Homology by BLASTX


BLASTX 2.2.4 [Aug-26-2002]
Query= R04D3_4
         (1293 letters)

Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
           1,967,186 sequences; 661,712,633 total letters


                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|17569247|ref|NP_510210.1| putative secreted or extracellular ...   697   0.0
gi|17569245|ref|NP_510208.1| putative protein family member (46....   324   2e-87
gi|39583190|emb|CAE61408.1| Hypothetical protein CBG05271 [Caeno...   241   4e-62
gi|17568955|ref|NP_508516.1| predicted CDS, putative nuclear pro...   177   4e-43
gi|39588177|emb|CAE68102.1| Hypothetical protein CBG13742 [Caeno...   107   6e-22
gi|17570399|ref|NP_508513.1| putative protein family member (XD6...   106   1e-21
gi|17569359|ref|NP_509409.1| putative nuclear protein family mem...   103   9e-21
gi|25513613|pir||E89588 protein R09F10.8 [imported] - Caenorhabd...   103   9e-21
gi|39583215|emb|CAE61433.1| Hypothetical protein CBG05315 [Caeno...   103   1e-20
gi|39578852|emb|CAE56668.1| Hypothetical protein CBG24440 [Caeno...   103   1e-20
gi|39583214|emb|CAE61432.1| Hypothetical protein CBG05314 [Caeno...   103   1e-20
gi|39588178|emb|CAE68103.1| Hypothetical protein CBG13743 [Caeno...    96   2e-18
gi|17544366|ref|NP_502909.1| putative protein family member (4Q7...    81   5e-14
gi|17568141|ref|NP_509980.1| putative protein family member (XM4...    63   1e-08
gi|25149434|ref|NP_495089.2| metridin-like ShK toxin (2F892) [Ca...    45   0.003
gi|38638836|gb|AAR25657.1| Hypothetical protein C17G10.6b [Caeno...    45   0.003
gi|7496228|pir||T34103 hypothetical protein C17G10.6 - Caenorhab...    45   0.003
gi|39589599|emb|CAE66834.1| Hypothetical protein CBG12204 [Caeno...    42   0.032
gi|39595087|emb|CAE60124.1| Hypothetical protein CBG03667 [Caeno...    40   0.092
gi|48853480|ref|ZP_00307650.1| COG1187: 16S rRNA uridine-516 pse...    40   0.16
gi|17507601|ref|NP_492821.1| of Ty 16 (116.9 kD) (1L369) [Caenor...    40   0.16
gi|46435189|gb|EAK94576.1| hypothetical protein CaO19.8632 [Cand...    39   0.20
gi|17558378|ref|NP_504775.1| putative protein, with 4 coiled coi...    39   0.20
gi|18644734|ref|NP_110517.2| beta catenin-like 1; nuclear associ...    39   0.20
gi|22760250|dbj|BAC11121.1| unnamed protein product [Homo sapiens]     39   0.20
gi|23465843|ref|NP_696446.1| ribonuclease G [Bifidobacterium lon...    39   0.27
gi|50293601|ref|XP_449212.1| unnamed protein product [Candida gl...    39   0.27
gi|22538461|ref|NP_006302.2| nuclear receptor co-repressor 1; th...    39   0.35
gi|3510603|gb|AAC33550.1| nuclear receptor co-repressor N-CoR [H...    39   0.35
gi|29421188|dbj|BAA82999.2| KIAA1047 protein [Homo sapiens]            39   0.35
gi|30348551|emb|CAC84343.1| hypothetical protein [Saimiriine her...    39   0.35
gi|23478336|gb|EAA15452.1| hypothetical protein [Plasmodium yoel...    39   0.35
