Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R11A5_1
(1011 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17509347|ref|NP_492169.1| TBP-Associated transcription Factor... 682 0.0
gi|39580105|emb|CAE56124.1| Hypothetical protein CBG23733 [Caeno... 577 e-163
gi|48097292|ref|XP_391870.1| similar to ENSANGP00000017965 [Apis... 261 1e-68
gi|31240845|ref|XP_320836.1| ENSANGP00000017965 [Anopheles gambi... 249 7e-65
gi|45768550|gb|AAH67651.1| Unknown (protein for IMAGE:6963216) [... 248 2e-64
gi|47117222|sp|Q8C092|TAF5_MOUSE Transcription initiation factor... 236 5e-61
gi|34863779|ref|XP_219965.2| similar to RIKEN cDNA 6330528C20 ge... 235 1e-60
gi|28893469|ref|NP_796316.1| TAF5 RNA polymerase II, TATA box bi... 235 1e-60
gi|1732075|gb|AAC50902.1| TBP-associated factor [Homo sapiens] 235 1e-60
gi|21071067|ref|NP_008882.2| TBP-associated factor 5; TATA box b... 235 1e-60
gi|6686341|sp|Q15542|TAF5_HUMAN Transcription initiation factor ... 235 1e-60
gi|30354079|gb|AAH52268.1| TAF5 protein [Homo sapiens] 232 9e-60
gi|50749745|ref|XP_421737.1| PREDICTED: similar to TAF5 RNA poly... 229 6e-59
gi|627169|pir||S33263 transcription initiation factor IID-associ... 229 7e-59
gi|17136870|ref|NP_476957.1| CG7704-PA [Drosophila melanogaster]... 229 7e-59
gi|1491718|emb|CAA64777.1| hTAFII100 [Homo sapiens] 227 3e-58
gi|47220310|emb|CAG03344.1| unnamed protein product [Tetraodon n... 207 3e-52
gi|39545918|gb|AAR28022.1| TAF5 [Arabidopsis thaliana] 201 3e-50
gi|50424771|ref|XP_460975.1| unnamed protein product [Debaryomyc... 198 2e-49
gi|50546811|ref|XP_500875.1| hypothetical protein [Yarrowia lipo... 197 4e-49
gi|30689741|ref|NP_197897.2| transducin family protein / WD-40 r... 193 5e-48
gi|46439108|gb|EAK98430.1| hypothetical protein CaO19.536 [Candi... 191 2e-47
gi|45190361|ref|NP_984615.1| AEL246Cp [Eremothecium gossypii] >g... 189 9e-47
gi|50309993|ref|XP_455010.1| unnamed protein product [Kluyveromy... 182 1e-44
gi|6319675|ref|NP_009757.1| Subunit (90 kDa) of TFIID and SAGA c... 176 6e-43
gi|19075402|ref|NP_587902.1| tfiid subunit taf72p. [Schizosaccha... 173 5e-42
gi|50294333|ref|XP_449578.1| unnamed protein product [Candida gl... 169 7e-41
gi|17864464|ref|NP_524827.1| CG6577-PA [Drosophila melanogaster]... 168 2e-40
gi|19527184|ref|NP_598727.1| TAF5-like RNA polymerase II, p300/C... 166 8e-40
gi|34851989|ref|XP_226577.2| similar to RIKEN cDNA 1110005N04 [R... 165 1e-39
gi|7657439|ref|NP_055224.1| PCAF associated factor 65 beta; TAF5... 164 4e-39
gi|41054115|ref|NP_956146.1| Unknown (protein for MGC:63765); wu... 162 1e-38
gi|26354532|dbj|BAC40894.1| unnamed protein product [Mus musculus] 160 3e-38
gi|49072822|ref|XP_400694.1| hypothetical protein UM03079.1 [Ust... 160 3e-38
gi|49522519|gb|AAH75582.1| Unknown (protein for MGC:89568) [Xeno... 160 3e-38
gi|50416375|gb|AAH77313.1| Unknown (protein for MGC:80243) [Xeno... 158 2e-37
gi|50255088|gb|EAL17827.1| hypothetical protein CNBL0890 [Crypto... 156 6e-37
gi|50741419|ref|XP_419579.1| PREDICTED: similar to TAF5-like RNA... 155 2e-36
gi|34854574|ref|XP_218024.2| similar to RIKEN cDNA 1110005N04 [R... 155 2e-36
gi|47214090|emb|CAF95347.1| unnamed protein product [Tetraodon n... 155 2e-36
gi|34880600|ref|XP_346308.1| similar to RIKEN cDNA 1110005N04 [R... 154 2e-36
gi|3646272|emb|CAA08816.1| putative transcription factor [Homo s... 154 4e-36
gi|19113046|ref|NP_596254.1| transcription initiation factor TFI... 152 1e-35
gi|19074975|ref|NP_586481.1| TRANSCRIPTION INITIATION FACTOR TFI... 151 2e-35
gi|32405726|ref|XP_323476.1| related to TRANSCRIPTION INITIATION... 145 2e-33
gi|33146605|dbj|BAC79801.1| putative TATA box binding protein-as... 143 5e-33
gi|49084464|ref|XP_404429.1| hypothetical protein AN0292.2 [Aspe... 136 7e-31
gi|38109175|gb|EAA55085.1| hypothetical protein MG06742.4 [Magna... 117 4e-25
gi|46134602|ref|ZP_00158196.2| COG2319: FOG: WD40 repeat [Anabae... 114 3e-24
gi|31208599|ref|XP_313266.1| ENSANGP00000010488 [Anopheles gambi... 114 4e-24
gi|17232326|ref|NP_488874.1| WD-repeat protein [Nostoc sp. PCC 7... 113 6e-24
gi|23128312|ref|ZP_00110163.1| COG2319: FOG: WD40 repeat [Nostoc... 110 7e-23
gi|47085759|ref|NP_998214.1| zgc:56055 [Danio rerio] >gnl|BL_ORD... 109 1e-22
gi|17227780|ref|NP_484328.1| WD-40 repeat protein [Nostoc sp. PC... 108 2e-22
gi|13938537|gb|AAH07417.1| DKFZP434C245 protein [Homo sapiens] 108 3e-22
gi|31377770|ref|NP_056241.2| DKFZP434C245 protein [Homo sapiens]... 107 3e-22
gi|24649265|ref|NP_651136.1| CG4448-PA [Drosophila melanogaster]... 105 2e-21
gi|23124810|ref|ZP_00106776.1| COG2319: FOG: WD40 repeat [Nostoc... 105 2e-21
gi|12846941|dbj|BAB27371.1| unnamed protein product [Mus musculus] 104 3e-21
gi|22028422|gb|AAH34901.1| 2510040D07Rik protein [Mus musculus] 104 3e-21
gi|23593529|ref|XP_135092.2| RIKEN cDNA 2510040D07 [Mus musculus] 103 5e-21
gi|17225206|gb|AAL37299.1| beta transducin-like protein HET-E2C*... 103 6e-21
gi|46110256|ref|XP_382186.1| hypothetical protein FG02010.1 [Gib... 103 6e-21
