Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R05H5_5
(450 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17535459|ref|NP_496200.1| thioredoxin family member (17.3 kD)... 312 8e-85
gi|39589121|emb|CAE57854.1| Hypothetical protein CBG00891 [Caeno... 259 6e-69
gi|39595082|emb|CAE60119.1| Hypothetical protein CBG03662 [Caeno... 210 4e-54
gi|17537401|ref|NP_494757.1| thioredoxin family member (2E596) [... 209 1e-53
gi|39580153|emb|CAE56273.1| Hypothetical protein CBG23918 [Caeno... 153 6e-37
gi|17539056|ref|NP_500478.1| thioredoxin family member (17.0 kD)... 150 4e-36
gi|39587621|emb|CAE58559.1| Hypothetical protein CBG01721 [Caeno... 148 3e-35
gi|14550374|gb|AAK67231.1| Hypothetical protein F29B9.5 [Caenorh... 146 7e-35
gi|17532245|ref|NP_495275.1| thioredoxin family member (2G632) [... 137 6e-32
gi|7500138|pir||T29930 hypothetical protein F29B9.5 - Caenorhabd... 135 2e-31
gi|39597070|emb|CAE59297.1| Hypothetical protein CBG02632 [Caeno... 132 1e-30
gi|45861991|gb|AAS78778.1| thioredoxin [Ascaris suum] 131 3e-30
gi|17564492|ref|NP_503954.1| predicted CDS, thioredoxin family m... 129 1e-29
gi|47219909|emb|CAF97179.1| unnamed protein product [Tetraodon n... 122 2e-27
gi|7505193|pir||T33313 hypothetical protein K02H11.6 - Caenorhab... 119 1e-26
gi|25153934|ref|NP_503440.2| predicted CDS, thioredoxin family m... 119 1e-26
gi|49256203|gb|AAH71162.1| Unknown (protein for MGC:83491) [Xeno... 119 1e-26
gi|17541496|ref|NP_500578.1| thioredoxin family member (4F253) [... 117 6e-26
gi|39587599|emb|CAE58537.1| Hypothetical protein CBG01696 [Caeno... 116 8e-26
gi|32452987|gb|AAB09142.2| Hypothetical protein M01H9.1 [Caenorh... 116 1e-25
gi|21436483|gb|AAM51563.1| thioredoxin [Brugia malayi] >gnl|BL_O... 115 1e-25
gi|23598164|gb|AAN34968.1| thioredoxin; wb-Thioredoxin [Wucherer... 115 2e-25
gi|23598166|gb|AAN34969.1| thioredoxin 1; ov-thioredoxin 1 [Onch... 114 4e-25
gi|19698793|gb|AAL91107.1| thioredoxin [Brugia malayi] 112 1e-24
gi|23598162|gb|AAN34967.1| thioredoxin 2; ov-thioredoxin 2 [Onch... 111 3e-24
gi|31415911|gb|AAP50932.1| putative trypanothione-dependent pero... 107 5e-23
gi|17564844|ref|NP_503892.1| predicted CDS, thioredoxin (5D726) ... 107 7e-23
gi|32563627|ref|NP_492564.2| putative nuclear protein family mem... 102 2e-21
gi|7507212|pir||T24545 hypothetical protein T05F1.11 - Caenorhab... 102 2e-21
gi|34874056|ref|XP_344575.1| similar to RIKEN cDNA 4930519N16 [R... 102 2e-21
gi|22165362|ref|NP_083449.1| RIKEN cDNA 4930519N16 [Mus musculus... 101 3e-21
gi|21592996|gb|AAM64945.1| PDI-like protein [Arabidopsis thaliana] 100 5e-21
gi|18406743|ref|NP_564756.1| DC1 domain-containing protein [Arab... 100 5e-21
gi|31415915|gb|AAP50936.1| putative trypanothione-dependent pero... 100 1e-20
gi|23304737|emb|CAC87937.1| PDI-like protein [Quercus suber] 97 7e-20
gi|41393676|gb|AAS02080.1| protein disulfide isomerase [Quercus ... 97 7e-20
gi|4056568|gb|AAD04231.1| PDI-like protein [Zea mays] 96 1e-19
gi|17538896|ref|NP_503101.1| thioredoxin family member (20.1 kD)... 95 3e-19
gi|13435627|gb|AAH04688.1| Nxn protein [Mus musculus] 92 2e-18
gi|6679160|ref|NP_032776.1| nucleoredoxin [Mus musculus] >gnl|BL... 92 2e-18
gi|17506685|ref|NP_493308.1| putative cytoplasmic protein family... 92 3e-18
gi|34872883|ref|XP_340858.1| similar to red-1 [Rattus norvegicus] 91 6e-18
gi|38567893|emb|CAE03648.2| OSJNBa0060N03.13 [Oryza sativa (japo... 90 8e-18
gi|48141594|ref|XP_397245.1| similar to red-1 [Apis mellifera] 90 8e-18
gi|33991273|gb|AAH09327.2| NXN protein [Homo sapiens] 89 1e-17
gi|33149331|ref|NP_071908.2| nucleoredoxin; nucleoredoxin 1 [Hom... 89 1e-17
gi|49522545|gb|AAH73845.1| NXN protein [Homo sapiens] 89 1e-17
gi|49256234|gb|AAH74275.1| Unknown (protein for MGC:84045) [Xeno... 89 2e-17
gi|39585201|emb|CAE57444.1| Hypothetical protein CBG00406 [Caeno... 89 2e-17
gi|50758318|ref|XP_415863.1| PREDICTED: similar to red-1 [Gallus... 89 2e-17
gi|8569430|pdb|1EZK|A Chain A, Crystal Structure Of Recombinant ... 87 9e-17
gi|8569420|pdb|1EWX|A Chain A, Crystal Structure Of Native Trypa... 87 9e-17
gi|8569320|pdb|1QK8|A Chain A, Tryparedoxin-I From Crithidia Fas... 87 9e-17
gi|34810146|pdb|1OKD|A Chain A, Nmr-Structure Of Tryparedoxin 1 87 9e-17
gi|44889410|gb|AAS48350.1| tryparedoxin [Leishmania infantum] 83 1e-15
gi|30749849|pdb|1O8X|A Chain A, Mutant Tryparedoxin-I Cys43ala 83 1e-15
gi|6175375|gb|AAF04973.1| tryparedoxin [Trypanosoma cruzi] 82 2e-15
gi|44889412|gb|AAS48351.1| mitochondrial tryparedoxin [Leishmani... 82 2e-15
gi|34908844|ref|NP_915769.1| PDI-like protein [Oryza sativa (jap... 82 3e-15
gi|50796126|ref|XP_423839.1| PREDICTED: similar to RIKEN cDNA 49... 80 9e-15
gi|27066375|pdb|1O6J|A Chain A, Tryparedoxin Ii From C.Fascicula... 80 1e-14
gi|29726921|pdb|1OC9|A Chain A, Tryparedoxin Ii From C.Fascicula... 80 1e-14
