775|pir||JC5443 cathepsin L-like cysteine proteinase (EC ... 374 e-102
gi|16304178|gb|AAL16954.1| cathepsin L-like cysteine protease pr... 369 e-101
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori] 367 e-100
gi|21425246|emb|CAD33266.1| cathepsin L [Aphis gossypii] 367 e-100
gi|5081735|gb|AAD39513.1| cathepsin L-like protease precursor [A... 366 e-100
gi|21953244|emb|CAD42716.1| putative cathepsin L [Myzus persicae] 365 e-100
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]... 360 3e-98
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]... 360 3e-98
gi|47086859|ref|NP_997749.1| cathepsin L, a; ik:tdsubc_2d2; xx:t... 360 4e-98
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec... 359 5e-98
gi|37994576|gb|AAH60335.1| Unknown (protein for MGC:68554) [Xeno... 355 9e-97
gi|41688064|dbj|BAD08618.1| cathepsin L preproprotein [Cyprinus ... 354 2e-96
gi|50762389|ref|XP_425038.1| PREDICTED: similar to cathepsin L p... 354 2e-96
gi|14582899|gb|AAK69706.1| procathepsin L [Oncorhynchus mykiss] 353 3e-96
gi|50251128|dbj|BAD27581.1| cathepsin L [Oryzias latipes] 353 5e-96
gi|49522051|gb|AAH74718.1| Unknown (protein for MGC:69486) [Xeno... 350 4e-95
gi|23452059|gb|AAN32912.1| cathepsin [Danio rerio] 347 2e-94
gi|23306947|dbj|BAC16538.1| cathepsin L [Engraulis japonicus] 347 2e-94
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 347 3e-94
gi|7435777|pir||JC5442 cathepsin L-like cysteine proteinase (EC ... 346 6e-94
gi|7435776|pir||JC5441 cathepsin L-like cysteine proteinase (EC ... 346 6e-94
gi|34850847|dbj|BAC87861.1| cathepsin L [Engraulis japonicus] 345 9e-94
gi|37786769|gb|AAO64471.1| cathepsin L precursor [Fundulus heter... 344 2e-93
gi|33348834|gb|AAQ16117.1| cathepsin L-like cysteine proteinase ... 344 2e-93
gi|2239109|emb|CAA70694.1| cathepsin S-like cysteine proteinase ... 343 3e-93
gi|33348836|gb|AAQ16118.1| cathepsin L-like cysteine proteinase ... 342 8e-93
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [... 340 3e-92
gi|10185020|emb|CAC08809.1| cathepsin L [Canis familiaris] 335 7e-91
gi|50539796|ref|NP_001002368.1| zgc:92089 [Danio rerio] >gnl|BL_... 334 2e-90
gi|47522698|ref|NP_999057.1| cathepsin L [Sus scrofa] >gnl|BL_OR... 332 6e-90
gi|1085687|pir||S53027 cathepsin L (EC 3.4.22.15) precursor - pe... 331 1e-89
gi|4503155|ref|NP_001903.1| cathepsin L preproprotein; major exc... 331 2e-89
gi|2765358|emb|CAA74241.1| cathepsin L [Litopenaeus vannamei] 329 5e-89
gi|15214962|gb|AAH12612.1| Cathepsin L, preproprotein [Homo sapi... 329 5e-89
gi|32394730|gb|AAM96001.1| cathepsin L precursor [Metapenaeus en... 328 9e-89
gi|32394728|gb|AAM96000.1| cathepsin L precursor [Metapenaeus en... 328 9e-89
gi|27806673|ref|NP_776457.1| cathepsin L [Bos taurus] >gnl|BL_OR... 328 1e-88
gi|11493685|gb|AAG35605.1| cysteine protease [Cercopithecus aeth... 328 1e-88
gi|7381610|gb|AAF61565.1| cathepsin L-like proteinase precursor ... 328 2e-88
gi|5822035|pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L 327 3e-88
gi|1093503|prf||2104214A Cys protease 327 3e-88
gi|115743|sp|P07154|CATL_RAT Cathepsin L precursor (Major excret... 325 8e-88
gi|47230018|emb|CAG10432.1| unnamed protein product [Tetraodon n... 325 1e-87
gi|67650|pir||KHRTL cathepsin L (EC 3.4.22.15) precursor - rat 325 1e-87
gi|33520126|gb|AAQ21040.1| cathepsin L precursor [Branchiostoma ... 325 1e-87
gi|23344734|gb|AAN28680.1| cathepsin L [Theromyzon tessulatum] 325 1e-87
gi|12847813|dbj|BAB27719.1| unnamed protein product [Mus musculus] 324 2e-87
gi|1483570|emb|CAA68066.1| cathepsin l [Litopenaeus vannamei] 324 2e-87
gi|2392232|pdb|1CJL| Crystal Structure Of A Cysteine Protease P... 324 2e-87
gi|6978723|ref|NP_037288.1| cathepsin L preproprotein [Rattus no... 323 3e-87
gi|6753558|ref|NP_034114.1| cathepsin L preproprotein; furless; ... 323 3e-87
gi|200501|gb|AAA39984.1| preprocathepsin L precursor >gnl|BL_ORD... 323 4e-87
gi|28194647|gb|AAO33585.1| cathepsin L [Mesocricetus auratus] 323 4e-87
gi|1498185|dbj|BAA06738.1| cysteine proteinase-1 precursor [Dros... 323 5e-87
gi|33242874|gb|AAQ01141.1| cathepsin [Branchiostoma lanceolatum] 322 1e-86
gi|33242878|gb|AAQ01143.1| cathepsin [Branchiostoma lanceolatum] 322 1e-86
gi|33242872|gb|AAQ01140.1| cathepsin [Branchiostoma lanceolatum] 321 1e-86
gi|33242876|gb|AAQ01142.1| cathepsin [Branchiostoma lanceolatum] 321 2e-86
gi|50657029|emb|CAH04632.1| cathepsin L [Suberites domuncula] 320 3e-86
gi|33242880|gb|AAQ01144.1| cathepsin [Branchiostoma lanceolatum] 320 4e-86
gi|33242882|gb|AAQ01145.1| cathepsin [Branchiostoma lanceolatum] 319 6e-86
gi|33242870|gb|AAQ01139.1| cathepsin [Branchiostoma lanceolatum] 319 7e-86
gi|18858809|ref|NP_571273.1| hatching gland gene 1; cathepsin l ... 318 9e-86
gi|33242867|gb|AAQ01138.1| cathepsin [Branchiostoma lanceolatum] 317 2e-85
gi|23110960|ref|NP_001324.2| cathepsin L2 preproprotein; catheps... 317 3e-85