gi|37682095|gb|AAQ97974.1| TUWD12 [Danio rerio] 102 1e-20
gi|45508168|ref|ZP_00160508.1| COG2319: FOG: WD40 repeat [Anabae... 102 2e-20
gi|23126059|ref|ZP_00107968.1| COG2319: FOG: WD40 repeat [Nostoc... 101 2e-20
gi|26665869|ref|NP_758440.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_I... 101 3e-20
gi|41056233|ref|NP_956412.1| Unknown (protein for MGC:63538); wu... 101 3e-20
gi|48895476|ref|ZP_00328460.1| COG2319: FOG: WD40 repeat [Tricho... 100 4e-20
gi|5051805|emb|CAB45034.1| putative WD-repeat containing protein... 100 4e-20
gi|45506973|ref|ZP_00159321.1| COG2319: FOG: WD40 repeat [Anabae... 100 5e-20
gi|17228160|ref|NP_484708.1| WD-40 repeat protein [Nostoc sp. PC... 100 7e-20
gi|17225204|gb|AAL37298.1| beta transducin-like protein HET-E2C ... 100 9e-20
gi|17225208|gb|AAL37300.1| beta transducin-like protein HET-E2C*... 100 9e-20
gi|49523068|gb|AAH75548.1| Unknown (protein for MGC:89488) [Xeno... 99 1e-19
gi|23124360|ref|ZP_00106355.1| COG2319: FOG: WD40 repeat [Nostoc... 99 2e-19
gi|47059149|ref|NP_082016.1| similar to TUWD12 [Mus musculus] >g... 99 2e-19
gi|3023956|sp|Q00808|HET1_PODAN Vegetatible incompatibility prot... 99 2e-19
gi|12856025|dbj|BAB30542.1| unnamed protein product [Mus musculu... 98 3e-19
gi|23124949|ref|ZP_00106905.1| COG2319: FOG: WD40 repeat [Nostoc... 98 3e-19
gi|23128981|ref|ZP_00110817.1| COG2319: FOG: WD40 repeat [Nostoc... 97 4e-19
gi|37522390|ref|NP_925767.1| WD-repeat protein [Gloeobacter viol... 97 4e-19
gi|17488592|gb|AAL40359.1| unknown protein [Takifugu rubripes] 97 6e-19
gi|23130558|ref|ZP_00112371.1| COG2319: FOG: WD40 repeat [Nostoc... 97 6e-19
gi|17227743|ref|NP_484291.1| WD-40 repeat protein [Nostoc sp. PC... 97 8e-19
gi|46134381|ref|ZP_00157805.2| COG2319: FOG: WD40 repeat [Anabae... 97 8e-19
gi|17227525|ref|NP_484073.1| WD-40 repeat protein [Nostoc sp. PC... 97 8e-19
gi|33417154|gb|AAH56099.1| MGC69111 protein [Xenopus laevis] 96 1e-18
gi|45505417|ref|ZP_00157801.1| COG2319: FOG: WD40 repeat [Anabae... 96 1e-18
gi|17230958|ref|NP_487506.1| WD-40 repeat protein [Nostoc sp. PC... 96 1e-18
gi|37523920|ref|NP_927297.1| WD-repeat protein [Gloeobacter viol... 96 2e-18
gi|37523925|ref|NP_927302.1| WD-repeat protein [Gloeobacter viol... 95 3e-18
gi|17229616|ref|NP_486164.1| WD-40 repeat protein [Nostoc sp. PC... 95 3e-18
gi|45506782|ref|ZP_00159132.1| COG2319: FOG: WD40 repeat [Anabae... 95 3e-18
gi|45509405|ref|ZP_00161739.1| COG2319: FOG: WD40 repeat [Anabae... 94 4e-18
gi|48891324|ref|ZP_00324864.1| COG2319: FOG: WD40 repeat [Tricho... 94 4e-18
gi|48838134|ref|ZP_00295082.1| COG2319: FOG: WD40 repeat [Methan... 94 4e-18
gi|50728412|ref|XP_416132.1| PREDICTED: similar to TUWD12 [Gallu... 94 5e-18
gi|23128236|ref|ZP_00110089.1| COG2319: FOG: WD40 repeat [Nostoc... 94 5e-18
gi|46135357|ref|ZP_00162759.2| COG2319: FOG: WD40 repeat [Anabae... 94 6e-18
gi|23126094|ref|ZP_00108001.1| COG2319: FOG: WD40 repeat [Nostoc... 93 8e-18
gi|47224493|emb|CAG08743.1| unnamed protein product [Tetraodon n... 93 8e-18
gi|45509691|ref|ZP_00162024.1| COG2319: FOG: WD40 repeat [Anabae... 93 8e-18
gi|37522457|ref|NP_925834.1| WD-repeat protein [Gloeobacter viol... 92 2e-17
gi|7479150|pir||T42045 beta transducin-like protein homolog - St... 92 2e-17
gi|49101231|ref|XP_410940.1| hypothetical protein AN6803.2 [Aspe... 92 2e-17
gi|17230661|ref|NP_487209.1| WD repeat protein with Ser/Thr prot... 92 2e-17
gi|21222277|ref|NP_628056.1| putative WD-40 repeat protein [Stre... 92 2e-17
gi|15229187|ref|NP_190535.1| transducin family protein / WD-40 r... 92 2e-17
gi|20091353|ref|NP_617428.1| WD40-repeat containing protein [Met... 91 3e-17
gi|20091406|ref|NP_617481.1| WD-domain containing protein [Metha... 91 3e-17
gi|46134601|ref|ZP_00158195.2| COG2319: FOG: WD40 repeat [Anabae... 91 3e-17
gi|48893749|ref|ZP_00326947.1| COG2319: FOG: WD40 repeat [Tricho... 91 3e-17
gi|50754099|ref|XP_414244.1| PREDICTED: similar to DKFZP434C245 ... 91 4e-17
gi|17230292|ref|NP_486840.1| WD-repeat protein [Nostoc sp. PCC 7... 91 4e-17
gi|23130132|ref|ZP_00111951.1| COG2319: FOG: WD40 repeat [Nostoc... 91 4e-17
gi|17227974|ref|NP_484522.1| WD-40 repeat protein [Nostoc sp. PC... 91 5e-17
gi|37521534|ref|NP_924911.1| WD-repeat protein [Gloeobacter viol... 90 9e-17
gi|47229875|emb|CAG07071.1| unnamed protein product [Tetraodon n... 90 9e-17
gi|48892224|ref|ZP_00325622.1| COG2319: FOG: WD40 repeat [Tricho... 90 9e-17
gi|17225210|gb|AAL37301.1| beta transducin-like protein HET-D2Y ... 90 9e-17
gi|17227779|ref|NP_484327.1| WD-40 repeat protein [Nostoc sp. PC... 89 1e-16
gi|46135416|ref|ZP_00203492.1| COG2319: FOG: WD40 repeat [Anabae... 89 2e-16
gi|48894805|ref|ZP_00327914.1| COG2319: FOG: WD40 repeat [Tricho... 89 2e-16
gi|17227934|ref|NP_484482.1| serine/threonine kinase with WD-40 ... 88 3e-16
gi|45507426|ref|ZP_00159770.1| COG2319: FOG: WD40 repeat [Anabae... 88 3e-16
gi|9931971|gb|AAB81475.2| general transcriptional repressor Tup1... 88 3e-16
gi|49102841|ref|XP_411097.1| hypothetical protein AN6960.2 [Aspe... 88 3e-16
