Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= T02H6_6
(1086 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535945|ref|NP_493792.1| cyclin-like F-box family member (2A... 741 0.0
gi|17560006|ref|NP_507748.1| cyclin-like F-box family member (5T... 394 e-108
gi|17555720|ref|NP_499353.1| cyclin-like F-box family member (3L... 339 6e-92
gi|17539908|ref|NP_500594.1| putative cytoplasmic protein family... 317 3e-85
gi|32698452|emb|CAB60388.2| Hypothetical protein Y47H10A.2 [Caen... 253 7e-66
gi|17510081|ref|NP_493053.1| cyclin-like F-box family member (1M... 246 5e-64
gi|17508299|ref|NP_490910.1| predicted CDS, cyclin-like F-box fa... 237 3e-61
gi|17558866|ref|NP_504399.1| cyclin-like F-box family member (5F... 204 2e-51
gi|17508809|ref|NP_493003.1| cyclin-like F-box family member (1M... 190 6e-47
gi|17532035|ref|NP_493736.1| cyclin-like F-box family member (2A... 183 5e-45
gi|17535961|ref|NP_493775.1| cyclin-like F-box family member (2A... 174 2e-42
gi|17536535|ref|NP_493753.1| putative protein family member (2A8... 173 5e-42
gi|17532051|ref|NP_493732.1| putative cytoplasmic protein family... 166 1e-39
gi|17508845|ref|NP_491425.1| cyclin-like F-box family member (1F... 163 7e-39
gi|17510619|ref|NP_490869.1| predicted CDS, putative cytoplasmic... 154 3e-36
gi|17507475|ref|NP_492845.1| predicted CDS, peptidase family A16... 153 8e-36
gi|38176053|gb|AAB71043.2| Hypothetical protein T27A1.2 [Caenorh... 151 2e-35
gi|17532055|ref|NP_493734.1| predicted CDS, cyclin-like F-box fa... 139 1e-31
gi|17570373|ref|NP_508368.1| putative mitochondrial protein fami... 124 3e-27
gi|17543454|ref|NP_502619.1| predicted CDS, putative cytoplasmic... 116 1e-24
gi|17536537|ref|NP_493754.1| cyclin-like F-box precursor family ... 112 2e-23
gi|25143643|ref|NP_740812.1| cyclin-like F-box family member (1D... 105 2e-21
gi|25143641|ref|NP_740811.1| cyclin-like F-box family member (1D... 105 2e-21
gi|39582523|emb|CAE65610.1| Hypothetical protein CBG10639 [Caeno... 96 1e-18
gi|17558878|ref|NP_504510.1| cyclin-like F-box family member (5G... 94 6e-18
gi|39580965|emb|CAE72935.1| Hypothetical protein CBG20260 [Caeno... 88 3e-16
gi|32699231|gb|AAB71205.2| Hypothetical protein C24H12.9 [Caenor... 87 5e-16
gi|32565585|ref|NP_498995.2| cyclin-like F-box family member (3K... 81 4e-14
gi|17553776|ref|NP_498994.1| cyclin-like F-box family member (3K... 80 8e-14
gi|25395375|pir||G88021 protein W10D9.2 [imported] - Caenorhabdi... 80 1e-13
gi|17536797|ref|NP_493765.1| predicted CDS, putative protein fam... 79 2e-13
gi|17553632|ref|NP_498736.1| predicted CDS, cyclin-like F-box fa... 78 3e-13
gi|17536835|ref|NP_493737.1| cyclin-like F-box family member (2A... 78 3e-13
gi|39595167|emb|CAE60204.1| Hypothetical protein CBG03766 [Caeno... 77 9e-13
gi|17559384|ref|NP_504434.1| cyclin-like F-box family member (5F... 74 6e-12
gi|17532049|ref|NP_493731.1| cyclin-like F-box precursor family ... 72 2e-11