gi|3087790|emb|CAA75029.1| cathepsin L2 [Homo sapiens] 317 4e-85
gi|28932704|gb|AAO60046.1| midgut cysteine proteinase 3 [Rhipice... 317 4e-85
gi|2146900|pir||S67481 cathepsin L-like cysteine proteinase (EC ... 315 8e-85
gi|21483194|gb|AAL49964.1| cathepsin L [Ascaris suum] 314 2e-84
gi|118119|sp|P13277|CYS1_HOMAM Digestive cysteine proteinase 1 p... 311 1e-83
gi|37747900|gb|AAH59142.1| Ctss protein [Rattus norvegicus] 311 2e-83
gi|630816|pir||S47433 cathepsin L (EC 3.4.22.15) - Norway lobste... 311 2e-83
gi|15593252|gb|AAL02222.1| cysteine protease CP14 precursor [Fra... 310 4e-83
gi|228245|prf||1801240C Cys protease 3 309 6e-83
gi|34873588|ref|XP_225137.2| similar to Cathepsin L precursor (M... 307 2e-82
gi|630815|pir||S47432 cathepsin L (EC 3.4.22.15) - Norway lobste... 307 2e-82
gi|15593246|gb|AAL02220.1| cysteine protease CP7 precursor [Fran... 307 3e-82
gi|11055|emb|CAA45129.1| cysteine proteinase preproenzyme [Homar... 306 4e-82
gi|118125|sp|P25784|CYS3_HOMAM Digestive cysteine proteinase 3 p... 306 4e-82
gi|321019|pir||S19651 cysteine proteinase (EC 3.4.22.-) precurso... 306 6e-82
gi|27497536|gb|AAO13008.1| cathepsin S preproprotein [Saimiri bo... 305 8e-82
gi|28971811|dbj|BAC65417.1| crustapain [Pandalus borealis] 304 2e-81
gi|37905511|gb|AAO64477.1| cathepsin S precursor [Fundulus heter... 304 2e-81
gi|28971813|dbj|BAC65418.1| cathepsin L [Pandalus borealis] 304 2e-81
gi|27497538|gb|AAO13009.1| cathepsin S preproprotein [Canis fami... 303 3e-81
gi|2144502|pir||KHCHL cathepsin L (EC 3.4.22.15) - chicken 303 5e-81
gi|6630972|gb|AAF19630.1| cysteine proteinase precursor [Myxine ... 302 7e-81
gi|15593255|gb|AAL02223.1| cysteine protease CP19 precursor [Fra... 302 9e-81
gi|6630974|gb|AAF19631.1| cysteine proteinase precursor [Myxine ... 301 1e-80
gi|12643318|sp|O70370|CATS_MOUSE Cathepsin S precursor >gnl|BL_O... 301 1e-80
gi|10946582|ref|NP_067256.1| cathepsin S preproprotein; Cat S [M... 301 1e-80
gi|2706547|emb|CAA75862.1| putative cathepsin L [Xenopus laevis] 301 2e-80
gi|15593249|gb|AAL02221.1| cysteine protease CP10 precursor [Fra... 301 2e-80
gi|12805315|gb|AAH02125.1| Ctss protein [Mus musculus] 301 2e-80
gi|3850787|emb|CAA05360.1| cathepsin S [Mus musculus] 300 3e-80
gi|26390492|dbj|BAC25906.1| unnamed protein product [Mus musculus] 300 3e-80
gi|1705639|sp|Q10991|CATL_SHEEP Cathepsin L 299 6e-80
gi|179957|gb|AAC37592.1| cathepsin S [Homo sapiens] 299 8e-80
gi|12803615|gb|AAH02642.1| Cathepsin S, preproprotein [Homo sapi... 298 1e-79
gi|23110962|ref|NP_004070.3| cathepsin S preproprotein [Homo sap... 298 1e-79
gi|228244|prf||1801240B Cys protease 2 298 2e-79
gi|284028|pir||A42482 cathepsin S (EC 3.4.22.27) precursor - hum... 298 2e-79
gi|33242886|gb|AAQ01147.1| cathepsin [Paralabidochromis chilotes] 297 2e-79
gi|246148|gb|AAB21516.1| Cyclic Protein-2; CP-2 [Rattus sp.] 297 3e-79
gi|21264393|sp|P25774|CATS_HUMAN Cathepsin S precursor 297 3e-79
gi|118123|sp|P25782|CYS2_HOMAM Digestive cysteine proteinase 2 p... 296 4e-79
gi|14041143|emb|CAA71554.1| cathepsin [Geodia cydonium] 296 4e-79
gi|33242865|gb|AAQ01137.1| cathepsin [Branchiostoma lanceolatum] 295 1e-78
gi|40255291|ref|NP_954599.1| cathepsin L-like [Mus musculus] >gn... 293 3e-78
gi|47523662|ref|NP_999467.1| cathepsin K precursor [Sus scrofa] ... 293 4e-78
gi|1168794|sp|P43236|CATK_RABIT Cathepsin K precursor (OC-2 prot... 293 4e-78
gi|6435586|pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Hu... 289 6e-77
gi|4503151|ref|NP_000387.1| cathepsin K preproprotein; cathepsin... 289 6e-77
gi|49456399|emb|CAG46520.1| CTSK [Homo sapiens] 289 6e-77
gi|47117667|sp|P61276|CATK_MACFA Cathepsin K precursor >gnl|BL_O... 289 8e-77
gi|836934|gb|AAA95998.1| cathepsin X 289 8e-77
gi|47199802|emb|CAF88807.1| unnamed protein product [Tetraodon n... 289 8e-77
gi|33417128|gb|AAH56059.1| Ctss-prov protein [Xenopus laevis] 288 1e-76
gi|47221526|emb|CAG08188.1| unnamed protein product [Tetraodon n... 287 3e-76
gi|50251130|dbj|BAD27582.1| cathepsin S [Oryzias latipes] 286 5e-76
gi|13928758|ref|NP_113748.1| cathepsin K [Rattus norvegicus] >gn... 286 5e-76
gi|30017423|ref|NP_835199.1| testin [Mus musculus] >gnl|BL_ORD_I... 286 7e-76
gi|8393221|ref|NP_059016.1| cathepsin S preproprotein [Rattus no... 285 9e-76
gi|31982433|ref|NP_031828.2| cathepsin K; Cat K; minisatellite 1... 285 1e-75
gi|49671274|gb|AAH75275.1| Unknown (protein for MGC:88904) [Xeno... 284 3e-75
gi|7435778|pir||S74227 cathepsin K (EC 3.4.22.-) precursor - mou... 283 3e-75
gi|49522293|gb|AAH75261.1| Unknown (protein for MGC:88875) [Xeno... 283 3e-75
gi|27465595|ref|NP_775155.1| testin [Rattus norvegicus] >gnl|BL_... 283 6e-75
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n... 282 7e-75
gi|1834307|dbj|BAA09820.1| cysteine proteinase [Spirometra erina... 282 7e-75
gi|15826035|pdb|1FH0|A Chain A, Crystal Structure Of Human Cathe... 282 1e-74