gi|45508715|ref|ZP_00161052.1| COG2319: FOG: WD40 repeat [Anabae... 88 3e-16
gi|19113822|ref|NP_592910.1| general transcriptional repressor t... 88 3e-16
gi|49124494|ref|XP_412605.1| hypothetical protein AN8468.2 [Aspe... 87 5e-16
gi|23124439|ref|ZP_00106428.1| COG2319: FOG: WD40 repeat [Nostoc... 87 5e-16
gi|23130123|ref|ZP_00111942.1| COG2319: FOG: WD40 repeat [Nostoc... 87 5e-16
gi|45509331|ref|ZP_00161665.1| COG2319: FOG: WD40 repeat [Anabae... 87 5e-16
gi|17230283|ref|NP_486831.1| WD-repeat protein [Nostoc sp. PCC 7... 87 8e-16
gi|45508311|ref|ZP_00160650.1| COG2319: FOG: WD40 repeat [Anabae... 87 8e-16
gi|45509197|ref|ZP_00161532.1| COG2319: FOG: WD40 repeat [Anabae... 87 8e-16
gi|45508310|ref|ZP_00160649.1| COG2319: FOG: WD40 repeat [Anabae... 86 1e-15
gi|23125398|ref|ZP_00107333.1| COG2319: FOG: WD40 repeat [Nostoc... 86 1e-15
gi|48894319|ref|ZP_00327428.1| COG2319: FOG: WD40 repeat [Tricho... 86 1e-15
gi|19112019|ref|NP_595227.1| WD repeat protein [Schizosaccharomy... 86 1e-15
gi|46135387|ref|ZP_00162792.2| COG2319: FOG: WD40 repeat [Anabae... 86 1e-15
gi|17230611|ref|NP_487159.1| WD repeat protein with Ser/Thr prot... 86 2e-15
gi|47679343|gb|AAT36652.1| Tup1p [Exophiala dermatitidis] 86 2e-15
gi|38099099|gb|EAA46486.1| hypothetical protein MG08829.4 [Magna... 86 2e-15
gi|24663767|ref|NP_648640.1| CG10191-PA [Drosophila melanogaster... 85 3e-15
gi|22298032|ref|NP_681279.1| WD-40 repeat protein [Thermosynecho... 85 3e-15
gi|50257760|gb|EAL20461.1| hypothetical protein CNBE3820 [Crypto... 84 4e-15
gi|48840987|ref|ZP_00297913.1| COG2319: FOG: WD40 repeat [Methan... 84 5e-15
gi|16331137|ref|NP_441865.1| beta transducin-like protein [Synec... 84 7e-15
gi|17232251|ref|NP_488799.1| WD-repeat protein [Nostoc sp. PCC 7... 83 9e-15
gi|48100231|ref|XP_392611.1| similar to TUWD12 [Apis mellifera] 83 9e-15
gi|48893580|ref|ZP_00326778.1| COG2319: FOG: WD40 repeat [Tricho... 83 1e-14
gi|23126805|ref|ZP_00108691.1| COG2319: FOG: WD40 repeat [Nostoc... 83 1e-14
gi|16331266|ref|NP_441994.1| beta transducin-like protein [Synec... 83 1e-14
gi|48835147|ref|ZP_00292148.1| COG2319: FOG: WD40 repeat [Thermo... 82 1e-14
gi|15235470|ref|NP_192182.1| transducin family protein / WD-40 r... 82 1e-14
gi|38455441|gb|AAR20840.1| antigenic WD protein [Leishmania amaz... 82 1e-14
gi|19113785|ref|NP_592873.1| WD repeat protein; related to tup1 ... 82 1e-14
gi|1346729|sp|P49695|PKWA_THECU Probable serine/threonine-protei... 82 1e-14
gi|23129032|ref|ZP_00110866.1| COG2319: FOG: WD40 repeat [Nostoc... 82 2e-14
gi|50428732|gb|AAT77083.1| putative WD G-beta repeat protein [Or... 82 2e-14
gi|48891514|ref|ZP_00325021.1| COG2319: FOG: WD40 repeat [Tricho... 82 3e-14
gi|45506821|ref|ZP_00159171.1| COG2319: FOG: WD40 repeat [Anabae... 82 3e-14
gi|23130638|ref|ZP_00112451.1| COG2319: FOG: WD40 repeat [Nostoc... 82 3e-14
gi|37520744|ref|NP_924121.1| WD-repeat protein [Gloeobacter viol... 82 3e-14
gi|50414726|gb|AAH77273.1| Unknown (protein for IMAGE:4031030) [... 82 3e-14
gi|3122601|sp|P93107|PF20_CHLRE Flagellar WD-repeat protein PF20... 82 3e-14
gi|37520294|ref|NP_923671.1| WD-40 repeat protein [Gloeobacter v... 82 3e-14
gi|17228167|ref|NP_484715.1| WD-repeat protein [Nostoc sp. PCC 7... 81 3e-14
gi|49078624|ref|XP_403047.1| hypothetical protein UM05432.1 [Ust... 81 4e-14
gi|5031817|ref|NP_005877.1| katanin p80 subunit B 1; katanin (80... 81 4e-14
gi|41724850|ref|ZP_00151660.1| COG2319: FOG: WD40 repeat [Dechlo... 81 4e-14
gi|46119952|ref|ZP_00179225.2| COG2319: FOG: WD40 repeat [Crocos... 81 4e-14
gi|21674797|ref|NP_662862.1| WD-repeat family protein [Chlorobiu... 81 4e-14
gi|31242369|ref|XP_321615.1| ENSANGP00000011640 [Anopheles gambi... 80 6e-14
gi|25402650|pir||E86245 hypothetical protein [imported] - Arabid... 80 6e-14
gi|50556994|ref|XP_505905.1| hypothetical protein [Yarrowia lipo... 80 6e-14
gi|37520475|ref|NP_923852.1| WD-repeat protein [Gloeobacter viol... 80 6e-14
gi|37522224|ref|NP_925601.1| WD-repeat protein [Gloeobacter viol... 80 7e-14
gi|48894581|ref|ZP_00327690.1| COG2319: FOG: WD40 repeat [Tricho... 80 7e-14
gi|37521813|ref|NP_925190.1| WD-repeat protein [Gloeobacter viol... 80 7e-14
gi|3406654|gb|AAC29438.1| transcriptional repressor TUP1 [Dictyo... 80 7e-14
gi|48891596|ref|ZP_00325089.1| COG0515: Serine/threonine protein... 80 7e-14
gi|23130298|ref|ZP_00112115.1| COG2319: FOG: WD40 repeat [Nostoc... 80 1e-13
gi|20302740|gb|AAM18868.1| unknown [Branchiostoma floridae] 80 1e-13
gi|23129632|ref|ZP_00111458.1| COG2319: FOG: WD40 repeat [Nostoc... 80 1e-13
gi|49098124|ref|XP_410522.1| hypothetical protein AN6385.2 [Aspe... 79 2e-13
gi|17233145|ref|NP_490235.1| WD-repeat protein [Nostoc sp. PCC 7... 79 2e-13
gi|23123730|ref|ZP_00105782.1| COG2319: FOG: WD40 repeat [Nostoc... 79 2e-13
gi|23130358|ref|ZP_00112175.1| COG2319: FOG: WD40 repeat [Nostoc... 79 2e-13
gi|29465691|gb|AAL99251.1| TupA protein [Penicillium marneffei] 79 2e-13
gi|47498030|ref|NP_998874.1| hypothetical protein MGC69344 [Xeno... 79 2e-13