gi|27574271|pdb|1O81|A Chain A, Tryparedoxin Ii From C.Fascicula... 80 1e-14
gi|3676476|gb|AAC61984.1| tryparedoxin II [Crithidia fasciculata] 80 1e-14
gi|41018378|sp|O77404|TYPX_TRYBB Tryparedoxin >gnl|BL_ORD_ID|643... 80 1e-14
gi|14278309|pdb|1FG4|A Chain A, Structure Of Tryparedoxin Ii >gn... 80 1e-14
gi|18417767|ref|NP_567869.1| expressed protein [Arabidopsis thal... 79 2e-14
gi|19923987|ref|NP_612463.1| hypothetical protein BC014127; rod-... 77 7e-14
gi|19171158|emb|CAC85916.1| tryparedoxin [Trypanosoma cruzi] 76 1e-13
gi|13787131|pdb|1I5G|A Chain A, Tryparedoxin Ii Complexed With G... 76 2e-13
gi|21704204|ref|NP_663573.1| thioredoxin-like 6 [Mus musculus] >... 75 4e-13
gi|50794394|ref|XP_423688.1| PREDICTED: similar to RIKEN cDNA A9... 75 4e-13
gi|34877784|ref|XP_224718.2| similar to hypothetical protein BC0... 74 8e-13
gi|28626437|gb|AAO44001.1| tryparedoxin [Trypanosoma cruzi] >gnl... 73 1e-12
gi|7486675|pir||T04491 hypothetical protein F8F16.60 - Arabidops... 73 1e-12
gi|28626435|gb|AAO44000.1| tryparedoxin [Trypanosoma cruzi] 73 1e-12
gi|16740634|gb|AAH16199.1| 4930519N16Rik protein [Mus musculus] 72 2e-12
gi|34908848|ref|NP_915771.1| PDI-like protein [Oryza sativa (jap... 71 4e-12
gi|21699084|ref|NP_660326.1| chromosome 9 open reading frame 121... 67 1e-10
gi|47223917|emb|CAG06094.1| unnamed protein product [Tetraodon n... 62 2e-09
gi|23957713|ref|NP_705844.1| thioredoxin-like redox-active prote... 62 3e-09
gi|7488267|pir||T04492 protein kinase homolog F8F16.70 - Arabido... 57 6e-08
gi|48854964|ref|ZP_00309124.1| COG0526: Thiol-disulfide isomeras... 55 2e-07
gi|14578300|gb|AAF99466.1| PV1H14100_P [Plasmodium vivax] 55 3e-07
gi|48861343|ref|ZP_00315246.1| COG0526: Thiol-disulfide isomeras... 55 3e-07
gi|23479713|gb|EAA16465.1| thioredoxin-like redox-active protein... 54 5e-07
gi|21673898|ref|NP_661963.1| thiol:disulfide interchange protein... 54 7e-07
gi|47223916|emb|CAG06093.1| unnamed protein product [Tetraodon n... 53 1e-06
gi|23099277|ref|NP_692743.1| cytochrome c biogenesis [Oceanobaci... 51 4e-06
gi|47227788|emb|CAG08951.1| unnamed protein product [Tetraodon n... 50 1e-05
gi|39794699|gb|AAH63828.1| NXN protein [Homo sapiens] 49 2e-05
gi|13358154|ref|NP_078428.1| thioredoxin [Ureaplasma parvum sero... 49 3e-05
gi|29346702|ref|NP_810205.1| thiol:disulfide interchange protein... 48 4e-05
gi|46576014|gb|AAT01375.1| unknown protein [Oryza sativa (japoni... 48 4e-05
gi|34541283|ref|NP_905762.1| thioredoxin family protein [Porphyr... 47 8e-05
gi|44004529|ref|NP_982197.1| cytochrome c biogenesis protein, pu... 47 1e-04
gi|16078448|ref|NP_389267.1| ykvV [Bacillus subtilis subsp. subt... 47 1e-04
gi|46106470|ref|ZP_00187298.2| COG0526: Thiol-disulfide isomeras... 46 1e-04
gi|47227790|emb|CAG08953.1| unnamed protein product [Tetraodon n... 46 2e-04
gi|15615431|ref|NP_243734.1| thiol/disulfide interchange protein... 46 2e-04
gi|22035894|emb|CAD43149.1| putative PDI-like protein [Toxoplasm... 46 2e-04
gi|42524350|ref|NP_969730.1| thiol:disulfide interchange protein... 46 2e-04
gi|48853637|ref|ZP_00307805.1| COG0526: Thiol-disulfide isomeras... 45 2e-04
gi|24371867|ref|NP_715909.1| thioredoxin, putative [Shewanella o... 45 3e-04
gi|21399393|ref|NP_655378.1| AhpC-TSA, AhpC/TSA family [Bacillus... 45 3e-04
gi|30019621|ref|NP_831252.1| ResA protein [Bacillus cereus ATCC ... 45 3e-04
gi|46579997|ref|YP_010805.1| thioredoxin family protein [Desulfo... 45 4e-04
gi|32474228|ref|NP_867222.1| probable thioredoxin related protei... 45 4e-04
gi|34395959|sp|P35160|RESA_BACSU Thiol-disulfide oxidoreductase ... 44 5e-04
gi|16079372|ref|NP_390196.1| essential protein similar to cytoch... 44 5e-04
gi|49259146|pdb|1ST9|A Chain A, Crystal Structure Of A Soluble D... 44 5e-04
gi|38100664|gb|EAA47763.1| hypothetical protein MG03006.4 [Magna... 44 7e-04
gi|48862666|ref|ZP_00316561.1| COG0526: Thiol-disulfide isomeras... 44 7e-04
gi|30021713|ref|NP_833344.1| Thiol:disulfide interchange protein... 44 7e-04
gi|47575097|ref|ZP_00245132.1| COG0526: Thiol-disulfide isomeras... 44 7e-04
gi|16877842|gb|AAH17153.1| Txnl6 protein [Mus musculus] 44 9e-04
gi|11135312|sp|Q96419|THIH_FAGES Thioredoxin H-type (TRX-H) >gnl... 44 9e-04
gi|34580538|ref|ZP_00142018.1| thiol:disulfide interchange prote... 44 9e-04
gi|14578634|gb|AAK68923.1| putative protein disulfide isomerase ... 44 9e-04
gi|21222859|ref|NP_628638.1| putative secreted protein [Streptom... 43 0.001
gi|15605725|ref|NP_213102.1| thiol disulfide interchange protein... 43 0.001
gi|15892467|ref|NP_360181.1| thiol:disulfide interchange protein... 43 0.001
gi|6319498|ref|NP_009580.1| Originally identified as a multicopy... 43 0.002
gi|39996423|ref|NP_952374.1| thioredoxin family protein [Geobact... 43 0.002
gi|23978434|dbj|BAC21264.1| thioredoxin h [Cucurbita maxima] 43 0.002
gi|23099137|ref|NP_692603.1| cytochrome c biogenesis [Oceanobaci... 43 0.002