gi|50418223|gb|AAH77285.1| Unknown (protein for MGC:80097) [Xeno... 281 1e-74
gi|15128493|dbj|BAB62718.1| plerocercoid growth factor/cysteine ... 281 2e-74
gi|3641698|dbj|BAA33398.1| preprocathepsin L [Bos taurus] 279 6e-74
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist... 278 1e-73
gi|18308182|gb|AAL67857.1| cysteine proteinase [Acanthamoeba hea... 278 2e-73
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 277 2e-73
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 277 2e-73
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 277 3e-73
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 276 5e-73
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica] 275 9e-73
gi|463046|gb|AAA49207.1| cysteine proteinase 275 9e-73
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 275 2e-72
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 274 2e-72
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 274 3e-72
gi|41323856|gb|AAS00027.1| cathepsin L-like cysteine proteinase ... 274 3e-72
gi|1809288|gb|AAC47721.1| secreted cathepsin L 2 [Fasciola hepat... 273 3e-72
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 273 3e-72
gi|45550334|gb|AAS67923.1| cathepsin L [Artemia franciscana] 273 5e-72
gi|28932708|gb|AAO60048.1| midgut cysteine proteinase 5 [Rhipice... 273 6e-72
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 272 8e-72
gi|115747|sp|P25326|CATS_BOVIN Cathepsin S >gnl|BL_ORD_ID|168691... 272 1e-71
gi|45822209|emb|CAE47501.1| cathepsin L-like proteinase [Diabrot... 271 1e-71
gi|47213724|emb|CAF95155.1| unnamed protein product [Tetraodon n... 271 2e-71
gi|45822207|emb|CAE47500.1| cathepsin L-like proteinase [Diabrot... 271 2e-71
gi|19698257|dbj|BAB86771.1| cathepsin L-like [Engraulis japonicus] 270 3e-71
gi|41055305|ref|NP_956686.1| hypothetical protein MGC64209 [Dani... 270 4e-71
gi|45550332|gb|AAS67922.1| cathepsin L [Artemia franciscana] 270 4e-71
gi|42794048|dbj|BAD11762.1| cahepsin L-like cysteine protease [B... 270 5e-71
gi|19698255|dbj|BAB86770.1| cathepsin L-like [Engraulis japonicus] 270 5e-71
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 269 7e-71
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 269 9e-71
gi|118121|sp|P04989|CYS2_DICDI Cysteine proteinase 2 precursor (... 269 9e-71
gi|16506723|gb|AAL23917.1| cathepsin L [Fasciola gigantica] 268 1e-70
gi|46948144|gb|AAT07054.1| cathepsin L-like cysteine proteinase ... 268 1e-70
gi|39930363|ref|NP_058817.1| cathepsin J; cathepsin P [Rattus no... 268 1e-70
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 268 2e-70
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 268 2e-70
gi|50761194|ref|XP_418273.1| PREDICTED: similar to Cathepsin L, ... 267 3e-70
gi|1698586|gb|AAB37252.1| cathepsin L 266 4e-70
gi|42733954|gb|AAM33702.3| similar to Dictyostelium discoideum (... 266 6e-70
gi|46358368|ref|NP_062414.2| cathepsin 8; ectoplacental cone, in... 266 7e-70
gi|7435780|pir||T09259 cathepsin L-like proteinase (EC 3.4.22.-)... 265 9e-70
gi|30749499|pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Boun... 265 9e-70
gi|7770062|ref|NP_036137.1| cathepsin J; rat gene/Cathepsin L-re... 265 9e-70
gi|8917581|gb|AAF81277.1| EPCS68 [Mus musculus] >gnl|BL_ORD_ID|4... 265 9e-70
gi|10241433|emb|CAC09354.1| putative oryzain alpha precursor [Or... 265 1e-69
gi|415567|gb|AAB28289.1| cysteine proteinase=39 kda activated fo... 265 2e-69
gi|1706263|sp|P54640|CYS5_DICDI Cysteine proteinase 5 precursor ... 264 2e-69
gi|30749675|pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin ... 264 2e-69
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 264 3e-69
gi|50657027|emb|CAH04631.1| cathepsin H [Suberites domuncula] 263 5e-69
gi|9931986|ref|NP_064680.1| cathepsin R [Mus musculus] >gnl|BL_O... 263 5e-69
gi|23200070|pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mu... 262 8e-69
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 261 1e-68
gi|10798509|emb|CAC12805.1| procathepsin L3 [Fasciola hepatica] 260 3e-68
gi|37963625|gb|AAP94048.2| cathepsin-L-like midgut cysteine prot... 259 5e-68
gi|13242029|gb|AAK16515.1| cathepsin L-like cysteine proteinase ... 259 5e-68
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 259 5e-68
gi|5915887|sp|O17473|CATL_BRUPA Cathepsin L-like precursor >gnl|... 258 2e-67
gi|2914174|pdb|1ATK| Crystal Structure Of The Cysteine Protease... 258 2e-67
gi|50513589|pdb|1SNK|A Chain A, Cathepsin K Complexed With Carba... 258 2e-67
gi|129231|sp|P25776|ORYA_ORYSA Oryzain alpha chain precursor >gn... 257 3e-67
gi|18422289|ref|NP_568620.1| cysteine proteinase, putative / thi... 257 3e-67
gi|38345906|emb|CAE04498.2| OSJNBb0059K02.8 [Oryza sativa (japon... 257 3e-67
gi|50355611|dbj|BAD29954.1| cysteine protease [Daucus carota] 256 4e-67
gi|46948150|gb|AAT07057.1| cathepsin L-like cysteine proteinase ... 256 4e-67
gi|10798513|emb|CAC12807.1| procathepsin L3 [Fasciola hepatica] 256 6e-67