gi|27694663|gb|AAH43772.1| Katnb1-prov protein [Xenopus laevis] 79 2e-13
gi|23129645|ref|ZP_00111471.1| COG2319: FOG: WD40 repeat [Nostoc... 79 2e-13
gi|48846051|ref|ZP_00300319.1| COG2319: FOG: WD40 repeat [Geobac... 79 2e-13
gi|46111239|ref|XP_382677.1| hypothetical protein FG02501.1 [Gib... 79 2e-13
gi|50750091|ref|XP_421865.1| PREDICTED: similar to PF20; sperm-a... 79 2e-13
gi|48832164|ref|ZP_00289205.1| COG2319: FOG: WD40 repeat [Magnet... 78 3e-13
gi|48893278|ref|ZP_00326547.1| COG0515: Serine/threonine protein... 78 3e-13
gi|31196347|ref|XP_307121.1| ENSANGP00000012135 [Anopheles gambi... 78 3e-13
gi|48893630|ref|ZP_00326828.1| COG2319: FOG: WD40 repeat [Tricho... 78 3e-13
gi|49125072|ref|XP_412642.1| hypothetical protein AN8505.2 [Aspe... 78 3e-13
gi|31203713|ref|XP_310805.1| ENSANGP00000014888 [Anopheles gambi... 78 4e-13
gi|38089557|ref|XP_134311.2| katanin p80 (WD40-containing) subun... 78 4e-13
gi|45361545|ref|NP_989349.1| hypothetical protein MGC76247 [Xeno... 78 4e-13
gi|46575873|dbj|BAB88914.2| WD-repeat protein [Burkholderia glumae] 78 4e-13
gi|34853150|ref|XP_342398.1| similar to hypothetical protein [Ra... 78 4e-13
gi|37521199|ref|NP_924576.1| WD-40 repeat protein [Gloeobacter v... 78 4e-13
gi|6714707|emb|CAB66159.1| hypothetical protein [Homo sapiens] 78 4e-13
gi|46120249|ref|ZP_00179648.2| COG2319: FOG: WD40 repeat [Crocos... 78 4e-13
gi|39580327|emb|CAE64482.1| Hypothetical protein CBG09206 [Caeno... 78 4e-13
gi|50416345|gb|AAH77844.1| Unknown (protein for MGC:80538) [Xeno... 78 4e-13
gi|16554627|ref|NP_060058.1| WD repeat domain 5 protein; WD-repe... 78 4e-13
gi|30353827|gb|AAH52124.1| Zgc:76895 protein [Danio rerio] >gnl|... 78 4e-13
gi|50757207|ref|XP_415427.1| PREDICTED: similar to Zgc:56591 pro... 78 4e-13
gi|26329699|dbj|BAC28588.1| unnamed protein product [Mus musculu... 77 5e-13
gi|26327487|dbj|BAC27487.1| unnamed protein product [Mus musculus] 77 5e-13
gi|22972904|ref|ZP_00019756.1| hypothetical protein [Chloroflexu... 77 5e-13
gi|12655011|gb|AAH01353.1| Katanin p80 subunit B 1 [Homo sapiens... 77 5e-13
gi|12845754|dbj|BAB26884.1| unnamed protein product [Mus musculus] 77 5e-13
gi|30584393|gb|AAP36445.1| Homo sapiens katanin p80 (WD40-contai... 77 5e-13
gi|50545019|ref|XP_500061.1| YlTUP1 [Yarrowia lipolytica] >gnl|B... 77 5e-13
gi|10178281|emb|CAC08339.1| katanin p80 subunit-like protein [Ar... 77 6e-13
gi|50554175|ref|XP_504496.1| hypothetical protein [Yarrowia lipo... 77 6e-13
gi|18415801|ref|NP_568194.1| transducin family protein / WD-40 r... 77 6e-13
gi|28279856|gb|AAH44093.1| Nmp200-prov protein [Xenopus laevis] 77 6e-13
gi|15823625|dbj|BAB69057.1| TUWD12 [Homo sapiens] >gnl|BL_ORD_ID... 77 6e-13
gi|37523230|ref|NP_926607.1| WD-40 repeat protein [Gloeobacter v... 77 8e-13
gi|46134549|ref|ZP_00158076.2| COG2319: FOG: WD40 repeat [Anabae... 77 8e-13
gi|11066216|gb|AAG28504.1| TUPA [Emericella nidulans] 77 8e-13
gi|19115471|ref|NP_594559.1| WD-repeat protein [Schizosaccharomy... 77 8e-13
gi|15220302|ref|NP_172582.1| WD-40 repeat family protein / katan... 77 8e-13
gi|46850175|gb|AAT02519.1| unknown [Chlamydomonas reinhardtii] 77 8e-13
gi|49098364|ref|XP_410642.1| hypothetical protein AN6505.2 [Aspe... 77 8e-13
gi|49075508|ref|XP_401814.1| hypothetical protein UM04199.1 [Ust... 77 8e-13
gi|40949819|gb|AAR97571.1| will die slowly [Bombyx mori] 76 1e-12
gi|49076806|ref|XP_402338.1| hypothetical protein UM04723.1 [Ust... 76 1e-12
gi|17864654|ref|NP_524984.1| CG17437-PA [Drosophila melanogaster... 76 1e-12
gi|45525517|ref|ZP_00176748.1| COG2319: FOG: WD40 repeat [Crocos... 76 1e-12
gi|27666788|ref|XP_221406.1| similar to WD repeat domain 5B [Rat... 76 1e-12
gi|23127725|ref|ZP_00109588.1| COG2319: FOG: WD40 repeat [Nostoc... 75 2e-12
gi|47209012|emb|CAF91370.1| unnamed protein product [Tetraodon n... 75 2e-12
gi|17552164|ref|NP_497749.1| WD repeat domain 5B (3E795) [Caenor... 75 2e-12
gi|45544464|emb|CAF34034.1| putative WD-repeat-containing protei... 75 2e-12
gi|21758953|dbj|BAC05425.1| unnamed protein product [Homo sapiens] 75 2e-12
gi|32189425|ref|NP_849143.1| hypothetical protein FLJ25955 [Homo... 75 2e-12
gi|41019302|gb|AAR98560.1| GntN [Micromonospora echinospora] 75 2e-12
gi|23129722|ref|ZP_00111547.1| COG2319: FOG: WD40 repeat [Nostoc... 75 2e-12
gi|39593406|emb|CAE64876.1| Hypothetical protein CBG09688 [Caeno... 75 2e-12
gi|22129772|ref|NP_078808.2| PF20; sperm-associated WD repeat pr... 75 2e-12
gi|39582675|emb|CAE73779.1| Hypothetical protein CBG21324 [Caeno... 75 2e-12
gi|2494901|sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 ... 75 2e-12
gi|38106950|gb|EAA53188.1| hypothetical protein MG07465.4 [Magna... 75 2e-12
gi|47085751|ref|NP_998183.1| zgc:56071 [Danio rerio] >gnl|BL_ORD... 75 2e-12
gi|23199987|ref|NP_061942.2| WD repeat domain 5B [Homo sapiens] ... 75 2e-12
gi|7023854|dbj|BAA92110.1| unnamed protein product [Homo sapiens] 75 2e-12
gi|36958731|gb|AAQ87199.1| Vegetatible incompatibility protein H... 75 3e-12
gi|38344202|emb|CAE05767.2| OSJNBa0064G10.18 [Oryza sativa (japo... 75 3e-12