gi|42782682|ref|NP_979929.1| ahpC/TSA family protein [Bacillus c... 43 0.002
gi|22970655|ref|ZP_00017705.1| hypothetical protein [Chloroflexu... 42 0.002
gi|15614140|ref|NP_242443.1| cytochrome c biogenesis (thioredoxi... 42 0.002
gi|23480906|gb|EAA17344.1| PDI-like protein-related [Plasmodium ... 42 0.002
gi|29831341|ref|NP_825975.1| hypothetical protein SAV4798 [Strep... 42 0.003
gi|47567895|ref|ZP_00238602.1| thioredoxin family protein [Bacil... 42 0.003
gi|29251147|gb|EAA42631.1| GLP_487_80448_80047 [Giardia lamblia ... 41 0.004
gi|48845548|ref|ZP_00299826.1| COG0526: Thiol-disulfide isomeras... 41 0.004
gi|42521808|ref|NP_967188.1| thioredoxin [Bdellovibrio bacteriov... 41 0.004
gi|29345576|ref|NP_809079.1| putative thiol-disulfide isomerase ... 41 0.004
gi|34556527|ref|NP_906342.1| PUTATIVE LIPOPROTEIN THIREDOXIN [Wo... 41 0.004
gi|24373660|ref|NP_717703.1| thioredoxin family protein [Shewane... 41 0.006
gi|21673850|ref|NP_661915.1| thiol:disulfide interchange protein... 41 0.006
gi|19879581|gb|AAL68889.1| thioredoxin; SoxW [Chlorobium limicola] 41 0.006
gi|17986371|ref|NP_539005.1| THIOL:DISULFIDE INTERCHANGE PROTEIN... 41 0.006
gi|45656182|ref|YP_000268.1| thioredoxin-like protein [Leptospir... 41 0.006
gi|24213020|ref|NP_710501.1| Thiol-disulfide isomerase and thior... 41 0.006
gi|23943824|ref|NP_705739.1| thioredoxin domain containing 2 (sp... 40 0.007
gi|38173919|gb|AAH60981.1| Txndc2 protein [Mus musculus] 40 0.007
gi|18309723|ref|NP_561657.1| probable cytochrome C-type biogenes... 40 0.007
gi|23502828|ref|NP_698955.1| thiol:disulfide interchange protein... 40 0.007
gi|16078864|ref|NP_389684.1| yneN [Bacillus subtilis subsp. subt... 40 0.007
gi|21674040|ref|NP_662105.1| thioredoxin [Chlorobium tepidum TLS... 40 0.010
gi|23613711|ref|NP_704732.1| hypothetical protein [Plasmodium fa... 40 0.010
gi|11135282|sp|Q43636|THIH_RICCO Thioredoxin H-type (TRX-H) >gnl... 40 0.010
gi|47215756|emb|CAG05767.1| unnamed protein product [Tetraodon n... 40 0.010
gi|21401535|ref|NP_657520.1| AhpC-TSA, AhpC/TSA family [Bacillus... 40 0.010
gi|48861502|ref|ZP_00315403.1| COG0526: Thiol-disulfide isomeras... 40 0.010
gi|49481052|ref|YP_035690.1| thiol-disulfide oxidoreductase [Bac... 40 0.010
gi|42780672|ref|NP_977919.1| resA protein [Bacillus cereus ATCC ... 40 0.010
gi|34877964|ref|XP_237591.2| similar to spermatid-specific thior... 40 0.013
gi|6687568|emb|CAB65014.1| thioredoxin (TRX) [Fasciola hepatica] 40 0.013
gi|6492215|gb|AAF14217.1| thioredoxin [Fasciola hepatica] 40 0.013
gi|19703445|ref|NP_603007.1| Thioredoxin [Fusobacterium nucleatu... 40 0.013
gi|15900873|ref|NP_345477.1| thioredoxin family protein [Strepto... 40 0.013
gi|15902948|ref|NP_358498.1| Conserved hypothetical protein [Str... 40 0.013
gi|46113775|ref|ZP_00200900.1| COG0526: Thiol-disulfide isomeras... 40 0.013
gi|15223645|ref|NP_173403.1| thioredoxin H-type 4 (TRX-H-4) (GRE... 39 0.017
gi|21617968|gb|AAM67018.1| thioredoxin [Arabidopsis thaliana] 39 0.017
gi|3915131|sp|Q42443|THIH_ORYSA Thioredoxin H-type (TRX-H) (Phlo... 39 0.017
gi|2117426|pir||S58119 thioredoxin (clone GREN) - Arabidopsis th... 39 0.017
gi|1388082|gb|AAC49355.1| thioredoxin h 39 0.017
gi|33864816|ref|NP_896375.1| thioredoxin-like protein TxlA [Syne... 39 0.022
gi|19851972|gb|AAL99941.1| thioredoxin H [Populus tremula x Popu... 39 0.022
gi|15239136|ref|NP_199112.1| thioredoxin H-type 3 (TRX-H-3) (GIF... 39 0.022
gi|21223797|ref|NP_629576.1| thioredoxin [Streptomyces coelicolo... 39 0.022
gi|23098307|ref|NP_691773.1| cytochrome c biogenesis [Oceanobaci... 39 0.022
gi|24215011|ref|NP_712492.1| thioredoxin [Leptospira interrogans... 39 0.022
gi|47569146|ref|ZP_00239834.1| thiol:disulfide interchange prote... 39 0.022
gi|50553760|ref|XP_504291.1| hypothetical protein [Yarrowia lipo... 39 0.028
gi|48730629|ref|ZP_00264376.1| COG0526: Thiol-disulfide isomeras... 39 0.028
gi|14485509|emb|CAC42084.1| thioredoxin h [Pisum sativum] 39 0.028
gi|21402738|ref|NP_658723.1| thiored, Thioredoxin [Bacillus anth... 39 0.028
gi|15219537|ref|NP_175128.1| thioredoxin H-type 5 (TRX-H-5) (TOU... 39 0.028
gi|267115|sp|P29446|THI2_DICDI Thioredoxin 2 >gnl|BL_ORD_ID|8679... 39 0.028
gi|47565119|ref|ZP_00236162.1| thioredoxin [Bacillus cereus G924... 39 0.028
gi|1388084|gb|AAC49356.1| thioredoxin h 39 0.028
gi|21757496|dbj|BAC05133.1| unnamed protein product [Homo sapiens] 39 0.028
gi|32475489|ref|NP_868483.1| probable thioredoxin [Pirellula sp.... 39 0.028
gi|46191650|ref|ZP_00206922.1| COG0526: Thiol-disulfide isomeras... 38 0.037
gi|48831057|ref|ZP_00288139.1| COG0526: Thiol-disulfide isomeras... 38 0.037
gi|11362710|pir||T50864 thioredoxin-like protein [imported] - Ho... 38 0.037
gi|11362711|pir||T50862 thioredoxin-like protein [imported] - Ph... 38 0.037
gi|11358957|pir||T50865 thioredoxin-like protein [imported] - pe... 38 0.037