gi|46948152|gb|AAT07058.1| cathepsin L-like cysteine proteinase ... 254 2e-66
gi|18141283|gb|AAL60579.1| senescence-associated cysteine protea... 254 2e-66
gi|42564163|gb|AAS20593.1| digestive cysteine proteinase intesta... 254 2e-66
gi|13897890|gb|AAK48495.1| putative cysteine protease [Ipomoea b... 254 2e-66
gi|50657396|ref|NP_001002813.1| cathepsin Q-like 2 [Rattus norve... 254 2e-66
gi|31981229|ref|NP_071721.2| cathepsin M; Cat M [Mus musculus] >... 254 2e-66
gi|34873742|ref|XP_225128.2| similar to EPCS68 [Rattus norvegicus] 254 3e-66
gi|13242027|gb|AAK16514.1| cathepsin L-like cysteine proteinase ... 254 3e-66
gi|1185459|gb|AAA87849.1| preprocathepsin cathepsin L 253 4e-66
gi|28212234|ref|NP_783171.1| cathepsin R [Rattus norvegicus] >gn... 253 5e-66
gi|33242884|gb|AAQ01146.1| cathepsin [Petromyzon marinus] 253 5e-66
gi|45384464|ref|NP_990302.1| JTAP-1 [Gallus gallus] >gnl|BL_ORD_... 253 6e-66
gi|10946820|ref|NP_067420.1| cathepsin 6 [Mus musculus] >gnl|BL_... 253 6e-66
gi|30141019|dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus] 253 6e-66
gi|22653680|sp|Q9JL96|CATM_MOUSE Cathepsin M precursor >gnl|BL_O... 253 6e-66
gi|46948156|gb|AAT07060.1| cathepsin L-like cysteine proteinase ... 251 1e-65
gi|13242025|gb|AAK16513.1| cathepsin L-like cysteine proteinase ... 251 2e-65
gi|6682829|dbj|BAA88898.1| cysteine protease component of protea... 251 2e-65
gi|16323039|gb|AAL15416.1| cathepsin M [Mus musculus] >gnl|BL_OR... 251 2e-65
gi|18141281|gb|AAL60578.1| senescence-associated cysteine protea... 251 2e-65
gi|7435806|pir||T01207 cysteine proteinase mir3 (EC 3.4.22.-) - ... 250 3e-65
gi|27960480|gb|AAO27844.1| cathepsin Q2 [Rattus norvegicus] 250 4e-65
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica] 249 5e-65
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens] 249 5e-65
gi|7435791|pir||T12041 cysteine proteinase (EC 3.4.22.-) 3 precu... 249 5e-65
gi|50355615|dbj|BAD29956.1| cysteine protease [Daucus carota] 249 5e-65
gi|2118132|pir||JC4848 cysteine proteinase (EC 3.4.22.-) - Dougl... 249 7e-65
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice... 249 7e-65
gi|33333714|gb|AAQ11975.1| putative gut cathepsin L-like cystein... 248 1e-64
gi|9843862|emb|CAC03737.1| silicatein protein [Suberites domuncula] 248 1e-64
gi|21245114|ref|NP_640355.1| cathepsin Q [Rattus norvegicus] >gn... 248 2e-64
gi|14517542|gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thalia... 248 2e-64
gi|18401614|ref|NP_564497.1| cysteine proteinase (RD21A) / thiol... 248 2e-64
gi|162815|gb|AAA30435.1| cathepsin S >gnl|BL_ORD_ID|233599 gi|31... 248 2e-64
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag... 247 3e-64
gi|27532972|ref|NP_083912.2| cathepsin Q [Mus musculus] >gnl|BL_... 247 3e-64
gi|535454|gb|AAA50755.1| cysteine proteinase 247 3e-64
gi|1272388|gb|AAB17051.1| cysteine protease 246 5e-64
gi|18141285|gb|AAL60580.1| senescence-associated cysteine protea... 246 5e-64
gi|6650391|gb|AAF21819.1| silicatein beta [Tethya aurantia] 246 6e-64
gi|18402225|ref|NP_566633.1| cysteine proteinase, putative / thi... 246 8e-64
gi|38014481|gb|AAH60424.1| MGC68723 protein [Xenopus laevis] 246 8e-64
gi|28194643|gb|AAO33583.1| cathepsin P [Meriones unguiculatus] 245 1e-63
gi|47524507|gb|AAT34987.1| putative cysteine protease [Gossypium... 244 2e-63
gi|1361974|pir||S57776 cysteine proteinase (EC 3.4.22.-) - clove... 244 2e-63
gi|31077116|ref|NP_852043.1| cathepsin M [Rattus norvegicus] >gn... 244 2e-63
gi|40060510|gb|AAR37419.1| papain-like cysteine proteinase [Tric... 244 3e-63
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica] 244 3e-63
gi|40060518|gb|AAR37420.1| papain-like cysteine proteinase [Tric... 244 3e-63
gi|33333704|gb|AAQ11970.1| putative gut cathepsin L-like cystein... 243 4e-63
gi|3243102|gb|AAC23951.1| silicatein alpha [Tethya aurantia] 243 4e-63
gi|32396020|gb|AAP41847.1| senescence-associated cysteine protea... 243 4e-63
gi|929719|emb|CAA27980.1| unnamed protein product [Mus musculus] 243 5e-63
gi|37780051|gb|AAP32198.1| cysteine protease 12 [Trifolium repens] 243 5e-63
gi|10336513|dbj|BAB13759.1| cysteine proteinase [Astragalus sini... 243 7e-63
gi|37780045|gb|AAP32195.1| cysteine protease 5 [Trifolium repens] 242 9e-63
gi|7435811|pir||T06708 cysteine proteinase (EC 3.4.22.-) T29H11.... 242 1e-62
gi|33333712|gb|AAQ11974.1| putative gut cathepsin L-like cystein... 241 1e-62
gi|34873584|ref|XP_214412.2| similar to cathepsin R [Rattus norv... 241 1e-62
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 241 1e-62
gi|28194645|gb|AAO33584.1| cathepsin P [Mesocricetus auratus] 241 1e-62
gi|50355617|dbj|BAD29957.1| cysteine protease [Daucus carota] 241 1e-62
gi|33333706|gb|AAQ11971.1| putative gut cathepsin L-like cystein... 241 2e-62
gi|33333698|gb|AAQ11967.1| putative gut cathepsin L-like cystein... 241 2e-62
gi|7435800|pir||T03941 cysteine proteinase (EC 3.4.22.-) precurs... 241 3e-62