gi|39585063|emb|CAE62714.1| Hypothetical protein CBG06869 [Caeno... 71 4e-11
gi|32564327|ref|NP_490991.2| cyclin-like F-box family member (1D... 71 4e-11
gi|345351|pir||S31129 hypothetical protein F59B2.9 - Caenorhabdi... 71 4e-11
gi|17540538|ref|NP_502501.1| predicted CDS, putative cytoplasmic... 67 9e-10
gi|17508893|ref|NP_492562.1| putative protein family member (1K2... 65 2e-09
gi|32565425|ref|NP_871891.1| cyclin-like F-box family member (1K... 65 4e-09
gi|39593501|emb|CAE61793.1| Hypothetical protein CBG05756 [Caeno... 64 8e-09
gi|39595157|emb|CAE60194.1| Hypothetical protein CBG03754 [Caeno... 60 9e-08
gi|7507212|pir||T24545 hypothetical protein T05F1.11 - Caenorhab... 59 2e-07
gi|17560370|ref|NP_504562.1| predicted CDS, putative cytoplasmic... 57 7e-07
gi|49035165|gb|AAK68353.2| Hypothetical protein F29G9.7 [Caenorh... 57 7e-07
gi|17553654|ref|NP_499733.1| cyclin-like F-box family member (35... 55 3e-06
gi|17534505|ref|NP_494036.1| cyclin-like F-box family member (2B... 54 8e-06
gi|17536893|ref|NP_494653.1| predicted CDS, cyclin-like F-box fa... 53 1e-05
gi|17543374|ref|NP_501099.1| cyclin-like F-box family member (4H... 52 2e-05
gi|17564212|ref|NP_507030.1| cyclin-like F-box family member, po... 51 4e-05
gi|17564210|ref|NP_507029.1| putative protein family member (5Q5... 50 7e-05
gi|39582548|emb|CAE63867.1| Hypothetical protein CBG08432 [Caeno... 50 7e-05
gi|17507471|ref|NP_492847.1| putative cytoplasmic protein family... 50 7e-05
gi|17555320|ref|NP_499788.1| cyclin-like F-box family member (3O... 50 9e-05
gi|39584449|emb|CAE72587.1| Hypothetical protein CBG19776 [Caeno... 50 9e-05
gi|17569785|ref|NP_508225.1| predicted CDS, putative protein fam... 50 1e-04
gi|17532053|ref|NP_493733.1| predicted CDS, cyclin-like F-box fa... 50 1e-04
gi|49035206|gb|AAB71206.2| Hypothetical protein C24H12.10 [Caeno... 49 2e-04
gi|17558298|ref|NP_505764.1| predicted CDS, putative cytoplasmic... 49 2e-04
gi|39587176|emb|CAE57644.1| Hypothetical protein CBG00630 [Caeno... 49 2e-04
gi|17540294|ref|NP_502240.1| cyclin-like F-box family member (4M... 48 3e-04
gi|39583805|emb|CAE74878.1| Hypothetical protein CBG22737 [Caeno... 48 5e-04
gi|17532979|ref|NP_494358.1| predicted CDS, cyclin-like F-box fa... 48 5e-04
gi|39589447|emb|CAE74476.1| Hypothetical protein CBG22224 [Caeno... 47 6e-04
gi|17534915|ref|NP_493994.1| predicted CDS, putative cytoplasmic... 47 8e-04
gi|39581913|emb|CAE72875.1| Hypothetical protein CBG20179 [Caeno... 47 0.001
gi|39585064|emb|CAE62715.1| Hypothetical protein CBG06870 [Caeno... 47 0.001
gi|39583279|emb|CAE60071.1| Hypothetical protein CBG03589 [Caeno... 47 0.001
gi|39585960|emb|CAE68249.1| Hypothetical protein CBG13925 [Caeno... 46 0.002
gi|32564986|ref|NP_498482.2| cyclin-like F-box family member (3H... 45 0.002
gi|39596247|emb|CAE69885.1| Hypothetical protein CBG16225 [Caeno... 45 0.003