gi|39597078|emb|CAE59305.1| Hypothetical protein CBG02640 [Caeno... 75 3e-12
gi|20892399|ref|XP_148059.1| expressed sequence AI606931 [Mus mu... 75 3e-12
gi|18139935|gb|AAL60198.1| WD40-repeat-containing protein [Chlam... 75 3e-12
gi|32411159|ref|XP_326060.1| hypothetical protein [Neurospora cr... 74 4e-12
gi|17232051|ref|NP_488599.1| WD-40 repeat-protein [Nostoc sp. PC... 74 4e-12
gi|7446139|pir||S62507 hypothetical trp-asp repeat-containing pr... 74 4e-12
gi|17535023|ref|NP_495285.1| cell division limitator, a SCF ubiq... 74 5e-12
gi|19528447|gb|AAL90338.1| RE19540p [Drosophila melanogaster] 74 5e-12
gi|7505689|pir||T16607 hypothetical protein K10B2.1 - Caenorhabd... 74 5e-12
gi|46130696|ref|XP_389128.1| hypothetical protein FG08952.1 [Gib... 74 5e-12
gi|45506958|ref|ZP_00159306.1| COG2319: FOG: WD40 repeat [Anabae... 74 5e-12
gi|45190337|ref|NP_984591.1| AEL269Cp [Eremothecium gossypii] >g... 74 5e-12
gi|49073338|ref|XP_400895.1| hypothetical protein UM03280.1 [Ust... 74 5e-12
gi|47551119|ref|NP_999734.1| katanin p80 subunit [Strongylocentr... 74 5e-12
gi|45185823|ref|NP_983539.1| ACR137Wp [Eremothecium gossypii] >g... 74 7e-12
gi|3023847|sp|O24076|GBLP_MEDSA Guanine nucleotide-binding prote... 74 7e-12
gi|50409865|ref|XP_456913.1| unnamed protein product [Debaryomyc... 74 7e-12
gi|17137196|ref|NP_477160.1| CG8440-PA [Drosophila melanogaster]... 73 9e-12
gi|3983137|gb|AAC83821.1| Lis1 homolog [Drosophila melanogaster] 73 9e-12
gi|39586585|emb|CAE73712.1| Hypothetical protein CBG21225 [Caeno... 73 9e-12
gi|9759081|dbj|BAB09559.1| unnamed protein product [Arabidopsis ... 73 9e-12
gi|50257175|gb|EAL19888.1| hypothetical protein CNBG0310 [Crypto... 73 9e-12
gi|37535206|ref|NP_921905.1| putative WD-repeat containing prote... 73 9e-12
gi|45508332|ref|ZP_00160671.1| COG2319: FOG: WD40 repeat [Anabae... 73 9e-12
gi|30688991|ref|NP_197734.2| transducin family protein / WD-40 r... 73 9e-12
gi|30688988|ref|NP_851064.1| transducin family protein / WD-40 r... 73 9e-12
gi|23956270|ref|NP_598776.1| F-box and WD-40 domain protein 11; ... 73 1e-11
gi|34534989|dbj|BAC87175.1| unnamed protein product [Homo sapiens] 73 1e-11
gi|2462069|emb|CAA04998.1| vanadium chloroperoxidase [Nostoc sp.... 73 1e-11
gi|29247640|gb|EAA39196.1| GLP_160_23307_22402 [Giardia lamblia ... 73 1e-11
gi|12852956|dbj|BAB29591.1| unnamed protein product [Mus musculu... 73 1e-11
gi|26006203|dbj|BAC41444.1| mKIAA0696 protein [Mus musculus] 73 1e-11
gi|34870632|ref|XP_220281.2| similar to F-box and WD-40 domain p... 73 1e-11
gi|26334549|dbj|BAC30975.1| unnamed protein product [Mus musculus] 73 1e-11
gi|22450205|gb|AAM97148.1| sperm-associated WD repeat protein [M... 73 1e-11
gi|50311135|ref|XP_455591.1| unnamed protein product [Kluyveromy... 72 2e-11
gi|17554220|ref|NP_499755.1| human LISsencephaly gene related (4... 72 2e-11
gi|3023858|sp|Q39836|GBLP_SOYBN Guanine nucleotide-binding prote... 72 2e-11
gi|21326455|ref|NP_647549.1| neuronal differentiation-related ge... 72 2e-11
gi|7507018|pir||T24399 hypothetical protein T03F6.5 - Caenorhabd... 72 2e-11
gi|41393099|ref|NP_958875.1| PRP19/PSO4 homolog; PRP19/PSO4 homo... 72 2e-11
gi|27380596|ref|NP_772125.1| bll5485 [Bradyrhizobium japonicum U... 72 2e-11
gi|50552157|ref|XP_503553.1| hypothetical protein [Yarrowia lipo... 72 2e-11
gi|24640523|ref|NP_572452.1| CG10763-PA [Drosophila melanogaster... 72 2e-11
gi|42562854|ref|NP_176316.3| WD-40 repeat family protein / katan... 72 2e-11
gi|48928050|ref|NP_036432.2| F-box and WD-40 domain protein 1B i... 72 3e-11
gi|48928046|ref|NP_387448.2| F-box and WD-40 domain protein 1B i... 72 3e-11
gi|480009|pir||S36113 LIS-1 protein - human 72 3e-11
gi|2104937|gb|AAC63098.1| truncated form platelet-activating fac... 72 3e-11
gi|50751998|ref|XP_422608.1| PREDICTED: similar to hypothetical ... 72 3e-11
gi|3327206|dbj|BAA31671.1| KIAA0696 protein [Homo sapiens] 72 3e-11
gi|7512942|pir||T17256 hypothetical protein DKFZp586O1922.1 - hu... 72 3e-11
gi|1346110|sp|P49026|GBLP_TOBAC Guanine nucleotide-binding prote... 72 3e-11
gi|7305363|ref|NP_038653.1| platelet-activating factor acetylhyd... 72 3e-11
gi|17056921|gb|AAL34972.1| Miller-Dieker lissencephaly protein [... 72 3e-11
gi|27807199|ref|NP_777088.1| platelet-activating factor acetylhy... 72 3e-11
gi|4557741|ref|NP_000421.1| platelet-activating factor acetylhyd... 72 3e-11
gi|48928048|ref|NP_387449.2| F-box and WD-40 domain protein 1B i... 72 3e-11
gi|21224333|ref|NP_630112.1| putative membrane protein [Streptom... 71 3e-11
gi|48103339|ref|XP_395552.1| similar to TAF5-like RNA polymerase... 71 3e-11
gi|26345812|dbj|BAC36557.1| unnamed protein product [Mus musculus] 71 3e-11
gi|50258634|gb|EAL21321.1| hypothetical protein CNBD3750 [Crypto... 71 3e-11
gi|19527358|ref|NP_598890.1| nuclear matrix protein SNEV [Mus mu... 71 3e-11
gi|7657381|ref|NP_055317.1| PRP19/PSO4 homolog; nuclear matrix p... 71 3e-11
gi|26338912|dbj|BAC33127.1| unnamed protein product [Mus musculus] 71 3e-11
gi|3023851|sp|P93340|GBLP_NICPL Guanine nucleotide-binding prote... 71 3e-11