gi|42744610|gb|AAH66625.1| Zgc:66267 protein [Danio rerio] 241 3e-62
gi|37724090|gb|AAO23671.1| silicatein [Petrosia ficiformis] 241 3e-62
gi|33333700|gb|AAQ11968.1| putative gut cathepsin L-like cystein... 240 3e-62
gi|33333694|gb|AAQ11965.1| putative gut cathepsin L-like cystein... 240 3e-62
gi|42564159|gb|AAS20591.1| digestive cysteine proteinase intesta... 240 3e-62
gi|50795312|ref|XP_423769.1| PREDICTED: similar to CG8947-PA, pa... 240 3e-62
gi|33333702|gb|AAQ11969.1| putative gut cathepsin L-like cystein... 240 4e-62
gi|32488398|emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa (japo... 240 4e-62
gi|13491750|gb|AAK27968.1| cysteine protease [Ipomoea batatas] 240 4e-62
gi|27681673|ref|XP_225126.1| similar to cathepsin 1 precursor [R... 239 6e-62
gi|42564161|gb|AAS20592.1| digestive cysteine proteinase intesta... 239 6e-62
gi|33333708|gb|AAQ11972.1| putative gut cathepsin L-like cystein... 239 6e-62
gi|26245875|gb|AAN77413.1| digestive cysteine protease intestain... 239 6e-62
gi|37780043|gb|AAP32194.1| cysteine protease 1 [Trifolium repens] 239 6e-62
gi|33333696|gb|AAQ11966.1| putative gut cathepsin L-like cystein... 239 7e-62
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota] 239 7e-62
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 239 7e-62
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 239 7e-62
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 239 1e-61
gi|21617828|sp||P09648_1 [Segment 1 of 2] Cathepsin L 239 1e-61
gi|24285904|gb|AAL14199.1| cysteine proteinase precursor [Ipomoe... 238 1e-61
gi|38345300|emb|CAE02828.2| OSJNBa0043A12.33 [Oryza sativa (japo... 238 1e-61
gi|28192373|gb|AAK07730.1| CPR1-like cysteine proteinase [Nicoti... 238 2e-61
gi|23956098|ref|NP_062412.1| cathepsin 7; ectoplacental cone, in... 238 2e-61
gi|15234557|ref|NP_195406.1| cysteine proteinase, putative [Arab... 238 2e-61
gi|46401612|dbj|BAD16614.1| cysteine proteinase [Dianthus caryop... 238 2e-61
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 237 3e-61
gi|19922198|ref|NP_610906.1| CG6347-PA [Drosophila melanogaster]... 237 4e-61
gi|5777889|emb|CAB53515.1| cysteine protease [Solanum tuberosum] 237 4e-61
gi|14600257|gb|AAK71314.1| papain-like cysteine peptidase XBCP3 ... 237 4e-61
gi|37780049|gb|AAP32197.1| cysteine protease 10 [Trifolium repens] 236 6e-61
gi|18391078|ref|NP_563855.1| cysteine protease, papain-like (XBC... 236 6e-61
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 236 8e-61
gi|15290508|gb|AAK92229.1| cysteine proteinase [Arabidopsis thal... 236 8e-61
gi|46395620|sp|O65039|CYSP_RICCO Vignain precursor (Cysteine end... 236 8e-61
gi|542419|pir||S41427 cysteine proteinase (EC 3.4.22.-) CP1 prec... 236 8e-61
gi|6980666|pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii... 236 8e-61
gi|454890|emb|CAA54438.1| cysteine proteinase, putative [Trichom... 236 8e-61
gi|7435774|pir||S22502 cysteine proteinase (EC 3.4.22.-) - kidne... 235 1e-60
gi|445927|prf||1910332A Cys endopeptidase 235 1e-60
gi|8917575|gb|AAF81274.1| EPCS24 [Mus musculus] 235 1e-60
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota] 235 1e-60
gi|1345573|emb|CAA40073.1| endopeptidase (EP-C1) [Phaseolus vulg... 235 1e-60
gi|129232|sp|P25777|ORYB_ORYSA Oryzain beta chain precursor >gnl... 235 1e-60
gi|2245510|gb|AAB62536.1| cysteine protease [Dirofilaria immitis] 235 1e-60
gi|25289998|pir||JC7787 carrot seed cysteine proteinase (EC 3.4.... 234 2e-60
gi|3929737|emb|CAA77180.1| cathepsin L [Homo sapiens] 234 2e-60
gi|6448469|dbj|BAA86911.1| homologue of Sarcophaga 26,29kDa prot... 234 2e-60
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 234 2e-60
gi|30141027|dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus] 234 2e-60
gi|50313163|gb|AAT74529.1| toxopain-2 [Toxoplasma gondii] 234 2e-60
gi|34905996|ref|NP_914345.1| putative cysteine proteinase [Oryza... 234 2e-60
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 234 2e-60
gi|537437|gb|AAC35211.1| cysteine proteinase [Hemerocallis hybri... 234 3e-60
gi|30141021|dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus] 234 3e-60
gi|544129|sp|P25803|CYSP_PHAVU Vignain precursor (Bean endopepti... 234 3e-60
gi|14719319|gb|AAK73137.1| putative cysteine proteinase [Oryza s... 234 3e-60
gi|7435801|pir||T06416 cysteine proteinase (EC 3.4.22.-) precurs... 234 3e-60
gi|50355613|dbj|BAD29955.1| cysteine protease [Daucus carota] 233 4e-60
gi|118158|sp|P12412|CYSP_VIGMU Vignain precursor (Bean endopepti... 233 5e-60
gi|27681979|ref|XP_225125.1| similar to cathepsin 1 precursor [R... 233 5e-60
gi|33333710|gb|AAQ11973.1| putative gut cathepsin L-like cystein... 233 7e-60
gi|945081|gb|AAC49361.1| P21 233 7e-60
gi|18408616|ref|NP_566901.1| cysteine proteinase, putative [Arab... 233 7e-60
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 233 7e-60