gi|28190008|gb|AAO32942.1| NCOR isoform b [Homo sapiens]               39   0.35
gi|33150576|gb|AAP97166.1| nuclear receptor co-repressor [Homo s...    39   0.35
gi|39594465|emb|CAE72043.1| Hypothetical protein CBG19125 [Caeno...    38   0.60
gi|46435142|gb|EAK94530.1| hypothetical protein CaO19.1030 [Cand...    38   0.60
gi|21355533|ref|NP_648367.1| CG8108-PB [Drosophila melanogaster]...    38   0.60
gi|50293187|ref|XP_449005.1| unnamed protein product [Candida gl...    37   0.78
gi|45478180|gb|AAS66261.1| LRRGT00170 [Rattus norvegicus]              37   1.0
gi|39588748|emb|CAE58272.1| Hypothetical protein CBG01378 [Caeno...    37   1.3
gi|31199963|ref|XP_308929.1| ENSANGP00000013171 [Anopheles gambi...    37   1.3
gi|7488172|pir||F71437 probable resistance gene - Arabidopsis th...    37   1.3
gi|1778352|gb|AAB40699.1| putative DNA dependent ATPase and heli...    37   1.3
gi|31541903|ref|NP_080213.2| nuclear NF-kappaB activating protei...    37   1.3
gi|12847651|dbj|BAB27654.1| unnamed protein product [Mus musculu...    37   1.3
gi|7711007|emb|CAB90351.1| bA42M11.1 (alpha thalassemia/mental r...    37   1.3
gi|20336209|ref|NP_000480.2| transcriptional regulator ATRX isof...    37   1.3
gi|38502929|sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX ...    37   1.3
gi|17380440|sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX ...    37   1.3
gi|7512482|pir||I38614 helicase II - human >gnl|BL_ORD_ID|551646...    37   1.3
gi|33354053|dbj|BAC81110.1| ATRX [Homo sapiens]                        37   1.3
gi|38502928|sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX ...    37   1.3
gi|20336207|ref|NP_612115.1| transcriptional regulator ATRX isof...    37   1.3
gi|20336205|ref|NP_612114.1| transcriptional regulator ATRX isof...    37   1.3
gi|1778351|gb|AAB40698.1| putative DNA dependent ATPase and heli...    37   1.3
gi|2306809|gb|AAC51657.1| X-linked nuclear protein [Homo sapiens]      37   1.3
gi|47224107|emb|CAG13027.1| unnamed protein product [Tetraodon n...    36   1.7
gi|26354767|dbj|BAC41010.1| unnamed protein product [Mus musculus]     36   1.7
gi|23612884|ref|NP_704423.1| hypothetical protein [Plasmodium fa...    36   1.7
gi|9626175|ref|NP_040523.1| minor core protein [Human adenovirus...    36   1.7
gi|26345990|dbj|BAC36646.1| unnamed protein product [Mus musculus]     36   1.7
gi|19920432|ref|NP_608486.1| CG11371-PB [Drosophila melanogaster...    36   1.7
gi|31212553|ref|XP_315261.1| ENSANGP00000022311 [Anopheles gambi...    36   1.7
gi|15010520|gb|AAK77308.1| GH08783p [Drosophila melanogaster]          36   1.7
gi|33563288|ref|NP_080477.1| cell division cycle and apoptosis r...    36   1.7
gi|5880841|gb|AAD54933.1| LOX18 homeodomain protein [Helobdella ...    36   1.7
gi|23508822|ref|NP_701490.1| eukaryotic translation initiation f...    36   1.7
gi|32413471|ref|XP_327215.1| hypothetical protein [Neurospora cr...    36   2.3
gi|46126293|ref|XP_387700.1| hypothetical protein FG07524.1 [Gib...    36   2.3