gi|1085952|pir||S49352 protein S1 - Phalaris coerulescens 38 0.037
gi|42783882|ref|NP_981129.1| thioredoxin family protein [Bacillu... 38 0.037
gi|15924734|ref|NP_372268.1| thioredoxin homolog [Staphylococcus... 38 0.037
gi|29346993|ref|NP_810496.1| putative protein disulfide isomeras... 38 0.037
gi|30575686|gb|AAP33009.1| thioredoxin H [Citrus x paradisi] 38 0.037
gi|16080036|ref|NP_390862.1| ytpP [Bacillus subtilis subsp. subt... 38 0.037
gi|18309721|ref|NP_561655.1| thioredoxin [Clostridium perfringen... 38 0.037
gi|17509965|ref|NP_491142.1| thioredoxin (1D888) [Caenorhabditis... 38 0.037
gi|34763779|ref|ZP_00144695.1| Thioredoxin [Fusobacterium nuclea... 38 0.037
gi|29346397|ref|NP_809900.1| putative cytochrome C-type biogenes... 38 0.037
gi|1086147|pir||S49353 protein S2 - Phalaris coerulescens 38 0.037
gi|48845155|ref|ZP_00299442.1| COG0526: Thiol-disulfide isomeras... 38 0.037
gi|30249298|ref|NP_841368.1| Thioredoxin [Nitrosomonas europaea ... 38 0.048
gi|15988313|pdb|1JFU|A Chain A, Crystal Structure Of The Soluble... 38 0.048
gi|27376491|ref|NP_768020.1| thioredoxin-like protein [Bradyrhiz... 38 0.048
gi|42519542|ref|NP_965472.1| thioredoxin [Lactobacillus johnsoni... 38 0.048
gi|11135265|sp|Q39362|THH2_BRANA Thioredoxin H-type 2 (TRX-H-2) ... 38 0.048
gi|27367008|ref|NP_762535.1| Thiol-disulfide isomerase [Vibrio v... 38 0.048
gi|34540820|ref|NP_905299.1| thioredoxin family protein [Porphyr... 38 0.048
gi|23007581|ref|ZP_00049389.1| COG0526: Thiol-disulfide isomeras... 38 0.048
gi|46359877|gb|AAS88809.1| putative thioredoxin h [Oryza sativa ... 37 0.063
gi|24637229|gb|AAN63618.1| thioredoxin h-like protein [Oryza sat... 37 0.063
gi|46198796|ref|YP_004463.1| thiol:disulfide interchange protein... 37 0.063
gi|15639094|ref|NP_218540.1| thioredoxin, putative [Treponema pa... 37 0.063
gi|33595920|ref|NP_883563.1| putative thiol:disulfide interchang... 37 0.063
gi|33601302|ref|NP_888862.1| putative thiol:disulfide interchang... 37 0.063
gi|30580603|sp|O96952|THIO_GEOCY Thioredoxin >gnl|BL_ORD_ID|1666... 37 0.063
gi|7481798|pir||T42061 thioredoxin - Streptomyces coelicolor >gn... 37 0.063
gi|29830849|ref|NP_825483.1| putative thioredoxin [Streptomyces ... 37 0.063
gi|11494247|gb|AAG35777.1| thioredoxin-h-like protein 1 [Brassic... 37 0.063
gi|11135277|sp|Q42388|THH1_BRANA Thioredoxin H-type 1 (TRX-H-1) ... 37 0.063
gi|27461140|gb|AAL67139.1| thioredoxin H [Triticum aestivum] 37 0.063
gi|21222296|ref|NP_628075.1| thioredoxin [Streptomyces coelicolo... 37 0.063
gi|4100188|gb|AAD00775.1| thioredoxin [Treponema pallidum] 37 0.063
gi|15805374|ref|NP_294068.1| cytochrome c biogenesis protein, th... 37 0.063
gi|16588843|gb|AAL26915.1| thioredoxin H [Prunus persica] 37 0.083
gi|46317426|ref|ZP_00218004.1| COG0526: Thiol-disulfide isomeras... 37 0.083
gi|24637225|gb|AAN63616.1| thioredoxin h-like protein [Hordeum v... 37 0.083
gi|27543511|gb|AAO16555.1| thioredoxin h [Leymus chinensis] 37 0.083
gi|11135129|sp|O64432|THIH_BRARA Thioredoxin H-type (TRX-H) >gnl... 37 0.083
gi|11358964|pir||T50867 thioredoxin-like protein [imported] - ry... 37 0.083
gi|18874552|gb|AAL79841.1| thioredoxin [Schistosoma mansoni] 37 0.083
gi|20140734|sp|Q98TX1|THIO_OPHHA Thioredoxin >gnl|BL_ORD_ID|7088... 37 0.083
gi|42523669|ref|NP_969049.1| cytochrome c biogenesis (thioredoxi... 37 0.083
gi|15891342|ref|NP_357014.1| AGR_L_2458p [Agrobacterium tumefaci... 37 0.083
gi|15231958|ref|NP_187483.1| thioredoxin family protein [Arabido... 37 0.083
gi|25405885|pir||G96509 protein F27F5.21 [imported] - Arabidopsi... 37 0.11
gi|39998369|ref|NP_954320.1| thioredoxin-related protein [Geobac... 37 0.11
gi|19704458|ref|NP_604020.1| Thioredoxin-like protein [Fusobacte... 37 0.11
gi|24637227|gb|AAN63617.1| thioredoxin h-like protein [Zea mays] 37 0.11
gi|45517156|ref|ZP_00168708.1| COG0526: Thiol-disulfide isomeras... 37 0.11
gi|32477575|ref|NP_870569.1| probable thioredoxin [Pirellula sp.... 37 0.11
gi|49480308|ref|YP_035959.1| thioredoxin family protein [Bacillu... 37 0.11
gi|42780922|ref|NP_978169.1| thioredoxin family protein [Bacillu... 37 0.11
gi|41406499|ref|NP_959335.1| hypothetical protein MAP0401 [Mycob... 37 0.11
gi|39598293|emb|CAE68986.1| Hypothetical protein CBG14970 [Caeno... 37 0.11
gi|15615815|ref|NP_244119.1| thioredoxin H1 [Bacillus halodurans... 37 0.11
gi|16077267|ref|NP_388080.1| ybdE [Bacillus subtilis subsp. subt... 37 0.11
gi|32475862|ref|NP_868856.1| probable FixW protein [Pirellula sp... 37 0.11
gi|48767644|ref|ZP_00271998.1| COG0526: Thiol-disulfide isomeras... 37 0.11
gi|29348827|ref|NP_812330.1| putative thiol:disulfide interchang... 36 0.14
gi|24372005|ref|NP_716047.1| hypothetical protein SO0409 [Shewan... 36 0.14
gi|29477099|gb|AAH50132.1| Thioredoxin domain-containing 2 [Homo... 36 0.14
gi|42516570|ref|NP_115619.4| thioredoxin domain-containing 2; sp... 36 0.14
