Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= R03E1_1
(733 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|7500109|pir||T21523 protein kinase (EC 2.7.1.37) akt-2 long s... 473 e-132
gi|25146791|ref|NP_510357.2| AKT kinase (55.8 kD) (akt-2) [Caeno... 382 e-105
gi|17557832|ref|NP_505637.1| AKT kinase (62.2 kD) (akt-1) [Caeno... 342 5e-93
gi|25145932|ref|NP_741614.1| AKT kinase (62.7 kD) (akt-1) [Caeno... 341 8e-93
gi|39593304|emb|CAE64774.1| Hypothetical protein CBG09565 [Caeno... 333 2e-90
gi|16266771|dbj|BAB69974.1| kinase Akt/PKB [Asterina pectinifera] 275 7e-73
gi|48138240|ref|XP_396874.1| similar to serine/threonine protein... 273 2e-72
gi|47230282|emb|CAG10696.1| unnamed protein product [Tetraodon n... 273 3e-72
gi|45433564|ref|NP_035915.2| thymoma viral proto-oncogene 3; PKB... 269 5e-71
gi|11131397|sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-prot... 268 7e-71
gi|33304021|gb|AAQ02518.1| v-akt murine thymoma viral oncogene-l... 268 9e-71
gi|4885549|ref|NP_005456.1| v-akt murine thymoma viral oncogene ... 268 9e-71
gi|47223805|emb|CAF98575.1| unnamed protein product [Tetraodon n... 268 1e-70
gi|50740731|ref|XP_419544.1| PREDICTED: similar to RAC-gamma ser... 268 1e-70
gi|45384254|ref|NP_990386.1| serine/threonine protein kinase [Ga... 267 1e-70
gi|47209740|emb|CAF93725.1| unnamed protein product [Tetraodon n... 266 2e-70
gi|7512664|pir||T17287 protein kinase (EC 2.7.1.37) akt3 short s... 266 3e-70
gi|32307163|ref|NP_859029.1| v-akt murine thymoma viral oncogene... 266 3e-70
gi|12539654|gb|AAG59601.1| Akt [Xenopus laevis] 266 4e-70
gi|31198165|ref|XP_308030.1| ENSANGP00000019348 [Anopheles gambi... 265 6e-70
gi|37926827|pdb|1MRV|A Chain A, Crystal Structure Of An Inactive... 265 7e-70
gi|31615317|pdb|1GZK|A Chain A, Molecular Mechanism For The Regu... 265 7e-70
gi|4502023|ref|NP_001617.1| v-akt murine thymoma viral oncogene ... 265 7e-70
gi|337491|gb|AAA36585.1| rac protein kinase-beta [Homo sapiens] 265 7e-70
gi|31615318|pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain 265 7e-70
gi|47939913|gb|AAH72041.1| MGC78893 protein [Xenopus laevis] 265 7e-70
gi|13928778|ref|NP_113763.1| thymoma viral proto-oncogene 3; v-a... 264 1e-69
gi|47205027|emb|CAF89793.1| unnamed protein product [Tetraodon n... 264 1e-69
gi|37700244|ref|NP_937789.1| v-akt murine thymoma viral oncogene... 264 1e-69
gi|28279352|gb|AAH46261.1| Akt2-prov protein [Xenopus laevis] 264 1e-69
gi|26324816|dbj|BAC26162.1| unnamed protein product [Mus musculus] 263 2e-69
gi|538540|pir||A40831 gag-akt polyprotein - AKT8 murine leukemia... 263 2e-69
gi|400112|sp|P31748|KAKT_MLVAT AKT kinase transforming protein 263 2e-69
gi|6680674|ref|NP_031460.1| thymoma viral proto-oncogene 2; RAC-... 263 2e-69
gi|15100164|ref|NP_150233.1| v-akt murine thymoma viral oncogene... 263 2e-69
gi|6753034|ref|NP_033782.1| thymoma viral proto-oncogene 1 [Mus ... 263 2e-69
gi|27066381|pdb|1O6L|A Chain A, Crystal Structure Of An Activate... 263 3e-69
gi|27066378|pdb|1O6K|A Chain A, Structure Of Activated Form Of P... 263 3e-69