gi|17542776|ref|NP_500471.1| predicted CDS, putative protein (4E... 45 0.003
gi|38176033|gb|AAB70998.3| Hypothetical protein M01D1.2 [Caenorh... 45 0.004
gi|32564823|ref|NP_493891.2| Meprin/TRAF-like MATH family member... 45 0.004
gi|25395396|pir||B88035 protein M01D1.2 [imported] - Caenorhabdi... 45 0.004
gi|39581924|emb|CAE72886.1| Hypothetical protein CBG20199 [Caeno... 44 0.005
gi|32565225|ref|NP_494093.2| putative cytoplasmic protein family... 44 0.005
gi|49035188|gb|AAK67220.3| Hypothetical protein C52E2.6 [Caenorh... 44 0.005
gi|39590887|emb|CAE65261.1| Hypothetical protein CBG10152 [Caeno... 44 0.005
gi|17541606|ref|NP_502237.1| cyclin-like F-box family member (4M... 44 0.007
gi|17553652|ref|NP_499732.1| cyclin-like F-box family member (3O... 44 0.009
gi|39583665|emb|CAE63769.1| Hypothetical protein CBG08306 [Caeno... 43 0.011
gi|17536311|ref|NP_494178.1| predicted CDS, cyclin-like F-box fa... 43 0.011
gi|39590473|emb|CAE66213.1| Hypothetical protein CBG11455 [Caeno... 43 0.011
gi|17532047|ref|NP_493730.1| predicted CDS, cyclin-like F-box fa... 43 0.011
gi|17534917|ref|NP_493992.1| predicted CDS, cyclin-like F-box fa... 43 0.011
gi|17555104|ref|NP_497155.1| cyclin-like F-box family member (3A... 43 0.015
gi|17534923|ref|NP_493995.1| cyclin-like F-box family member (2B... 42 0.019
gi|7506328|pir||T16695 hypothetical protein R05H11.1 - Caenorhab... 42 0.019
gi|7505335|pir||T32848 hypothetical protein K05F6.7 - Caenorhabd... 42 0.019
gi|23619065|ref|NP_705027.1| hypothetical protein [Plasmodium fa... 42 0.019
gi|39593998|emb|CAE70108.1| Hypothetical protein CBG16556 [Caeno... 42 0.025
gi|17533763|ref|NP_494071.1| predicted CDS, cyclin-like F-box fa... 42 0.032
gi|17555108|ref|NP_497157.1| very Early Transcript VET-3, cyclin... 41 0.042
gi|17533773|ref|NP_494069.1| cyclin-like F-box family member (2C... 41 0.055
gi|50420259|ref|XP_458662.1| unnamed protein product [Debaryomyc... 41 0.055
gi|39583301|emb|CAE60093.1| Hypothetical protein CBG03617 [Caeno... 41 0.055
gi|17510357|ref|NP_493459.1| predicted CDS, cyclin-like F-box fa... 40 0.072
gi|17537757|ref|NP_494023.1| predicted CDS, cyclin-like F-box fa... 39 0.16
gi|13812221|ref|NP_113352.1| hypothetical protein [Guillardia th... 39 0.16
gi|17534927|ref|NP_493999.1| cyclin-like F-box family member (2B... 39 0.16
gi|39587417|emb|CAE75071.1| Hypothetical protein CBG22987 [Caeno... 39 0.16
gi|17536833|ref|NP_493738.1| predicted CDS, putative endoplasmic... 39 0.21
gi|39581912|emb|CAE72874.1| Hypothetical protein CBG20177 [Caeno... 39 0.21
gi|17534523|ref|NP_494048.1| cyclin-like F-box family member (2B... 39 0.21
gi|17507459|ref|NP_493499.1| cyclin-like F-box family member (1O... 39 0.27
gi|7503792|pir||T22401 hypothetical protein F49B2.1 - Caenorhabd... 39 0.27
gi|17534913|ref|NP_493996.1| predicted CDS, cyclin-like F-box fa... 39 0.27