gi|24637231|gb|AAN63619.1| thioredoxin h-like protein [Nicotiana... 36 0.14
gi|34498208|ref|NP_902423.1| probable disulphide-isomerase [Chro... 36 0.14
gi|14906096|gb|AAK72483.1| thioredoxin [Branchiostoma belcheri] 36 0.14
gi|12053003|emb|CAB66676.1| hypothetical protein [Homo sapiens] 36 0.14
gi|267116|sp|P29447|THI3_DICDI Thioredoxin 3 >gnl|BL_ORD_ID|9021... 36 0.14
gi|45917036|ref|ZP_00196138.2| COG0526: Thiol-disulfide isomeras... 36 0.14
gi|46187898|ref|ZP_00126367.2| COG0526: Thiol-disulfide isomeras... 36 0.14
gi|17648013|ref|NP_523526.1| CG31884-PA [Drosophila melanogaster... 36 0.14
gi|48767047|ref|ZP_00271413.1| COG0526: Thiol-disulfide isomeras... 36 0.18
gi|29348731|ref|NP_812234.1| putative thioredoxin family protein... 36 0.18
gi|50797549|ref|XP_423953.1| PREDICTED: similar to RIKEN cDNA 24... 36 0.18
gi|15608815|ref|NP_216193.1| dsbF [Mycobacterium tuberculosis H3... 36 0.18
gi|24158968|pdb|1M7T|A Chain A, Solution Structure And Dynamics ... 36 0.18
gi|32186040|gb|AAP72290.1| thioredoxin h isoform 1; HvTrxh1 [Hor... 36 0.18
gi|31210535|ref|XP_314234.1| ENSANGP00000014381 [Anopheles gambi... 36 0.18
gi|22974690|ref|ZP_00020860.1| hypothetical protein [Chloroflexu... 36 0.18
gi|24372047|ref|NP_716089.1| thioredoxin 2 [Shewanella oneidensi... 36 0.18
gi|28209917|ref|NP_780861.1| thiol:disulfide interchange protein... 36 0.18
gi|31213043|ref|XP_315465.1| ENSANGP00000014263 [Anopheles gambi... 35 0.24
gi|21675042|ref|NP_663107.1| thiol:disulfide interchange protein... 35 0.24
gi|48835113|ref|ZP_00292115.1| COG0526: Thiol-disulfide isomeras... 35 0.24
gi|48846587|ref|ZP_00300848.1| COG0526: Thiol-disulfide isomeras... 35 0.24
gi|48858333|ref|ZP_00312290.1| COG0526: Thiol-disulfide isomeras... 35 0.24
gi|15604262|ref|NP_220778.1| THIOL:DISULFIDE INTERCHANGE PROTEIN... 35 0.24
gi|17547006|ref|NP_520408.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 35 0.24
gi|20092028|ref|NP_618103.1| thioredoxin [Methanosarcina acetivo... 35 0.24
gi|22538056|ref|NP_688907.1| bacteriocin transport accessory pro... 35 0.24
gi|48832301|ref|ZP_00289339.1| COG0526: Thiol-disulfide isomeras... 35 0.24
gi|8980491|emb|CAB96931.1| thioredoxin h [Triticum aestivum] >gn... 35 0.24
gi|27734590|sp|Q9V429|THI2_DROME Thioredoxin 2 (DmTrx-2) >gnl|BL... 35 0.24
gi|15894825|ref|NP_348174.1| Thioredoxin, trx [Clostridium aceto... 35 0.24
gi|11135132|sp|O65049|THIH_PICMA Thioredoxin H-type (TRX-H) >gnl... 35 0.24
gi|28868894|ref|NP_791513.1| thioredoxin, putative [Pseudomonas ... 35 0.31
gi|34499734|ref|NP_903949.1| thioredoxin-related transmembrane p... 35 0.31
gi|25029368|ref|NP_739422.1| putative thioredoxin [Corynebacteri... 35 0.31
gi|48833050|ref|ZP_00290074.1| COG0526: Thiol-disulfide isomeras... 35 0.31
gi|15614085|ref|NP_242388.1| thioredoxin (thiol:disulfide interc... 35 0.31
gi|34896158|ref|NP_909423.1| thioredoxin-like protein [Oryza sat... 35 0.31
gi|15966987|ref|NP_387340.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 35 0.31
gi|48475191|gb|AAT44260.1| putative thioredoxin H-type (TRX-H) (... 35 0.31
gi|267126|sp|P29451|THIO_MACMU Thioredoxin >gnl|BL_ORD_ID|675440... 35 0.31
gi|12082335|dbj|BAB20886.1| thioredoxin h [Oryza sativa (japonic... 35 0.31
gi|15230385|ref|NP_190672.1| thioredoxin H-type 1 (TRX-H-1) [Ara... 35 0.31
gi|46112827|ref|ZP_00181911.2| COG0526: Thiol-disulfide isomeras... 35 0.31
gi|46111043|ref|XP_382579.1| hypothetical protein FG02403.1 [Gib... 35 0.31
gi|267114|sp|P29445|THI1_DICDI Thioredoxin 1 >gnl|BL_ORD_ID|2421... 35 0.31
gi|27468335|ref|NP_764972.1| thioredoxin-like protein [Staphyloc... 35 0.31
gi|17548784|ref|NP_522124.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 35 0.31
gi|46317795|ref|ZP_00218373.1| COG0526: Thiol-disulfide isomeras... 35 0.31
gi|13473026|ref|NP_104593.1| thioredoxin-like protein [Mesorhizo... 35 0.41
gi|24639826|ref|NP_572212.1| CG3315-PA [Drosophila melanogaster]... 35 0.41
gi|15238181|ref|NP_198994.1| COP1-interactive protein 1 / CIP1 [... 35 0.41
gi|29246815|gb|EAA38398.1| GLP_0_21090_20686 [Giardia lamblia AT... 35 0.41
gi|30019866|ref|NP_831497.1| Thiol:disulfide interchange protein... 35 0.41
gi|47565510|ref|ZP_00236551.1| cytochrome c biogenesis protein, ... 35 0.41
gi|24637237|gb|AAN63622.1| thioredoxin [Triticum aestivum] 35 0.41
gi|15222488|ref|NP_177146.1| thioredoxin, putative [Arabidopsis ... 35 0.41
gi|22972679|ref|ZP_00019544.1| hypothetical protein [Chloroflexu... 35 0.41
gi|47458977|ref|YP_015839.1| thioredoxin [Mycoplasma mobile 163K... 35 0.41
gi|46019952|emb|CAG25528.1| thioredoxin [Suberites ficus] 35 0.41
gi|33621082|gb|AAQ23134.1| thioredoxin H1 [Ipomoea batatas] 35 0.41
gi|27466894|gb|AAO12854.1| thioredoxin h [Pisum sativum] 35 0.41
gi|33621084|gb|AAQ23135.1| thioredoxin H3 [Ipomoea batatas] 35 0.41
gi|50841811|ref|YP_055038.1| conserved protein [Propionibacteriu... 35 0.41