gi|4589836|dbj|BAA76896.1| LeArcA2 protein [Lycopersicon esculen... 71 3e-11
gi|4589834|dbj|BAA76895.1| LeArcA1 protein [Lycopersicon esculen... 71 3e-11
gi|45383504|ref|NP_989655.1| platelet-activating factor acetylhy... 71 3e-11
gi|12840673|dbj|BAB24913.1| unnamed protein product [Mus musculu... 71 3e-11
gi|48891847|ref|ZP_00325296.1| COG2319: FOG: WD40 repeat [Tricho... 71 3e-11
gi|48893643|ref|ZP_00326841.1| COG2319: FOG: WD40 repeat [Tricho... 71 3e-11
gi|15240710|ref|NP_201533.1| WD-40 repeat family protein [Arabid... 71 3e-11
gi|31198029|ref|XP_307962.1| ENSANGP00000013415 [Anopheles gambi... 71 4e-11
gi|24654584|ref|NP_611261.1| CG10931-PA [Drosophila melanogaster... 70 6e-11
gi|449693|prf||1919424A Miller-Dieker lissencephaly gene 70 6e-11
gi|47210478|emb|CAF90785.1| unnamed protein product [Tetraodon n... 70 6e-11
gi|7446138|pir||T02300 GTP-binding regulatory protein beta chain... 70 6e-11
gi|41152004|ref|NP_958467.1| F-box and WD-40 domain protein 1B [... 70 6e-11
gi|46227426|gb|EAK88361.1| transcription factor TAF5p, TBP assoc... 70 6e-11
gi|47215541|emb|CAG06271.1| unnamed protein product [Tetraodon n... 70 6e-11
gi|47523580|ref|NP_999415.1| platelet-activating factor acetylhy... 70 6e-11
gi|14132774|gb|AAK52334.1| LIS1 [Xenopus laevis] 70 6e-11
gi|46126003|ref|XP_387555.1| PWP2_NEUCR Periodic tryptophan prot... 70 6e-11
gi|30685651|ref|NP_850206.1| transducin family protein / WD-40 r... 70 8e-11
gi|1438062|emb|CAA64560.1| PWP2 [Homo sapiens] 70 8e-11
gi|13471938|ref|NP_103505.1| probable transcriptional repressor ... 70 8e-11
gi|48762926|ref|NP_005040.2| periodic tryptophan protein 2 homol... 70 8e-11
gi|2494898|sp|Q15269|PWP2_HUMAN Periodic tryptophan protein 2 ho... 70 8e-11
gi|5733806|gb|AAD49742.1| G protein beta subunit [Pisum sativum] 70 8e-11
gi|4929352|gb|AAD33959.1| G protein beta subunit [Pisum sativum] 70 8e-11
gi|50292381|ref|XP_448623.1| unnamed protein product [Candida gl... 70 8e-11
gi|30685653|ref|NP_850207.1| transducin family protein / WD-40 r... 70 8e-11
gi|7446126|pir||T16970 GTP-binding protein beta chain homolog - ... 70 8e-11
gi|17738089|ref|NP_524430.1| CG3412-PA [Drosophila melanogaster]... 70 1e-10
gi|2853610|gb|AAC38852.1| Slimb [Drosophila melanogaster] 70 1e-10
gi|50260066|gb|EAL22729.1| hypothetical protein CNBB1770 [Crypto... 70 1e-10
gi|21593440|gb|AAM65407.1| guanine nucleotide-binding protein, p... 70 1e-10
gi|15221916|ref|NP_175296.1| guanine nucleotide-binding family p... 70 1e-10
gi|32404964|ref|XP_323095.1| hypothetical protein ( (AL513466) p... 70 1e-10
gi|45433584|ref|NP_991399.1| hypothetical protein MGC76037 [Xeno... 70 1e-10
gi|38505813|ref|NP_942432.1| WD-repeat protein [Synechocystis sp... 70 1e-10
gi|11875643|gb|AAG40737.1| Bap1 [Myxococcus xanthus] 70 1e-10
gi|48096118|ref|XP_392399.1| similar to CG8440-PA [Apis mellifera] 69 1e-10
gi|39597052|emb|CAE59279.1| Hypothetical protein CBG02611 [Caeno... 69 1e-10
gi|22476946|gb|AAM97354.1| G protein beta subunit [Pisum sativum] 69 1e-10
gi|17551498|ref|NP_509886.1| u5 snRNP-specific protein (XL916) [... 69 1e-10
gi|24210418|emb|CAD54457.1| LIS1 protein [Dictyostelium discoide... 69 1e-10
gi|50080158|ref|NP_001001940.1| coatomer protein complex, subuni... 69 1e-10
gi|47087275|ref|NP_998669.1| zgc:63728 [Danio rerio] >gnl|BL_ORD... 69 1e-10
gi|13173175|gb|AAK14331.1| unknown protein i8 [Aedes aegypti] 69 1e-10
gi|19335618|gb|AAL85578.1| unknown protein [Aedes aegypti] 69 1e-10
gi|13173173|gb|AAK14330.1| unknown protein i8 [Aedes aegypti] 69 1e-10
gi|16117783|ref|NP_378663.1| beta-transducin repeat containing p... 69 1e-10
gi|17555002|ref|NP_498096.1| nuclear matrix protein SNEV (3G260)... 69 1e-10
gi|33357846|pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-B... 69 1e-10
gi|41152231|ref|NP_958503.1| platelet-activating factor acetylhy... 69 1e-10
gi|23574762|dbj|BAC20600.1| platelet activating factor acetylhyd... 69 1e-10
gi|4502477|ref|NP_003930.1| beta-transducin repeat containing pr... 69 1e-10
gi|37535664|ref|NP_922134.1| putative microtubule-severing prote... 69 2e-10
gi|23482009|gb|EAA18121.1| coatomer beta' subunit [Plasmodium yo... 69 2e-10
gi|3023839|sp|P93398|GBB2_TOBAC Guanine nucleotide-binding prote... 69 2e-10
gi|48895484|ref|ZP_00328468.1| COG2319: FOG: WD40 repeat [Tricho... 69 2e-10
gi|14764438|gb|AAK72095.1| F-box/WD40 repeat-containing protein ... 69 2e-10
gi|34851232|ref|XP_214635.2| similar to katanin p80 subunit B 1;... 69 2e-10
gi|37589406|gb|AAH59354.1| MGC69179 protein [Xenopus laevis] 69 2e-10
gi|17566626|ref|NP_505737.1| WD repeat domain 5B (54.5 kD) (5L21... 69 2e-10
gi|18390401|ref|NP_563708.1| transducin family protein / WD-40 r... 69 2e-10
gi|41152229|ref|NP_958502.1| platelet-activating factor acetylhy... 69 2e-10
gi|47212444|emb|CAG11397.1| unnamed protein product [Tetraodon n... 69 2e-10
gi|46439635|gb|EAK98951.1| hypothetical protein CaO19.10786 [Can... 69 2e-10
gi|49091992|ref|XP_407457.1| hypothetical protein AN3320.2 [Aspe... 69 2e-10