gi|33303885|gb|AAQ02456.1| v-akt murine thymoma viral oncogene h... 262 5e-69
gi|12653417|gb|AAH00479.1| AKT1 protein [Homo sapiens] 262 5e-69
gi|400144|sp|P31750|KRAC_MOUSE RAC-alpha serine/threonine-protei... 262 5e-69
gi|4885061|ref|NP_005154.1| serine/threonine protein kinase; Mur... 262 5e-69
gi|35481|emb|CAA43372.1| human protein kinase B [Homo sapiens] 262 5e-69
gi|27806747|ref|NP_776411.1| v-akt murine thymoma viral oncogene... 262 6e-69
gi|1079127|pir||A55888 protein kinase (EC 2.7.1.37) akt [similar... 260 2e-68
gi|45551909|ref|NP_732113.2| CG4006-PC [Drosophila melanogaster]... 260 2e-68
gi|398924|emb|CAA81204.1| Dakt1 serine-threonine protein kinase ... 260 2e-68
gi|24647358|ref|NP_732114.1| CG4006-PA [Drosophila melanogaster]... 260 2e-68
gi|5853305|gb|AAD54413.1| protein serine/threonine kinase [Gallu... 260 2e-68
gi|47086403|ref|NP_997980.1| v-akt murine thymoma viral oncogene... 259 4e-68
gi|30725240|gb|AAP37655.1| serine/threonine protein kinase Akt [... 257 2e-67
gi|8392888|ref|NP_058789.1| murine thymoma viral (v-akt) oncogen... 257 2e-67
gi|26333955|dbj|BAC30695.1| unnamed protein product [Mus musculus] 253 4e-66
gi|12804627|gb|AAH01737.1| Unknown (protein for IMAGE:3354010) [... 232 7e-60
gi|26343125|dbj|BAC35219.1| unnamed protein product [Mus musculus] 230 2e-59
gi|7522131|pir||T28666 protein kinase C-related kinase PRKSD - S... 227 2e-58
gi|50751352|ref|XP_422357.1| PREDICTED: similar to protein kinas... 225 8e-58
gi|34860837|ref|XP_215718.2| similar to protein kinase C-like 2 ... 224 1e-57
gi|30354738|gb|AAH52073.1| Pkn2 protein [Mus musculus] 224 2e-57
gi|26344119|dbj|BAC35716.1| unnamed protein product [Mus musculus] 224 2e-57
gi|50757368|ref|XP_415491.1| PREDICTED: similar to protein kinas... 224 2e-57
gi|26350541|dbj|BAC38910.1| unnamed protein product [Mus musculus] 224 2e-57
gi|30520013|ref|NP_848769.1| serine/threonine kinase 7; protein ... 224 2e-57
gi|5453974|ref|NP_006247.1| protein kinase N2; protein kinase C-... 222 5e-57
gi|6225860|sp|O08874|PKL2_RAT Protein kinase C-like 2 (Protein-k... 222 5e-57
gi|11493219|emb|CAC17575.1| dJ905H16.1 (protein kinase C-like 2)... 222 5e-57
gi|33303981|gb|AAQ02498.1| protein kinase C-like 2 [synthetic co... 222 5e-57
gi|2586064|gb|AAC13357.1| protein kinase C-related kinase 2 [Xen... 222 7e-57
gi|6174910|sp|Q16512|PKL1_HUMAN Protein kinase C-like 1 (Protein... 220 2e-56
gi|47132589|ref|NP_002732.3| protein kinase N1 isoform 2; serine... 220 2e-56
gi|1093486|prf||2104208A protein kinase C-related kinase:ISOTYPE... 220 2e-56
gi|47132591|ref|NP_998725.1| protein kinase N1 isoform 1; serine... 220 2e-56
gi|38197376|gb|AAH61836.1| Protein kinase C-like 1 [Rattus norve... 220 3e-56
gi|16905491|gb|AAL31374.1| cardiolipin/protease-activated protei... 220 3e-56
gi|25304069|gb|AAH40061.1| Protein kinase C-like 1, isoform 2 [H... 220 3e-56
gi|47223932|emb|CAG06109.1| unnamed protein product [Tetraodon n... 219 3e-56
gi|1085218|pir||S53726 protein kinase PKN - African clawed frog ... 219 3e-56