gi|33864093|ref|NP_895653.1| thioredoxin-like protein TxlA [Proc... 35 0.41
gi|5051813|emb|CAB45042.1| putative [Amycolatopsis orientalis] 35 0.41
gi|11135126|sp|O64394|THIH_WHEAT Thioredoxin H-type (TRX-H) (Trx... 34 0.54
gi|2995380|emb|CAA05081.1| thioredoxin H [Triticum turgidum subs... 34 0.54
gi|14581677|gb|AAK64512.1| Hsp70 interacting protein/thioredoxin... 34 0.54
gi|15614280|ref|NP_242583.1| thioredoxin [Bacillus halodurans C-... 34 0.54
gi|79882|pir||B29504 hypothetical 18K protein (mer operon) - Sta... 34 0.54
gi|15803110|ref|NP_289141.1| putative thioredoxin-like protein [... 34 0.54
gi|41407294|ref|NP_960130.1| TrxB [Mycobacterium avium subsp. pa... 34 0.54
gi|339649|gb|AAA74596.1| thioredoxin >gnl|BL_ORD_ID|1573571 gi|9... 34 0.54
gi|20140745|sp|Q9BDJ3|THIO_CALJA Thioredoxin >gnl|BL_ORD_ID|1571... 34 0.54
gi|38048645|gb|AAR10225.1| similar to Drosophila melanogaster th... 34 0.54
gi|17509457|ref|NP_491139.1| thioredoxin H (12.5 kD) (1D862) [Ca... 34 0.54
gi|29373131|gb|AAO72714.1| thioredoxin 1 [Melopsittacus undulatus] 34 0.54
gi|1072380|emb|CAA56993.1| unnamed protein product [Lactococcus ... 34 0.54
gi|19879659|gb|AAL79931.1| thioredoxin-like protein [Fusarium cu... 34 0.54
gi|4587471|gb|AAD25738.1| thioredoxin [Mycoplasma fermentans] 34 0.54
gi|32186042|gb|AAP72291.1| thioredoxin h isoform 2; HvTrxh2 [Hor... 34 0.54
gi|48838344|ref|ZP_00295289.1| COG0526: Thiol-disulfide isomeras... 34 0.54
gi|21226538|ref|NP_632460.1| Thioredoxin [Methanosarcina mazei G... 34 0.54
gi|1827675|pdb|1ERV| Human Thioredoxin Mutant With Cys 73 Repla... 34 0.54
gi|13624884|emb|CAC36986.1| thioredoxin h [Pisum sativum] 34 0.54
gi|23474644|ref|ZP_00129937.1| COG0526: Thiol-disulfide isomeras... 34 0.54
gi|98850|pir||S18531 cytochrome P450 eryF - Saccharopolyspora er... 34 0.70
gi|729202|sp|Q00441|CPXJ_SACER 6-deoxyerythronolide B hydroxylas... 34 0.70
gi|41018362|sp|Q8IFW4|THIT_DROME Thioredoxin T (ThioredoxinT) >g... 34 0.70
gi|25026846|ref|NP_736900.1| hypothetical protein [Corynebacteri... 34 0.70
gi|19551544|ref|NP_599546.1| thiol-disulfide isomerase [Coryneba... 34 0.70
gi|45509619|ref|ZP_00161952.1| COG0739: Membrane proteins relate... 34 0.70
gi|21536657|gb|AAM60989.1| tetratricoredoxin [Arabidopsis thaliana] 34 0.70
gi|1310983|pdb|1OXA| Cytochrome P450 (Donor:o2 Oxidoreductase) ... 34 0.70
gi|16975236|pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE 34 0.70
gi|16975235|pdb|1JIO|A Chain A, P450eryf6DEB 34 0.70
gi|11358963|pir||T50863 thioredoxin-like protein [imported] - ry... 34 0.70
gi|46362893|ref|ZP_00198057.2| COG0526: Thiol-disulfide isomeras... 34 0.70
gi|48869615|ref|ZP_00322366.1| COG0526: Thiol-disulfide isomeras... 34 0.70
gi|27806783|ref|NP_776393.1| thioredoxin [Bos taurus] >gnl|BL_OR... 34 0.70
gi|29653799|ref|NP_819491.1| thioredoxin [Coxiella burnetii RSA ... 34 0.70
gi|48894708|ref|ZP_00327817.1| COG0526: Thiol-disulfide isomeras... 34 0.70
gi|18977113|ref|NP_578470.1| hypothetical protein PF0741 [Pyroco... 34 0.70
gi|20140452|sp|O97508|THIO_HORSE Thioredoxin >gnl|BL_ORD_ID|1070... 34 0.70
gi|50592994|ref|NP_003320.2| thioredoxin [Homo sapiens] >gnl|BL_... 34 0.70
gi|47523692|ref|NP_999478.1| thioredoxin [Sus scrofa] >gnl|BL_OR... 34 0.70
gi|29337032|sp|O17486|THIO_ECHGR Thioredoxin >gnl|BL_ORD_ID|7234... 34 0.70
gi|11135375|sp|Q9UW02|THIO_COPCM Thioredoxin (Allergen Cop c 2) ... 34 0.70
gi|30584095|gb|AAP36296.1| Homo sapiens thioredoxin [synthetic c... 34 0.70
gi|230939|pdb|3TRX| Thioredoxin (Reduced Form) >gnl|BL_ORD_ID|4... 34 0.70
gi|640449|pdb|1TRS| Thioredoxin Mutant With Cys 62 Replaced By ... 34 0.70
gi|28379150|ref|NP_786042.1| thioredoxin H-type [Lactobacillus p... 34 0.70
gi|1729950|sp|P50413|THIO_SHEEP Thioredoxin >gnl|BL_ORD_ID|10029... 34 0.70
gi|21244602|ref|NP_644184.1| disulphide-isomerase [Xanthomonas a... 34 0.70
gi|15966399|ref|NP_386752.1| PUTATIVE THIOL:DISULFIDE INTERCHANG... 34 0.70
gi|47573051|ref|ZP_00243091.1| COG0526: Thiol-disulfide isomeras... 34 0.70
gi|29246716|gb|EAA38302.1| GLP_622_7659_8294 [Giardia lamblia AT... 34 0.70
gi|47223486|emb|CAF97973.1| unnamed protein product [Tetraodon n... 33 0.91
gi|32473848|ref|NP_866842.1| probable thiol-disulfide interchang... 33 0.91
gi|22537351|ref|NP_688202.1| TPR domain protein [Streptococcus a... 33 0.91
gi|25011315|ref|NP_735710.1| Unknown [Streptococcus agalactiae N... 33 0.91
gi|38232926|ref|NP_938693.1| Putative secreted protein [Coryneba... 33 0.91
gi|46321068|ref|ZP_00221448.1| COG0526: Thiol-disulfide isomeras... 33 0.91
gi|30261828|ref|NP_844205.1| thioredoxin family protein [Bacillu... 33 0.91
gi|46140331|ref|ZP_00203565.1| COG0526: Thiol-disulfide isomeras... 33 0.91
gi|267124|sp|P29449|THH1_TOBAC Thioredoxin H-type 1 (TRX-H1) >gn... 33 0.91
gi|23127896|ref|ZP_00109755.1| COG0526: Thiol-disulfide isomeras... 33 0.91