gi|42661866|ref|XP_375557.1| NY-REN-24 antigen [Homo sapiens]          36   2.3
gi|7494278|pir||B71624 hypothetical protein PFB0080c - malaria p...    36   2.3
gi|1204159|emb|CAA86696.1| Sec7p [Saccharomyces cerevisiae]            36   2.3
gi|253851|gb|AAB22964.1| calreticulin=63 kda calcium-binding pro...    36   2.3
gi|23593260|ref|NP_472945.2| hypothetical protein [Plasmodium fa...    36   2.3
gi|6320374|ref|NP_010454.1| Involved in protein transport at mul...    36   2.3
gi|172570|gb|AAB04031.1| Sec7p protein                                 36   2.3
gi|50418619|ref|XP_457828.1| unnamed protein product [Debaryomyc...    36   2.3
gi|11693172|ref|NP_071794.1| calreticulin [Rattus norvegicus] >g...    36   2.3
gi|7496978|pir||T19694 hypothetical protein C34B7.2 - Caenorhabd...    36   2.3
gi|50256317|gb|EAL19042.1| hypothetical protein CNBH1440 [Crypto...    35   3.0
gi|34932989|ref|XP_216468.2| similar to hypothetical protein FLJ...    35   3.0
gi|46441356|gb|EAL00654.1| hypothetical protein CaO19.2088 [Cand...    35   3.0
gi|47222918|emb|CAF99074.1| unnamed protein product [Tetraodon n...    35   3.0
gi|50310841|ref|XP_455443.1| unnamed protein product [Kluyveromy...    35   3.0
gi|15238595|ref|NP_200811.1| expressed protein [Arabidopsis thal...    35   3.0
gi|32698003|emb|CAB04326.3| Hypothetical protein F36F2.3 [Caenor...    35   3.0
gi|23485982|gb|EAA20680.1| hypothetical protein [Plasmodium yoel...    35   3.0
gi|17507217|ref|NP_492424.1| retinoblastoma binding protein 6 li...    35   3.0
gi|7500635|pir||T21861 hypothetical protein F36F2.3 - Caenorhabd...    35   3.0
gi|6678609|ref|NP_033556.1| alpha thalassemia/mental retardation...    35   3.0
gi|24641342|ref|NP_572736.1| CG1703-PA [Drosophila melanogaster]...    35   3.0
gi|50260420|gb|EAL23077.1| hypothetical protein CNBA6020 [Crypto...    35   3.0
gi|33469121|ref|NP_058059.1| dentin matrix protein 1; serine ric...    35   3.0
gi|6137020|emb|CAB59629.1| dentin matrix protein-1 [Mus musculus]      35   3.0
gi|2136369|pir||I54367 X-linked nuclear protein - human >gnl|BL_...    35   3.9
gi|20070900|gb|AAH26774.1| Nuclear NF-kappaB activating protein ...    35   3.9
gi|23397399|ref|NP_610101.2| CG8677-PA [Drosophila melanogaster]...    35   3.9
gi|50293711|ref|XP_449267.1| unnamed protein product [Candida gl...    35   3.9
gi|24711753|gb|AAN62757.1| larval allergen [Brugia malayi]             35   3.9
gi|32422567|ref|XP_331727.1| hypothetical protein [Neurospora cr...    35   3.9
gi|49078454|ref|XP_402978.1| hypothetical protein UM05363.1 [Ust...    35   3.9
gi|38100316|gb|EAA47458.1| hypothetical protein MG02701.4 [Magna...    35   3.9
gi|34860284|ref|XP_215906.2| similar to beta catenin-like 1; nuc...    35   3.9
gi|50748622|ref|XP_421330.1| PREDICTED: similar to chromogranin ...    35   3.9
gi|22788756|ref|NP_690468.1| hypothetical protein HZV_49 [Heliot...    35   3.9