gi|24642416|ref|NP_727940.1| CG13956-PA [Drosophila melanogaster... 69 2e-10
gi|19528359|gb|AAL90294.1| LD44201p [Drosophila melanogaster] 69 2e-10
gi|45916042|ref|ZP_00194861.2| COG2319: FOG: WD40 repeat [Mesorh... 69 2e-10
gi|13472512|ref|NP_104079.1| WD-repeart protein, beta transducin... 69 2e-10
gi|50752064|ref|XP_422637.1| PREDICTED: similar to beta prime co... 69 2e-10
gi|17568701|ref|NP_510394.1| WD repeat domain 5B (43.1 kD) (XO96... 69 2e-10
gi|15224356|ref|NP_181905.1| transducin family protein / WD-40 r... 69 2e-10
gi|31241375|ref|XP_321118.1| ENSANGP00000018451 [Anopheles gambi... 69 2e-10
gi|15234752|ref|NP_193325.1| PP1/PP2A phosphatases pleiotropic r... 69 2e-10
gi|21537191|gb|AAM61532.1| PRL1 protein [Arabidopsis thaliana] 69 2e-10
gi|27754713|gb|AAO22800.1| putative PRL1 protein [Arabidopsis th... 69 2e-10
gi|27697187|gb|AAH41755.1| Wu:fc55e05-prov protein [Xenopus laevis] 69 2e-10
gi|28556872|dbj|BAC57516.1| beta-transducin repeat-containing ho... 69 2e-10
gi|49250840|gb|AAH74533.1| Unknown (protein for MGC:69283) [Xeno... 68 3e-10
gi|49086626|ref|XP_405345.1| hypothetical protein AN1208.2 [Aspe... 68 3e-10
gi|17225202|gb|AAL37297.1| beta transducin-like protein HET-E4s ... 68 3e-10
gi|25404314|pir||A96638 hypothetical protein F11P17.7 [imported]... 68 3e-10
gi|50551875|ref|XP_503412.1| hypothetical protein [Yarrowia lipo... 68 3e-10
gi|31210799|ref|XP_314366.1| ENSANGP00000001275 [Anopheles gambi... 68 3e-10
gi|3023841|sp|P93339|GBB_NICPL Guanine nucleotide-binding protei... 68 4e-10
gi|10048265|gb|AAG12330.1| heterotrimeric GTP-binding protein su... 68 4e-10
gi|19113878|ref|NP_592966.1| putative pre-mRNA splicing factor; ... 68 4e-10
gi|17535491|ref|NP_496985.1| trp-asp repeats containing protein ... 68 4e-10
gi|15218190|ref|NP_172998.1| transducin family protein / WD-40 r... 68 4e-10
gi|7492063|pir||T41075 hypothetical WD-repeat protein SPCC16A11.... 68 4e-10
gi|14250255|gb|AAH08552.1| Fbxw11 protein [Mus musculus] 68 4e-10
gi|42571491|ref|NP_973836.1| transducin family protein / WD-40 r... 68 4e-10
gi|15342076|gb|AAH13309.1| Periodic tryptophan protein 2 homolog... 68 4e-10
gi|5103844|gb|AAD39674.1| Strong similarity to gb|X95263 Periodi... 68 4e-10
gi|46130702|ref|XP_389131.1| hypothetical protein FG08955.1 [Gib... 68 4e-10
gi|4455040|gb|AAD21044.1| putative regulatory protein WdlA [Stre... 67 5e-10
gi|31322517|gb|AAP20646.1| nuclear receptor co-repressor complex... 67 5e-10
gi|11055998|ref|NP_067642.1| guanine nucleotide-binding protein,... 67 5e-10
gi|5230822|gb|AAD41025.1| beta-transducin repeat-containing prot... 67 5e-10
gi|31240513|ref|XP_320670.1| ENSANGP00000021164 [Anopheles gambi... 67 5e-10
gi|39584777|emb|CAE67672.1| Hypothetical protein CBG13235 [Caeno... 67 5e-10
gi|19922822|ref|NP_611804.1| CG3957-PA [Drosophila melanogaster]... 67 5e-10
gi|49119215|gb|AAH73215.1| Unknown (protein for MGC:80502) [Xeno... 67 5e-10
gi|15229589|ref|NP_188441.1| guanine nucleotide-binding family p... 67 5e-10
gi|39581518|emb|CAE64254.1| Hypothetical protein CBG08899 [Caeno... 67 5e-10
gi|13661964|gb|AAK38126.1| L344.3 [Leishmania major] 67 5e-10
gi|13445757|gb|AAK26376.1| beta-transducin repeat-containing pro... 67 6e-10
gi|12854841|dbj|BAB30146.1| unnamed protein product [Mus musculus] 67 6e-10
gi|2289095|gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thal... 67 6e-10
gi|50755671|ref|XP_414846.1| PREDICTED: similar to MGC69179 prot... 67 6e-10
gi|19112135|ref|NP_595343.1| WD repeat protein [Schizosaccharomy... 67 6e-10
gi|50730071|ref|XP_416757.1| PREDICTED: similar to periodic tryp... 67 6e-10
gi|47216142|emb|CAG10016.1| unnamed protein product [Tetraodon n... 67 6e-10
gi|4138841|gb|AAD03596.1| G-protein beta subunit GPB1 [Filobasid... 67 6e-10
gi|3023843|sp|Q40687|GBB_ORYSA Guanine nucleotide-binding protei... 67 6e-10
gi|26331128|dbj|BAC29294.1| unnamed protein product [Mus musculus] 67 6e-10
gi|34865864|ref|XP_236595.2| similar to RIKEN cDNA E330026B02 [R... 67 6e-10
gi|486784|pir||S35342 Golgi-associated particle 102K chain - human 67 6e-10
gi|27805865|ref|NP_776706.1| coatomer protein complex, subunit b... 67 6e-10
gi|4758032|ref|NP_004757.1| coatomer protein complex, subunit be... 67 6e-10
gi|29789080|ref|NP_056642.1| coatomer protein complex, subunit b... 67 6e-10
gi|31215008|ref|XP_315945.1| ENSANGP00000013583 [Anopheles gambi... 67 8e-10
gi|38074777|ref|XP_130321.3| RIKEN cDNA 2610014F08 [Mus musculus... 67 8e-10
gi|21356075|ref|NP_649969.1| CG3909-PA [Drosophila melanogaster]... 67 8e-10
gi|39594799|emb|CAE70667.1| Hypothetical protein CBG17375 [Caeno... 67 8e-10
gi|30048137|gb|AAH50792.1| 2610014F08Rik protein [Mus musculus] 67 8e-10
gi|9955107|pdb|1ERJ|A Chain A, Crystal Structure Of The C-Termin... 67 8e-10
gi|49119937|ref|XP_412320.1| hypothetical protein AN8183.2 [Aspe... 67 8e-10
gi|50289957|ref|XP_447410.1| unnamed protein product [Candida gl... 67 8e-10
gi|23613131|ref|NP_703453.1| WD-repeat potein, putative [Plasmod... 67 8e-10