gi|15903769|ref|NP_359319.1| Conserved hypothetical protein [Str... 33 0.91
gi|14595690|gb|AAK70900.1| thioredoxin [Aedes aegypti] 33 0.91
gi|42541138|gb|AAS19462.1| thioredoxin [Paxillus involutus] 33 0.91
gi|29833889|ref|NP_828523.1| putative thioredoxin [Streptomyces ... 33 0.91
gi|29377495|ref|NP_816649.1| thioredoxin family protein [Enteroc... 33 0.91
gi|19746768|ref|NP_607904.1| putative thioredoxin [Streptococcus... 33 0.91
gi|34496561|ref|NP_900776.1| thioredoxin 2 [Chromobacterium viol... 33 0.91
gi|15900560|ref|NP_345164.1| thioredoxin family protein [Strepto... 33 0.91
gi|15902620|ref|NP_358170.1| Conserved hypothetical protein [Str... 33 0.91
gi|24372070|ref|NP_716112.1| thioredoxin, putative [Shewanella o... 33 0.91
gi|48781086|ref|ZP_00277740.1| COG0526: Thiol-disulfide isomeras... 33 0.91
gi|33597266|ref|NP_884909.1| cytochrome C-type biogenesis protei... 33 0.91
gi|46916593|emb|CAG23358.1| hypothetical thioredoxin [Photobacte... 33 0.91
gi|48846169|ref|ZP_00300435.1| COG0785: Cytochrome c biogenesis ... 33 1.2
gi|42733788|gb|AAS38707.1| hypothetical protein [Dictyostelium d... 33 1.2
gi|46322800|ref|ZP_00223167.1| COG0526: Thiol-disulfide isomeras... 33 1.2
gi|11125364|emb|CAC15387.1| protein disulfide isomerase [Plasmod... 33 1.2
gi|50290053|ref|XP_447458.1| unnamed protein product [Candida gl... 33 1.2
gi|33598426|ref|NP_886069.1| thioredoxin [Bordetella parapertuss... 33 1.2
gi|29345867|ref|NP_809370.1| sialic acid-specific 9-O-acetyleste... 33 1.2
gi|15889944|ref|NP_355625.1| AGR_C_4873p [Agrobacterium tumefaci... 33 1.2
gi|33383073|dbj|BAC81190.1| thiol-disulfide oxidoreductase [Brev... 33 1.2
gi|15672371|ref|NP_266545.1| thioredoxin H-type [Lactococcus lac... 33 1.2
gi|15901736|ref|NP_346340.1| thioredoxin, putative [Streptococcu... 33 1.2
gi|17229859|ref|NP_486407.1| thioredoxin [Nostoc sp. PCC 7120] >... 33 1.2
gi|46226985|gb|EAK87951.1| possible thioredoxin H-type of possib... 33 1.2
gi|45382053|ref|NP_990784.1| thioredoxin [Gallus gallus] >gnl|BL... 33 1.2
gi|40287476|gb|AAR83852.1| thioredoxin [Capsicum annuum] 33 1.2
gi|2392150|pdb|1AIU| Human Thioredoxin (D60n Mutant, Reduced Form) 33 1.2
gi|45509098|ref|ZP_00161433.1| COG0526: Thiol-disulfide isomeras... 33 1.2
gi|24380154|ref|NP_722109.1| putative bacterocin transport acces... 33 1.2
gi|15646067|ref|NP_208249.1| thioredoxin [Helicobacter pylori 26... 33 1.2
gi|39937802|ref|NP_950078.1| possible thioredoxin-like protein [... 33 1.2
gi|49473781|ref|YP_031823.1| Thiol 3A-disulfide interchange prot... 33 1.2
gi|33593930|ref|NP_881574.1| thioredoxin [Bordetella pertussis T... 33 1.2
gi|19705357|ref|NP_602852.1| Thiol:disulfide interchange protein... 33 1.2
gi|50286569|ref|XP_445713.1| unnamed protein product [Candida gl... 33 1.2
gi|50417287|ref|XP_457653.1| unnamed protein product [Debaryomyc... 33 1.2
gi|33592138|ref|NP_879782.1| putative exported protein [Bordetel... 33 1.2
gi|48765854|ref|ZP_00270404.1| COG0526: Thiol-disulfide isomeras... 33 1.2
gi|28868965|ref|NP_791584.1| conserved hypothetical protein [Pse... 33 1.6
gi|45514534|ref|ZP_00166092.1| COG1033: Predicted exporters of t... 33 1.6
gi|18041548|gb|AAL54858.1| tetratricoredoxin [Nicotiana tabacum] 33 1.6
gi|42630077|ref|ZP_00155621.1| COG0526: Thiol-disulfide isomeras... 33 1.6
gi|49119156|gb|AAH72884.1| Unknown (protein for MGC:80314) [Xeno... 33 1.6
gi|135775|sp|P08628|THIO_RABIT Thioredoxin >gnl|BL_ORD_ID|156405... 33 1.6
gi|28898779|ref|NP_798384.1| putative thioredoxin [Vibrio paraha... 33 1.6
gi|32266659|ref|NP_860691.1| thioredoxin [Helicobacter hepaticus... 33 1.6
gi|21402563|ref|NP_658548.1| thiored, Thioredoxin [Bacillus anth... 33 1.6
gi|12841560|dbj|BAB25256.1| unnamed protein product [Mus musculus] 33 1.6
gi|44004543|ref|NP_982212.1| thioredoxin, putative [Bacillus cer... 33 1.6
gi|50841970|ref|YP_055197.1| thiol-disulfide isomerase [Propioni... 33 1.6
gi|48835262|ref|ZP_00292263.1| COG0526: Thiol-disulfide isomeras... 33 1.6
gi|6755911|ref|NP_035790.1| thioredoxin 1 [Mus musculus] >gnl|BL... 33 1.6
gi|15608609|ref|NP_215987.1| trxB [Mycobacterium tuberculosis H3... 33 1.6
gi|16758644|ref|NP_446252.1| thioredoxin [Rattus norvegicus] >gn... 33 1.6
gi|48857749|ref|ZP_00311733.1| COG0526: Thiol-disulfide isomeras... 33 1.6
gi|46130219|ref|ZP_00164996.2| COG0526: Thiol-disulfide isomeras... 33 1.6
gi|20140788|sp|Q9DGI3|THIO_ICTPU Thioredoxin >gnl|BL_ORD_ID|1333... 33 1.6
gi|34558037|ref|NP_907852.1| SENSOR/RESPONSE REGULATOR HYBRID [W... 33 1.6
gi|50421171|ref|XP_459131.1| unnamed protein product [Debaryomyc... 33 1.6
gi|6321022|ref|NP_011101.1| Hydroperoxide and superoxide-radical... 33 1.6
gi|33597598|ref|NP_885241.1| thioredoxin 2 [Bordetella parapertu... 33 1.6
gi|33592785|ref|NP_880429.1| thioredoxin 2 [Bordetella pertussis... 33 1.6
gi|33602001|ref|NP_889561.1| thioredoxin 2 [Bordetella bronchise... 33 1.6