gi|50546138|ref|XP_500596.1| hypothetical protein [Yarrowia lipo...    35   3.9
gi|23957728|ref|NP_473185.2| hypothetical protein, conserved [Pl...    35   3.9
gi|45184964|ref|NP_982682.1| AAR140Wp [Eremothecium gossypii] >g...    35   3.9
gi|46121247|ref|XP_385178.1| hypothetical protein FG05002.1 [Gib...    35   3.9
gi|47525253|gb|AAD56608.2| putative calmodulin-binding protein C...    35   5.0
gi|49903364|gb|AAH76719.1| LOC398539 protein [Xenopus laevis]          35   5.0
gi|84211|pir||S00485 gene 11-1 protein precursor - malaria paras...    35   5.0
gi|27503180|gb|AAH42300.1| LOC398539 protein [Xenopus laevis]          35   5.0
gi|17864460|ref|NP_524825.1| CG9930-PA [Drosophila melanogaster]...    35   5.0
gi|23481592|gb|EAA17823.1| hypothetical protein [Plasmodium yoel...    35   5.0
gi|17507467|ref|NP_493503.1| aminopeptidase (1O931) [Caenorhabdi...    35   5.0
gi|6323352|ref|NP_013424.1| Mms22p [Saccharomyces cerevisiae] >g...    35   5.0
gi|48994794|gb|AAT48090.1| nucleomorphin B [Dictyostelium discoi...    35   5.0
gi|49109447|ref|XP_411675.1| hypothetical protein AN7538.2 [Aspe...    35   5.0
gi|9826|emb|CAA30336.1| 11-1 polypeptide [Plasmodium falciparum]       35   5.0
gi|34881163|ref|XP_217570.2| similar to ATRX protein [Rattus nor...    35   5.0
gi|23486500|gb|EAA20810.1| unknown protein, putative [Plasmodium...    35   5.0
gi|46136153|ref|XP_389768.1| hypothetical protein FG09592.1 [Gib...    35   5.0
gi|42761547|gb|AAS45365.1| similar to Plasmodium falciparum. Hyp...    35   5.0
gi|50259111|gb|EAL21788.1| hypothetical protein CNBC4900 [Crypto...    35   5.0
gi|6680836|ref|NP_031617.1| calreticulin [Mus musculus] >gnl|BL_...    35   5.0
gi|45551505|ref|NP_728686.2| CG1828-PB [Drosophila melanogaster]...    34   6.6
gi|39594466|emb|CAE72044.1| Hypothetical protein CBG19126 [Caeno...    34   6.6
gi|27544248|dbj|BAC54898.1| supressor of Ty element 16 [Drosophi...    34   6.6
gi|23613572|ref|NP_704593.1| hypothetical protein [Plasmodium fa...    34   6.6
gi|42761577|gb|AAS45395.1| similar to Plasmodium falciparum (iso...    34   6.6
gi|17367114|sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX ...    34   6.6
gi|17509687|ref|NP_491423.1| human XNP gene related (156.2 kD) (...    34   6.6
gi|8096269|dbj|BAA95789.1| KED [Nicotiana tabacum]                     34   6.6
gi|32418500|ref|XP_329728.1| hypothetical protein [Neurospora cr...    34   6.6
gi|47208500|emb|CAF90519.1| unnamed protein product [Tetraodon n...    34   6.6
gi|23619305|ref|NP_705267.1| hypothetical protein [Plasmodium fa...    34   6.6
gi|46137049|ref|XP_390216.1| hypothetical protein FG10040.1 [Gib...    34   6.6
gi|23612603|ref|NP_704164.1| hypothetical protein [Plasmodium fa...    34   6.6
gi|50311575|ref|XP_455812.1| unnamed protein product [Kluyveromy...    34   6.6
gi|34878571|ref|XP_223518.2| similar to RIKEN cDNA 4921513E08 [R...    34   6.6
gi|45549019|ref|NP_476610.2| CG1828-PA [Drosophila melanogaster]...    34   6.6