gi|17532981|ref|NP_494359.1| cyclin-like F-box family member (2D... 38 0.36
gi|17532265|ref|NP_494204.1| cyclin-like F-box family member (2C... 38 0.36
gi|39587416|emb|CAE75070.1| Hypothetical protein CBG22986 [Caeno... 38 0.47
gi|23612819|ref|NP_704358.1| hypothetical protein [Plasmodium fa... 37 0.61
gi|17540812|ref|NP_500352.1| protein of unknown function DUF38 a... 37 0.61
gi|17557382|ref|NP_507586.1| putative protein family member (5S7... 37 0.61
gi|11466195|ref|NP_066518.1| ribosomal protein S10 [Naegleria gr... 37 0.61
gi|17564742|ref|NP_507739.1| predicted CDS, cyclin-like F-box fa... 37 0.80
gi|17555106|ref|NP_497156.1| putative cytoplasmic protein family... 37 1.0
gi|7507908|pir||T33429 hypothetical protein T17A3.6 - Caenorhabd... 37 1.0
gi|23509930|ref|NP_702597.1| hypothetical protein [Plasmodium fa... 36 1.4
gi|23619023|ref|NP_704985.1| hypothetical protein [Plasmodium fa... 36 1.4
gi|49483760|ref|YP_040984.1| PfkB family carbohydrate kinase [St... 36 1.4
gi|17556284|ref|NP_499547.1| predicted CDS, cyclin-like F-box fa... 36 1.8
gi|38176057|gb|AAB71056.3| Hypothetical protein W10D9.2 [Caenorh... 36 1.8
gi|17534055|ref|NP_494058.1| cyclin-like F-box family member (2C... 35 2.3
gi|17552704|ref|NP_497698.1| cyclin-like F-box family member (3E... 35 3.0
gi|39581284|emb|CAE60030.1| Hypothetical protein CBG03537 [Caeno... 35 3.0
gi|15828853|ref|NP_326213.1| conserved hypothetical protein [Myc... 35 3.0
gi|17509951|ref|NP_493362.1| cyclin-like F-box family member (1O... 35 3.0
gi|19173437|ref|NP_597240.1| COATOMER COMPLEX BETA SUBUNIT [Ence... 35 3.0
gi|23509272|ref|NP_701939.1| hypothetical protein, conserved [Pl... 35 3.0
gi|17535153|ref|NP_493899.1| cyclin-like F-box family member (2B... 35 3.0
gi|16804955|ref|NP_472984.1| hypothetical protein [Plasmodium fa... 35 4.0
gi|15605641|ref|NP_213016.1| putative protein [Aquifex aeolicus ... 35 4.0
gi|23478342|gb|EAA15456.1| glutamate dehydrogenase-related [Plas... 35 4.0
gi|23490487|gb|EAA22252.1| hypothetical protein [Plasmodium yoel... 35 4.0
gi|13811987|ref|NP_113116.1| DNA repair helicase component of tr... 35 4.0
gi|39581513|emb|CAE64249.1| Hypothetical protein CBG08893 [Caeno... 35 4.0
gi|7506054|pir||T32302 hypothetical protein M151.6 - Caenorhabdi... 35 4.0
gi|39583274|emb|CAE60066.1| Hypothetical protein CBG03582 [Caeno... 35 4.0
gi|17567313|ref|NP_510404.1| cyclin-like F-box (XP63) [Caenorhab... 34 5.2
gi|11496554|ref|NP_044567.1| ribosomal protein S2 [Toxoplasma go... 34 5.2
gi|23507900|ref|NP_700570.1| hypothetical protein [Plasmodium fa... 34 5.2
gi|18309339|ref|NP_561273.1| hypothetical protein CPE0357 [Clost... 34 5.2
gi|17555102|ref|NP_497154.1| cyclin-like F-box family member (3A... 34 5.2
gi|39583273|emb|CAE60065.1| Hypothetical protein CBG03581 [Caeno... 34 5.2
gi|42560827|ref|NP_975278.1| Conserved hypothetical transmembran... 34 5.2
gi|46445620|gb|EAL04888.1| hypothetical protein CaO19.4900 [Cand... 34 5.2