gi|255032|gb|AAB23155.1| COT44=cysteine proteinase homolog [Bras... 233 7e-60
gi|31559526|dbj|BAC77521.1| cysteine proteinase [Glycine max] >g... 232 9e-60
gi|25289988|pir||G86232 cysteine proteinase (EC 3.4.22.-) [simil... 232 9e-60
gi|6650705|gb|AAF21977.1| thiolproteinase SmTP1 [Sarcocystis muris] 232 9e-60
gi|118127|sp|P25251|CYS4_BRANA Cysteine proteinase COT44 precurs... 232 9e-60
gi|1173630|gb|AAB37233.1| cysteine proteinase 232 1e-59
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 232 1e-59
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab... 232 1e-59
gi|26452046|dbj|BAC43113.1| putative cysteine proteinase RD21A p... 231 2e-59
gi|31559530|dbj|BAC77523.1| cysteine proteinase [Glycine max] >g... 231 2e-59
gi|27573938|pdb|1MHW|A Chain A, Design Of Non-Covalent Inhibitor... 231 2e-59
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho... 231 2e-59
gi|18394919|ref|NP_564126.1| cysteine endopeptidase, papain-type... 231 2e-59
gi|48094830|ref|XP_394277.1| similar to CG5367-PA [Apis mellifera] 231 2e-59
gi|45822201|emb|CAE47497.1| cathepsin L-like proteinase [Diabrot... 231 2e-59
gi|30685308|ref|NP_566634.2| cysteine proteinase, putative [Arab... 231 3e-59
gi|100069|pir||S24602 cysteine proteinase tpp (EC 3.4.22.-) - ga... 231 3e-59
gi|11265608|pir||T46630 cysteine proteinase (EC 3.4.22.-) 1 prec... 231 3e-59
gi|7435794|pir||T12039 cysteine proteinase (EC 3.4.22.-) 1 precu... 231 3e-59
gi|4731374|gb|AAD28477.1| papain-like cysteine protease [Sanders... 230 3e-59
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 230 3e-59
gi|18422605|ref|NP_568651.1| senescence-specific SAG12 protein (... 230 4e-59
gi|1223922|gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata] 230 4e-59
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 230 4e-59
gi|3688528|emb|CAA06243.1| pre-pro-TPE4A protein [Pisum sativum] 229 6e-59
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab... 229 6e-59
gi|600111|emb|CAA84378.1| cysteine proteinase [Vicia sativa] 229 1e-58
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 229 1e-58
gi|37780039|gb|AAP32192.1| cysteine protease 14 [Trifolium repens] 229 1e-58
gi|629792|pir||S47434 cysteine proteinase (EC 3.4.22.-) - rice >... 228 1e-58
gi|5823018|gb|AAD53011.1| senescence-specific cysteine protease ... 228 2e-58
gi|5731354|gb|AAB70820.2| cysteine protease Mir1 [Zea mays] 228 2e-58
gi|37780041|gb|AAP32193.1| cysteine protease 14 [Trifolium repens] 228 2e-58
gi|1046373|gb|AAC49135.1| SAG12 protein 227 4e-58
gi|4731372|gb|AAD28476.1| papain-like cysteine protease [Sanders... 226 5e-58
gi|31196755|ref|XP_307325.1| ENSANGP00000013730 [Anopheles gambi... 226 6e-58
gi|19424144|ref|NP_081182.2| cathepsin 3 precursor [Mus musculus... 226 6e-58
gi|4210800|emb|CAA76927.1| thiol protease [Phaedon cochleariae] 226 8e-58
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 225 1e-57
gi|1491774|emb|CAA68192.1| cysteine protease [Zea mays] 225 1e-57
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 225 1e-57
gi|7435805|pir||T01206 cysteine proteinase mir2 (EC 3.4.22.-) - ... 225 1e-57
gi|27960490|gb|AAO27848.1| cathepsin 3 [Mus musculus] 224 2e-57
gi|12837902|dbj|BAB23995.1| unnamed protein product [Mus musculus] 224 2e-57
gi|42407937|dbj|BAD09076.1| putative cysteine proteinase [Oryza ... 224 2e-57
gi|42761541|gb|AAS45359.1| similar to Sarcophaga peregrina (Fles... 224 3e-57
gi|21357391|ref|NP_649608.1| CG11459-PA [Drosophila melanogaster... 223 4e-57
gi|7239343|gb|AAF43193.1| cathepsin L [Stylonychia lemnae] 223 4e-57
gi|18418684|ref|NP_567983.1| cysteine endopeptidase, papain-type... 223 5e-57
gi|30141023|dbj|BAC75925.1| cysteine protease-3 [Helianthus annuus] 223 7e-57
gi|42564157|gb|AAS20590.1| digestive cysteine proteinase intesta... 222 1e-56
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 221 2e-56
gi|34809309|gb|AAQ82649.1| cysteine protease [Tritrichomonas foe... 221 2e-56
gi|24644155|ref|NP_730901.1| CG12163-PA [Drosophila melanogaster... 221 2e-56
gi|24644153|ref|NP_649521.1| CG12163-PB [Drosophila melanogaster... 221 2e-56
gi|7435798|pir||T06206 probable cysteine proteinase (EC 3.4.22.-... 221 2e-56
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 221 3e-56
gi|42564153|gb|AAS20589.1| digestive cysteine proteinase intesta... 220 3e-56
gi|1141743|gb|AAB04162.1| putative cysteine proteinase 220 3e-56
gi|5823020|gb|AAD53012.1| senescence-specific cysteine protease ... 220 5e-56
gi|629651|pir||S47312 cysteine proteinase (EC 3.4.22.-) precurso... 220 5e-56
gi|47169030|pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of T... 220 5e-56
gi|42564149|gb|AAS20588.1| digestive cysteine proteinase intesta... 220 5e-56
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 220 5e-56
gi|12621903|gb|AAB60643.2| cathepsin S [Homo sapiens] 219 6e-56
gi|42734286|emb|CAD67990.1| silicatein beta [Suberites domuncula] 219 6e-56