gi|46852388|ref|NP_060707.2| cell-cycle and apoptosis regulatory...    34   6.6
gi|34304005|ref|NP_899141.1| hypothetical protein 6430402L03 [Mu...    34   6.6
gi|23508177|ref|NP_700847.1| gene 11-1 protein precursor [Plasmo...    34   6.6
gi|31981221|ref|NP_079956.2| nuclear protein NAP [Mus musculus] ...    34   6.6
gi|26346502|dbj|BAC36902.1| unnamed protein product [Mus musculus]     34   6.6
gi|29747967|gb|AAH50787.1| Nuclear protein NAP [Mus musculus]          34   6.6
gi|18460918|gb|AAK27389.1| nuclear protein NAP [Mus musculus]          34   6.6
gi|47606347|sp|Q9CWL8|CNL1_MOUSE Beta-catenin-like protein 1 (Nu...    34   6.6
gi|49387556|dbj|BAD25487.1| unknown protein [Oryza sativa (japon...    34   8.6
gi|23507939|ref|NP_700609.1| hypothetical protein [Plasmodium fa...    34   8.6
gi|17534591|ref|NP_495100.1| putative protein, with 4 coiled coi...    34   8.6
gi|32411183|ref|XP_326072.1| hypothetical protein [Neurospora cr...    34   8.6
gi|15242223|ref|NP_197018.1| aldose 1-epimerase family protein [...    34   8.6
gi|7505887|pir||T23647 hypothetical protein M01E5.5b - Caenorhab...    34   8.6
gi|45188060|ref|NP_984283.1| ADR187Wp [Eremothecium gossypii] >g...    34   8.6
gi|6179410|emb|CAB59918.1| hypothetical phosphatase associated p...    34   8.6
gi|23485477|gb|EAA20446.1| dentin phosphoryn, putative [Plasmodi...    34   8.6
gi|49900606|gb|AAH76130.1| Unknown (protein for IMAGE:7071950) [...    34   8.6
gi|128414|sp|P07222|NPM_XENLA Nucleophosmin (NPM) (Nucleolar pho...    34   8.6
gi|50555528|ref|XP_505172.1| hypothetical protein [Yarrowia lipo...    34   8.6
gi|2133452|pir||S65469 DNA topoisomerase (EC 5.99.1.2) - Caenorh...    34   8.6
gi|4098874|gb|AAD00455.1| heat shock protein 70 [Pneumocystis ca...    34   8.6
gi|39593629|emb|CAE61921.1| Hypothetical protein CBG05917 [Caeno...    34   8.6
gi|38104108|gb|EAA50723.1| hypothetical protein MG04482.4 [Magna...    34   8.6
gi|34895374|ref|NP_909030.1| P0698A04.25 [Oryza sativa (japonica...    34   8.6
gi|39591381|emb|CAE73435.1| Hypothetical protein CBG20878 [Caeno...    34   8.6
gi|4097891|gb|AAD09565.1| heat shock protein 70 [Pneumocystis ca...    34   8.6
gi|27371146|gb|AAH41537.1| LOC397919 protein [Xenopus laevis]          34   8.6
gi|39594797|emb|CAE70665.1| Hypothetical protein CBG17372 [Caeno...    34   8.6
gi|121279|sp|P02858|GLC4_SOYBN Glycinin G4 precursor [Contains: ...    34   8.6
gi|23612965|ref|NP_704504.1| hypothetical protein [Plasmodium fa...    34   8.6
gi|23480087|gb|EAA16743.1| Drosophila melanogaster GH13383p [Pla...    34   8.6
gi|32417556|ref|XP_329256.1| hypothetical protein [Neurospora cr...    34   8.6
gi|50294838|ref|XP_449830.1| unnamed protein product [Candida gl...    34   8.6
gi|17508321|ref|NP_493337.1| eukaryotic DNA topoisomerase I., TO...    34   8.6
gi|1934847|emb|CAA65537.1| DNA topoisomerase; DNA topoisomerase ...    34   8.6