gi|39595078|emb|CAE60115.1| Hypothetical protein CBG03655 [Caeno... 32 2.0
gi|23612738|ref|NP_704277.1| disulfide isomerase precursor, puta... 32 2.0
gi|16758038|ref|NP_445783.1| thioredoxin 2; thioredoxin, mitocho... 32 2.0
gi|9903609|ref|NP_064297.1| thioredoxin 2; thioredoxin nuclear g... 32 2.0
gi|50288575|ref|XP_446717.1| unnamed protein product [Candida gl... 32 2.0
gi|29612484|gb|AAH49564.1| 4930429J24Rik protein [Mus musculus] 32 2.0
gi|23102781|ref|ZP_00089280.1| COG0526: Thiol-disulfide isomeras... 32 2.0
gi|38103824|gb|EAA50477.1| hypothetical protein MG04236.4 [Magna... 32 2.0
gi|31544837|ref|NP_853415.1| TrxA [Mycoplasma gallisepticum R] >... 32 2.0
gi|586099|sp|Q07090|THH2_TOBAC Thioredoxin H-type 2 (TRX-H2) >gn... 32 2.0
gi|47215755|emb|CAG05766.1| unnamed protein product [Tetraodon n... 32 2.0
gi|549079|sp|Q05739|THIO_STRCL Thioredoxin (TRX) >gnl|BL_ORD_ID|... 32 2.0
gi|26453152|dbj|BAC43652.1| putative thioredoxin [Arabidopsis th... 32 2.0
gi|33860219|sp|Q9R6P9|THIO_MYCGA Thioredoxin (Trx) 32 2.0
gi|6601583|gb|AAF19044.1| thioredoxin [Mycoplasma gallisepticum] 32 2.0
gi|38257105|ref|NP_940767.1| thioredoxin [Staphylococcus warneri... 32 2.0
gi|31231849|ref|XP_318603.1| ENSANGP00000004582 [Anopheles gambi... 32 2.0
gi|49474929|ref|YP_032970.1| Thiol 3A-disulfide interchange prot... 32 2.0
gi|7109697|gb|AAF36768.1| thioredoxin [Mycoplasma gallisepticum] 32 2.0
gi|23003045|ref|ZP_00046715.1| COG0526: Thiol-disulfide isomeras... 32 2.0
gi|29829350|ref|NP_823984.1| putative thioredoxin [Streptomyces ... 32 2.0
gi|23099690|ref|NP_693156.1| thioredoxin [Oceanobacillus iheyens... 32 2.0
gi|32477354|ref|NP_870348.1| thioredoxin 1 [Pirellula sp. 1] >gn... 32 2.0
gi|48862305|ref|ZP_00316202.1| COG0526: Thiol-disulfide isomeras... 32 2.0
gi|45518114|ref|ZP_00169665.1| COG0526: Thiol-disulfide isomeras... 32 2.0
gi|27229039|ref|NP_080408.2| RIKEN cDNA 4930429J24 [Mus musculus... 32 2.0
gi|16765969|ref|NP_461584.1| thioredoxin 2 [Salmonella typhimuri... 32 2.0
gi|27375705|ref|NP_767234.1| thioredoxin [Bradyrhizobium japonic... 32 2.0
gi|28899583|ref|NP_799188.1| flavohemoprotein (flavohemoglobin) ... 32 2.0
gi|46141372|ref|ZP_00146606.2| COG0526: Thiol-disulfide isomeras... 32 2.0
gi|15226875|ref|NP_181046.1| thioredoxin family protein [Arabido... 32 2.0
gi|26990927|ref|NP_746352.1| thiol:disulfide interchange protein... 32 2.7
gi|15597673|ref|NP_251167.1| probable thiol:disulfide interchang... 32 2.7
gi|49083636|gb|AAT51080.1| PA2477 [synthetic construct] 32 2.7
gi|41723077|ref|ZP_00150033.1| COG0784: FOG: CheY-like receiver ... 32 2.7
gi|10434208|dbj|BAB14171.1| unnamed protein product [Homo sapien... 32 2.7
gi|18397764|ref|NP_564371.1| thioredoxin o (TRXO2) [Arabidopsis ... 32 2.7
gi|24371865|ref|NP_715907.1| thiol:disulfide interchange protein... 32 2.7
gi|24374636|ref|NP_718679.1| thioredoxin, putative [Shewanella o... 32 2.7
gi|30684711|ref|NP_188415.2| tetratricoredoxin (TDX) [Arabidopsi... 32 2.7
gi|46440305|gb|EAK99613.1| hypothetical protein CaO19.2516 [Cand... 32 2.7
gi|32815907|gb|AAP88338.1| At3g17880 [Arabidopsis thaliana] 32 2.7
gi|7508751|pir||T32946 hypothetical protein W01B11.6 - Caenorhab... 32 2.7
gi|46118007|ref|ZP_00174517.2| COG0526: Thiol-disulfide isomeras... 32 2.7
gi|48834589|ref|ZP_00291596.1| COG0526: Thiol-disulfide isomeras... 32 2.7
gi|99566|pir||S15137 thioredoxin h2 - spinach (fragments) 32 2.7
gi|45527950|ref|ZP_00179149.1| COG0526: Thiol-disulfide isomeras... 32 2.7
gi|50309357|ref|XP_454686.1| unnamed protein product [Kluyveromy... 32 2.7
gi|15612416|ref|NP_224069.1| putative THIOREDOXIN [Helicobacter ... 32 2.7
gi|50402589|gb|AAT76629.1| thioredoxin 2 [Schistosoma mansoni] 32 2.7
gi|48856477|ref|ZP_00310634.1| COG0526: Thiol-disulfide isomeras... 32 2.7
gi|9755396|gb|AAF98203.1| F17F8.6 [Arabidopsis thaliana] 32 2.7
gi|34540117|ref|NP_904596.1| thioredoxin family protein [Porphyr... 32 2.7
>gi|17535459|ref|NP_496200.1| thioredoxin family member (17.3 kD)
(2K489) [Caenorhabditis elegans]
gi|7506331|pir||T23939 hypothetical protein R05H5.3 -
Caenorhabditis elegans
gi|3878799|emb|CAA88726.1| Hypothetical protein R05H5.3
[Caenorhabditis elegans]
Length = 149
Score = 312 bits (800), Expect = 8e-85
Identities = 149/149 (100%), Positives = 149/149 (100%)
Frame = +1
Query: 1 MSELLAGTKLINQDSEELDAGEHLKGKVVGLYFSASWCPPCRQFTPKLTRFFDEIRKKHP 180
MSELLAGTKLINQDSEELDAGEHLKGKVVGLYFSASWCPPCRQFTPKLTRFFDEIRKKHP
Sbjct: 1 MSELLAGTKLINQDSEELDAGEHLKGKVVGLYFSASWCPPCRQFTPKLTRFFDEIRKKHP 60
Query: 181 EFEVVFVSRDREDGDLREYFLEHMGAWTAIPFGTPRIQELLEQYEVKTIPSMRIVKPNGD 360
EFEVVFVSRDREDGDLREYFLEHMGAWTAIPFGTPRIQELLEQYEVKTIPSMRIVKPNGD
Sbjct: 61 EFEVVFVSRDREDGDLREYFLEHMGAWTAIPFGTPRIQELLEQYEVKTIPSMRIVKPNGD 120
Query: 361 VVVQDARTEIQDKGNDPEALWEEWLAFYD 447
VVVQDARTEIQDKGNDPEALWEEWLAFYD
Sbjct: 121 VVVQDARTEIQDKGNDPEALWEEWLAFYD 149