gi|50355621|dbj|BAD29959.1| cysteine protease [Daucus carota] 219 6e-56
gi|18251953|gb|AAL66176.1| cathepsin L [Oryctolagus cuniculus] 219 8e-56
gi|542420|pir||S41428 cysteine proteinase (EC 3.4.22.-) CP2 prec... 219 8e-56
gi|10441624|gb|AAG17127.1| cathepsin L-like cysteine proteinase ... 219 8e-56
gi|7435797|pir||T06208 cysteine proteinase (EC 3.4.22.-) - barle... 219 8e-56
gi|12585196|sp|Q63088|CATJ_RAT Cathepsin J precursor (Cathepsin ... 219 1e-55
gi|20428641|ref|NP_620470.1| CG8947-PA [Drosophila melanogaster]... 219 1e-55
gi|48475189|gb|AAT44258.1| hypothetical protein [Oryza sativa (j... 219 1e-55
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 219 1e-55
gi|27728675|gb|AAO18731.1| cysteine protease [Gossypium hirsutum] 218 1e-55
gi|11265612|pir||T47471 cysteine proteinase (EC 3.4.22.-) F18N11... 218 2e-55
gi|4521167|dbj|BAA76272.1| 26,29kDa proteinase [Sarcophaga pereg... 218 2e-55
gi|1169186|sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor ... 218 2e-55
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 218 2e-55
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 218 2e-55
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 218 2e-55
gi|4733887|gb|AAD02173.3| cysteine proteinase; ACCP2 [Acanthamoe... 218 2e-55
gi|24654434|ref|NP_725686.1| CG4847-PD [Drosophila melanogaster]... 217 3e-55
gi|19922450|ref|NP_611221.1| CG4847-PA [Drosophila melanogaster]... 217 3e-55
gi|22331686|ref|NP_680113.1| cysteine proteinase, putative [Arab... 217 4e-55
gi|40806500|gb|AAR92155.1| putative cysteine protease 2 [Iris ho... 216 5e-55
gi|38346003|emb|CAD40112.2| OSJNBa0035O13.5 [Oryza sativa (japon... 216 5e-55
gi|4100157|gb|AAD10337.1| cysteine proteinase precursor [Hordeum... 216 5e-55
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 216 7e-55
gi|21666724|gb|AAM73806.1| cysteine proteinase [Brassica napus] ... 216 7e-55
gi|41055337|ref|NP_956720.1| hypothetical protein MGC66267 [Dani... 216 7e-55
gi|118124|sp|P25250|CYS2_HORVU Cysteine proteinase EP-B 2 precur... 216 9e-55
gi|21070926|gb|AAM34401.1| putative cysteine proteinase [Oryza s... 215 1e-54
gi|3929821|emb|CAA77183.1| cathepsin L [Mus musculus] 215 1e-54
gi|7435809|pir||T06529 cysteine proteinase (EC 3.4.22.-) - garde... 214 2e-54
gi|38345008|emb|CAD40026.2| OSJNBa0052O21.11 [Oryza sativa (japo... 214 2e-54
gi|24583376|ref|NP_609387.1| CG5367-PA [Drosophila melanogaster]... 214 3e-54
gi|18408828|ref|NP_566920.1| cysteine proteinase, putative [Arab... 214 3e-54
gi|118120|sp|P25249|CYS1_HORVU Cysteine proteinase EP-B 1 precur... 213 4e-54
gi|5761329|dbj|BAA83473.1| cysteine endopeptidase [Oryza sativa]... 213 4e-54
gi|15146346|dbj|BAB62816.1| cysteine proteinase [Spirometra erin... 213 4e-54
gi|32396018|gb|AAP41846.1| cysteine protease [Anthurium andraeanum] 213 6e-54
gi|113285|sp|P00785|ACTN_ACTCH Actinidain precursor (Actinidin) ... 213 7e-54
gi|203341|gb|AAA63484.1| cathepsin H 213 7e-54
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 212 1e-53
gi|22759715|dbj|BAC10906.1| cysteine proteinase [Zinnia elegans] 212 1e-53
gi|37903264|gb|AAO64475.1| cathepsin K [Fundulus heteroclitus] 212 1e-53
gi|118150|sp|P25804|CYSP_PEA Cysteine proteinase 15A precursor (... 212 1e-53
gi|38346007|emb|CAD40110.2| OSJNBa0035O13.9 [Oryza sativa (japon... 211 2e-53
gi|42567068|ref|NP_567686.2| cysteine proteinase, putative [Arab... 211 2e-53
gi|12744965|gb|AAK06862.1| actinidin protease [Actinidia chinensis] 211 2e-53
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 211 2e-53
gi|118145|sp|P20721|CYSL_LYCES Low-temperature-induced cysteine ... 211 3e-53
gi|7435804|pir||T03694 cysteine proteinase (EC 3.4.22.-) - rice ... 211 3e-53
gi|7435813|pir||T05390 probable cysteine proteinase (EC 3.4.22.-... 211 3e-53
gi|4426617|gb|AAD20453.1| cysteine endopeptidase precursor [Oryz... 210 4e-53
gi|2144501|pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi ... 210 5e-53
gi|27413319|gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba] 210 5e-53
gi|1401242|gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba] 210 5e-53
gi|1071886|pir||S49451 cysteine proteinase (EC 3.4.22.-) - chick... 209 6e-53
gi|542004|pir||S42882 cysteine proteinase (EC 3.4.22.-) precurso... 209 6e-53
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 209 8e-53
gi|18401420|ref|NP_565649.1| cysteine proteinase, putative [Arab... 209 8e-53
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 209 8e-53
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 209 8e-53
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 209 8e-53
gi|7435790|pir||T12382 cysteine proteinase (EC 3.4.22.-) - commo... 208 1e-52
gi|30141025|dbj|BAC75926.1| cysteine protease-4 [Helianthus annuus] 208 1e-52
gi|7435773|pir||S71773 cysteine proteinase (EC 3.4.22.-) precurs... 207 2e-52
gi|18413507|ref|NP_567377.1| cysteine proteinase, putative [Arab... 207 4e-52