>gi|17569247|ref|NP_510210.1| putative secreted or extracellular
            protein family member precursor, with a coiled coil-4
            domain (XN908) [Caenorhabditis elegans]
 gi|7506265|pir||T23899 hypothetical protein R04D3.3 - Caenorhabditis
            elegans
 gi|3878815|emb|CAA94163.1| Hypothetical protein R04D3.3
            [Caenorhabditis elegans]
          Length = 430

 Score =  697 bits (1799), Expect = 0.0
 Identities = 361/430 (83%), Positives = 361/430 (83%)
 Frame = -1

Query: 1293 MAFHRFLLMALPMLVSAAVSIDCSRENSCFGEPYGCSPNAGCNSLFHFDTDHNLHFYIRN 1114
            MAFHRFLLMALPMLVSAAVSIDCSRENSCFGEPYGCSPNAGCNSLFHFDTDHNLHFYIRN
Sbjct: 1    MAFHRFLLMALPMLVSAAVSIDCSRENSCFGEPYGCSPNAGCNSLFHFDTDHNLHFYIRN 60

Query: 1113 FTDMSGYAAFAVNRSSDETIEYFVILPYQRQLLRAHADFGGRVLISEKRISGDVEYLGKT 934
            FTDMSGYAAFAVNRSSDETIEYFVILPYQRQLLRAHADFGGRVLISEKRISGDVEYLGKT
Sbjct: 61   FTDMSGYAAFAVNRSSDETIEYFVILPYQRQLLRAHADFGGRVLISEKRISGDVEYLGKT 120

Query: 933  DFRCTFPASELPTKFQQEQLFFVSKGTFVESFFVHDGIQLFNLEDDAQFDIVSAEVPLTP 754
            DFRCTFPASELPTKFQQEQLFFVSKGTFVESFFVHDGIQLFNLEDDAQFDIVSAEVPLTP
Sbjct: 121  DFRCTFPASELPTKFQQEQLFFVSKGTFVESFFVHDGIQLFNLEDDAQFDIVSAEVPLTP 180

Query: 753  SIYHIGSQVGGSSMEDVLTSDEKDSLSEAISNLPKSPKSKTDRDLETLAQSGSKTRDSHX 574
            SIYHIGSQVGGSSMEDVLTSDEKDSLSEAISNLPKSPKSKTDRDLETLAQSGSKTRDSH
Sbjct: 181  SIYHIGSQVGGSSMEDVLTSDEKDSLSEAISNLPKSPKSKTDRDLETLAQSGSKTRDSHS 240

Query: 573  XXXXXXXXXXXXXXXXXXXXXXXXRHSNNARGRSTRKHRXXXXXXXXXXXXXXXESKTRK 394
                                    RHSNNARGRSTRKHR               ESKTRK
Sbjct: 241  RRRQYPEYEYEDEDREEMESRPRRRHSNNARGRSTRKHREEGESDDENEDYEEEESKTRK 300

Query: 393  TXXXXXXXXXXXXXXXXNFKPRRKPYGGRSAHRNRXXXXXXXXXXXXXDNSFKPRKTNRR 214
            T                NFKPRRKPYGGRSAHRNR             DNSFKPRKTNRR
Sbjct: 301  TNRRSRNDDDDILDDEDNFKPRRKPYGGRSAHRNREEDDYEDDEDYEEDNSFKPRKTNRR 360

Query: 213  SRIDDEDESKPRKTQRGRKNKKDSDEDELFDTEENDEDWSDLDNSGSRLDKRKHIVCDLV 34
            SRIDDEDESKPRKTQRGRKNKKDSDEDELFDTEENDEDWSDLDNSGSRLDKRKHIVCDLV
Sbjct: 361  SRIDDEDESKPRKTQRGRKNKKDSDEDELFDTEENDEDWSDLDNSGSRLDKRKHIVCDLV 420

Query: 33   AIALILVFMF 4
            AIALILVFMF
Sbjct: 421  AIALILVFMF 430




[DB home][top]