gi|46445426|gb|EAL04695.1| hypothetical protein CaO19.12366 [Can... 34 5.2
gi|23619371|ref|NP_705333.1| hypothetical protein [Plasmodium fa... 34 6.8
gi|17533245|ref|NP_496662.1| cyclin-like F-box family member (2M... 34 6.8
gi|37680874|ref|NP_935483.1| c-di-GMP phosphodiesterase A-relate... 34 6.8
gi|23612448|ref|NP_704009.1| hypothetical protein [Plasmodium fa... 34 6.8
gi|27365074|ref|NP_760602.1| c-di-GMP phosphodiesterase A-relate... 34 6.8
gi|15794987|ref|NP_284809.1| hypothetical protein [Neisseria men... 34 6.8
gi|40788294|dbj|BAA25512.2| KIAA0586 protein [Homo sapiens] 33 8.8
gi|46227692|gb|EAK88612.1| hypothetical protein, transcripts ide... 33 8.8
gi|44890621|gb|AAH66647.1| KIAA0586 protein [Homo sapiens] 33 8.8
gi|20140756|sp|Q9BVV6|K586_HUMAN Protein KIAA0586 >gnl|BL_ORD_ID... 33 8.8
gi|17536137|ref|NP_494083.1| predicted CDS, cyclin-like F-box fa... 33 8.8
gi|17537477|ref|NP_497110.1| predicted CDS, cyclin-like F-box fa... 33 8.8
gi|11466092|ref|NP_052999.1| RNA polymerase [Pleurotus ostreatus... 33 8.8
gi|23612645|ref|NP_704206.1| hypothetical protein [Plasmodium fa... 33 8.8
gi|26554058|ref|NP_757992.1| predicted integral membrane protein... 33 8.8
gi|41281469|ref|NP_055564.2| KIAA0586 [Homo sapiens] >gnl|BL_ORD... 33 8.8
>gi|17535945|ref|NP_493792.1| cyclin-like F-box family member (2A979)
[Caenorhabditis elegans]
gi|7206805|gb|AAF39964.1| Hypothetical protein T02H6.5
[Caenorhabditis elegans]
Length = 361
Score = 741 bits (1913), Expect = 0.0
Identities = 361/361 (100%), Positives = 361/361 (100%)
Frame = +1
Query: 1 MAISKLFFAYFHKNEKPFKMLCLPLLPLKNVINQMSFESVWRLSKTSRKMYEKIKNVKKS 180
MAISKLFFAYFHKNEKPFKMLCLPLLPLKNVINQMSFESVWRLSKTSRKMYEKIKNVKKS
Sbjct: 1 MAISKLFFAYFHKNEKPFKMLCLPLLPLKNVINQMSFESVWRLSKTSRKMYEKIKNVKKS 60
Query: 181 IYKIVIDNRFEYNIIYPRFKTRILRFEKKSDFVSVYNEMGTNKEITASVYLKFSVDFWIE 360
IYKIVIDNRFEYNIIYPRFKTRILRFEKKSDFVSVYNEMGTNKEITASVYLKFSVDFWIE
Sbjct: 61 IYKIVIDNRFEYNIIYPRFKTRILRFEKKSDFVSVYNEMGTNKEITASVYLKFSVDFWIE 120
Query: 361 LFYKLDKRGPGKLRSSVYKLNHLKKRLKYLNRFDELFSIKHVDLVIDKYKLFGDSISHPL 540
LFYKLDKRGPGKLRSSVYKLNHLKKRLKYLNRFDELFSIKHVDLVIDKYKLFGDSISHPL
Sbjct: 121 LFYKLDKRGPGKLRSSVYKLNHLKKRLKYLNRFDELFSIKHVDLVIDKYKLFGDSISHPL 180
Query: 541 FQKCDYMEIVGNTSYISNNEMNFVLNNFKLKNGLLTNCLIAEDFDVTAMQQIPRLVIFNA 720
FQKCDYMEIVGNTSYISNNEMNFVLNNFKLKNGLLTNCLIAEDFDVTAMQQIPRLVIFNA
Sbjct: 181 FQKCDYMEIVGNTSYISNNEMNFVLNNFKLKNGLLTNCLIAEDFDVTAMQQIPRLVIFNA 240
Query: 721 QHITVEDLIKMDCETIKLCYHQFKPRHINQLLHHWLSGEMPKLRRFRLNFYCDTTWIGVV 900
QHITVEDLIKMDCETIKLCYHQFKPRHINQLLHHWLSGEMPKLRRFRLNFYCDTTWIGVV
Sbjct: 241 QHITVEDLIKMDCETIKLCYHQFKPRHINQLLHHWLSGEMPKLRRFRLNFYCDTTWIGVV 300
Query: 901 LSGIEHSKWDGQRRAKFFRDGIESIDCGNGFDIERNDGLLATFSSLEDSIDFVVWGNISA 1080
LSGIEHSKWDGQRRAKFFRDGIESIDCGNGFDIERNDGLLATFSSLEDSIDFVVWGNISA
Sbjct: 301 LSGIEHSKWDGQRRAKFFRDGIESIDCGNGFDIERNDGLLATFSSLEDSIDFVVWGNISA 360
Query: 1081 L 1083
L
Sbjct: 361 L 361