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 207 4e-52
gi|18403438|ref|NP_565780.1| cysteine proteinase, putative [Arab... 207 4e-52
gi|118117|sp|P04988|CYS1_DICDI Cysteine proteinase 1 precursor >... 207 4e-52
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 207 4e-52
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 207 4e-52
gi|18202415|sp|P82474|GPII_ZINOF Cysteine proteinase GP-II >gnl|... 207 4e-52
gi|7435793|pir||T09528 probable cysteine proteinase (EC 3.4.22.-... 206 5e-52
gi|1076552|pir||S49166 cysteine proteinase (EC 3.4.22.-) precurs... 206 5e-52
gi|1353726|gb|AAB01769.1| cysteine proteinase homolog 206 5e-52
gi|18390634|ref|NP_563764.1| cysteine proteinase, putative [Arab... 206 7e-52
gi|47191670|emb|CAF89137.1| unnamed protein product [Tetraodon n... 206 7e-52
gi|7435799|pir||T06207 cysteine proteinase (EC 3.4.22.-) - barle... 206 9e-52
gi|42563538|gb|AAS20467.1| cysteine protease-like protein [Pelar... 206 9e-52
gi|42407296|dbj|BAD10859.1| cysteine protease [Aster tripolium] 206 9e-52
gi|20260334|gb|AAM13065.1| drought-inducible cysteine proteinase... 205 2e-51
gi|18413505|ref|NP_567376.1| cysteine proteinase, putative [Arab... 205 2e-51
gi|38372247|sp|Q94504|CYS7_DICDI Cysteine proteinase 7 precursor... 204 2e-51
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 204 2e-51
gi|33945877|emb|CAE45588.1| papain-like cysteine proteinase-like... 204 3e-51
gi|20334375|gb|AAM19208.1| cysteine protease [Lycopersicon penne... 204 3e-51
gi|18407678|ref|NP_566867.1| cysteine proteinase, putative [Arab... 203 4e-51
gi|21593501|gb|AAM65468.1| cysteine proteinase [Arabidopsis thal... 203 4e-51
gi|25289991|pir||D86413 cysteine proteinase (EC 3.4.22.-) [simil... 203 4e-51
gi|30690594|ref|NP_564321.2| peptidase C1A papain family protein... 203 4e-51
gi|7435795|pir||T12040 cysteine proteinase (EC 3.4.22.-) 2 precu... 203 4e-51
>gi|17563798|ref|NP_507199.1| CathePsin L (38.1 kD) (cpl-1)
[Caenorhabditis elegans]
gi|7507001|pir||T24387 probable cysteine proteinase (EC 3.4.22.-)
T03E6.7 - Caenorhabditis elegans
gi|3879367|emb|CAB07275.1| Hypothetical protein T03E6.7
[Caenorhabditis elegans]
Length = 337
Score = 685 bits (1768), Expect = 0.0
Identities = 327/337 (97%), Positives = 327/337 (97%)
Frame = -1
Query: 1014 MNRFIXXXXXXXXXXVNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMI 835
MNRFI VNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMI
Sbjct: 1 MNRFILLALVAAVVAVNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMI 60
Query: 834 HIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQV 655
HIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQV
Sbjct: 61 HIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQV 120
Query: 654 PDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYG 475
PDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYG
Sbjct: 121 PDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYG 180
Query: 474 NHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEE 295
NHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEE
Sbjct: 181 NHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEE 240
Query: 294 QLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYW 115
QLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYW
Sbjct: 241 QLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYW 300
Query: 114 IVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 4
IVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV
Sbjct: 301 IVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 337
>gi|39582386|emb|CAE74770.1| Hypothetical protein CBG22599
[Caenorhabditis briggsae]
Length = 336
Score = 676 bits (1743), Expect = 0.0
Identities = 322/337 (95%), Positives = 325/337 (95%)
Frame = -1
Query: 1014 MNRFIXXXXXXXXXXVNSAKLSRQIESAIEKWDDYKEDFDKEYSESEEQTYMEAFVKNMI 835
MNRFI NSAKLSRQIESAIEKWDDYKEDFDKEY+ESEEQTYMEAFVKN+I
Sbjct: 1 MNRFILLAVLAVVAV-NSAKLSRQIESAIEKWDDYKEDFDKEYTESEEQTYMEAFVKNVI 59
Query: 834 HIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQV 655
HIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQV
Sbjct: 60 HIENHNRDHRLGRKTFEMGLNHIADLPFSQYRKLNGYRRLFGDSRIKNSSSFLAPFNVQV 119
Query: 654 PDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYG 475
PDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYG
Sbjct: 120 PDEVDWRDTHLVTDVKNQGMCGSCWAFSATGALEGQHARKLGQLVSLSEQNLVDCSTKYG 179
Query: 474 NHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEE 295
NHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEE
Sbjct: 180 NHGCNGGLMDQAFEYIRDNHGVDTEESYPYKGRDMKCHFNKKTVGADDKGYVDTPEGDEE 239
Query: 294 QLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYW 115
QLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYW
Sbjct: 240 QLKIAVATQGPISIAIDAGHRSFQLYKKGVYYDEECSSEELDHGVLLVGYGTDPEHGDYW 299
Query: 114 IVKNSWGAGWGEKGYIRIARNRNNHCGVATKASYPLV 4
+VKNSWG GWGEKGYIRIARNRNNHCGVATKASYPLV
Sbjct: 300 LVKNSWGTGWGEKGYIRIARNRNNHCGVATKASYPLV 336