gi|49093204|ref|XP_408063.1| hypothetical protein AN3926.2 [Aspe... 67 8e-10
gi|49115497|gb|AAH73405.1| Unknown (protein for MGC:80868) [Xeno... 67 8e-10
gi|7499046|pir||T16064 hypothetical protein F13H8.2 - Caenorhabd... 66 1e-09
gi|27527767|emb|CAD21857.2| putative heterotrimeric G protein be... 66 1e-09
gi|32822805|gb|AAH54992.1| MGC64565 protein [Xenopus laevis] 66 1e-09
gi|6321301|ref|NP_011378.1| Involved in endoplasmic-to-Golgi pro... 66 1e-09
gi|15227373|ref|NP_181681.1| WD-40 repeat family protein / small... 66 1e-09
gi|23126511|ref|ZP_00108404.1| COG2319: FOG: WD40 repeat [Nostoc... 66 1e-09
gi|17533163|ref|NP_495256.1| transducin protein (103.2 kD) (2G56... 66 1e-09
gi|31231745|ref|XP_318586.1| ENSANGP00000020892 [Anopheles gambi... 66 1e-09
gi|19335616|gb|AAL85577.1| unknown protein [Aedes aegypti] 66 1e-09
gi|50797401|ref|XP_423947.1| PREDICTED: similar to nuclear recep... 66 1e-09
gi|17056923|gb|AAL34973.1| Miller-Dieker lissencephaly protein [... 66 1e-09
gi|6979998|gb|AAF34688.1| putative microtubule severing protein ... 66 1e-09
gi|34855547|ref|XP_345196.1| similar to nuclear receptor co-repr... 66 1e-09
gi|47215488|emb|CAG01596.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|45184880|ref|NP_982598.1| AAR057Wp [Eremothecium gossypii] >g... 66 1e-09
gi|15236122|ref|NP_195172.1| guanine nucleotide-binding protein ... 66 1e-09
gi|13591874|ref|NP_112249.1| guanine nucleotide-binding protein,... 66 1e-09
gi|30794128|gb|AAP40506.1| putative small nuclear ribonucleoprot... 66 1e-09
gi|47222782|emb|CAG01749.1| unnamed protein product [Tetraodon n... 66 1e-09
gi|50294067|ref|XP_449445.1| unnamed protein product [Candida gl... 66 1e-09
gi|42570167|ref|NP_849494.2| guanine nucleotide-binding protein ... 66 1e-09
gi|41053421|ref|NP_956616.1| similar to U5 snRNP-specific 40 kDa... 66 1e-09
gi|42573173|ref|NP_974683.1| guanine nucleotide-binding protein ... 66 1e-09
gi|12006108|gb|AAG44738.1| IRA1 [Mus musculus] 66 1e-09
gi|10434648|dbj|BAB14331.1| unnamed protein product [Homo sapiens] 66 1e-09
gi|31543001|ref|NP_109657.2| IRA1 protein [Mus musculus] >gnl|BL... 66 1e-09
gi|19913371|ref|NP_078941.2| nuclear receptor co-repressor/HDAC3... 66 1e-09
gi|31228182|ref|XP_318012.1| ENSANGP00000010744 [Anopheles gambi... 66 1e-09
gi|24652561|ref|NP_610618.1| CG12325-PA [Drosophila melanogaster... 65 2e-09
gi|21539573|gb|AAM53339.1| WD40-repeat protein [Arabidopsis thal... 65 2e-09
gi|30686005|ref|NP_568338.2| transducin family protein / WD-40 r... 65 2e-09
gi|20810487|gb|AAH29520.1| WDSAM1 protein [Homo sapiens] 65 2e-09
gi|49073067|ref|XP_400779.1| hypothetical protein UM03164.1 [Ust... 65 2e-09
gi|22749103|ref|NP_689741.1| WD repeat and SAM domain containing... 65 2e-09
gi|15810485|gb|AAL07130.1| putative WD40-repeat protein [Arabido... 65 2e-09
gi|50313334|gb|AAT74567.1| guanine nucleotide binding protein be... 65 2e-09
gi|3023859|sp|Q40507|GBB3_TOBAC Guanine nucleotide-binding prote... 65 2e-09
gi|38108877|gb|EAA54825.1| hypothetical protein MG05616.4 [Magna... 65 2e-09
gi|23124911|ref|ZP_00106869.1| COG2319: FOG: WD40 repeat [Nostoc... 65 2e-09
gi|23126612|ref|ZP_00108502.1| COG2319: FOG: WD40 repeat [Nostoc... 65 2e-09
gi|45360769|ref|NP_989058.1| hypothetical protein MGC75813 [Xeno... 65 2e-09
gi|12006104|gb|AAG44736.1| IRA1 [Homo sapiens] 65 2e-09
>gi|17509347|ref|NP_492169.1| TBP-Associated transcription Factor
family member (taf-5) [Caenorhabditis elegans]
gi|7500201|pir||T21580 hypothetical protein F30F8.8 - Caenorhabditis
elegans
gi|3876493|emb|CAB03035.1| Hypothetical protein F30F8.8
[Caenorhabditis elegans]
gi|3879143|emb|CAB05603.1| Hypothetical protein F30F8.8
[Caenorhabditis elegans]
Length = 645
Score = 682 bits (1759), Expect = 0.0
Identities = 336/336 (100%), Positives = 336/336 (100%)
Frame = +1
Query: 1 ICMYTTVNAPIGVASCDFTDDSSLIAMGLSDSSIVMNAMDPMNKMKKLRDMEFLDKIDIE 180
ICMYTTVNAPIGVASCDFTDDSSLIAMGLSDSSIVMNAMDPMNKMKKLRDMEFLDKIDIE
Sbjct: 310 ICMYTTVNAPIGVASCDFTDDSSLIAMGLSDSSIVMNAMDPMNKMKKLRDMEFLDKIDIE 369
Query: 181 TADNVQSQMFDLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNA 360
TADNVQSQMFDLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNA
Sbjct: 370 TADNVQSQMFDLQGSTTSVRYTGHGGPVFSVNFSPDRRLLISSAGDRTVRLWSMETQRNA 429
Query: 361 VIYRTPAVAQFCSRGYYFATASADKTAAMWSTDRMHPLRIFADPYGDVGCIDYHPNCNYI 540
VIYRTPAVAQFCSRGYYFATASADKTAAMWSTDRMHPLRIFADPYGDVGCIDYHPNCNYI
Sbjct: 430 VIYRTPAVAQFCSRGYYFATASADKTAAMWSTDRMHPLRIFADPYGDVGCIDYHPNCNYI 489
Query: 541 AGGSDDRYVRVWDVCSGTRVRIFSGHKASIIAVKFSPCGRYIVSLDAIGNLMIWDLAYQR 720
AGGSDDRYVRVWDVCSGTRVRIFSGHKASIIAVKFSPCGRYIVSLDAIGNLMIWDLAYQR
Sbjct: 490 AGGSDDRYVRVWDVCSGTRVRIFSGHKASIIAVKFSPCGRYIVSLDAIGNLMIWDLAYQR 549
Query: 721 LVAAEITEQAGTKGSITFSRDGGVFAVSHGNSSIQLYSLDTLIGTVLAAGQNDSYIEPKV 900
LVAAEITEQAGTKGSITFSRDGGVFAVSHGNSSIQLYSLDTLIGTVLAAGQNDSYIEPKV
Sbjct: 550 LVAAEITEQAGTKGSITFSRDGGVFAVSHGNSSIQLYSLDTLIGTVLAAGQNDSYIEPKV 609
Query: 901 NLDGFNIGSYATKETAVIGLHFTRRNLLLGFGCFGQ 1008
NLDGFNIGSYATKETAVIGLHFTRRNLLLGFGCFGQ
Sbjct: 610 NLDGFNIGSYATKETAVIGLHFTRRNLLLGFGCFGQ 645