gi|543444|pir||JC2130 protein kinase (EC 2.7.1.37) - rat 219 5e-56
gi|8394047|ref|NP_058871.1| protein kinase C-like 1; protein kin... 219 5e-56
gi|2707262|gb|AAB92244.1| protein kinase C-related kinase [Pisas... 218 1e-55
gi|50755717|ref|XP_414868.1| PREDICTED: similar to Protein kinas... 218 1e-55
gi|24418929|ref|NP_722500.1| protein kinase N3; hypothetical pro... 218 1e-55
gi|1085381|pir||S48705 serine/threonine protein kinase - human >... 218 1e-55
gi|6981398|ref|NP_036845.1| protein kinase C, beta; protein kina... 217 2e-55
gi|47157322|ref|NP_997700.1| protein kinase C, beta isoform 1; p... 217 2e-55
gi|125540|sp|P04410|KPCB_MOUSE Protein kinase C, beta type (PKC-... 217 2e-55
gi|66721|pir||KIRTC1 protein kinase C (EC 2.7.1.-) beta-I - rat ... 217 2e-55
gi|56920|emb|CAA27756.1| protein kinase C C-terminal region (224... 217 2e-55
gi|2822146|gb|AAB97933.1| Protein kinase C beta (5' partial) spl... 217 2e-55
gi|125539|sp|P05772|KPCB_RABIT Protein kinase C, beta type (PKC-... 216 3e-55
gi|6225857|sp|P70268|PKL1_MOUSE Protein kinase C-like 1 (Protein... 216 4e-55
gi|32813439|ref|NP_796236.2| protein kinase N1; serine/threonine... 216 4e-55
gi|2137689|pir||PC4220 protein kinase (EC 2.7.1.37) - mouse (fra... 216 4e-55
gi|6225593|sp|Q16974|KPC1_APLCA Calcium-dependent protein kinase... 215 7e-55
gi|31198671|ref|XP_308283.1| ENSANGP00000010728 [Anopheles gambi... 215 7e-55
gi|31198669|ref|XP_308282.1| ENSANGP00000022695 [Anopheles gambi... 215 7e-55
gi|47213332|emb|CAF93963.1| unnamed protein product [Tetraodon n... 215 7e-55
gi|228058|prf||1716374A protein kinase C I 215 9e-55
gi|7446458|pir||JC7083 protein kinase (EC 2.7.1.37) N beta - human 214 1e-54
gi|40254851|ref|NP_037487.2| protein kinase PKNbeta [Homo sapien... 214 1e-54
gi|28573947|ref|NP_788294.1| CG2049-PE [Drosophila melanogaster]... 213 4e-54
gi|15292295|gb|AAK93416.1| LD45949p [Drosophila melanogaster] 213 4e-54
gi|28573939|ref|NP_788290.1| CG2049-PB [Drosophila melanogaster]... 213 4e-54
gi|28573941|ref|NP_788291.1| CG2049-PC [Drosophila melanogaster]... 213 4e-54
gi|7446393|pir||PC4287 protein kinase (EC 2.7.1.37) N - fruit fl... 213 4e-54
gi|28573943|ref|NP_788292.1| CG2049-PF [Drosophila melanogaster]... 213 4e-54
gi|6319363|ref|NP_009445.1| Protein Kinase C; Pkc1p [Saccharomyc... 212 7e-54
gi|172177|gb|AAA34878.1| protein kinase C-like protein (PKC1) 212 7e-54
gi|9716257|emb|CAC01625.1| protein kinase C homologue [Tuber bor... 212 7e-54
gi|47227642|emb|CAG09639.1| unnamed protein product [Tetraodon n... 211 9e-54
gi|33589302|gb|AAQ22418.1| RH55776p [Drosophila melanogaster] 211 1e-53
gi|23509142|ref|NP_701810.1| rac-beta serine/threonine protein k... 211 2e-53
gi|46909485|gb|AAT06260.1| protein kinase B-like protein [Plasmo... 211 2e-53
gi|6088096|dbj|BAA85625.1| protein kinase PKNbeta [Homo sapiens] 210 2e-53
gi|7503594|pir||T22318 hypothetical protein F46F6.2 - Caenorhabd... 209 4e-53
gi|25146933|ref|NP_509742.2| PKN/rhophilin/rhotekin rho-binding ... 209 4e-53
gi|32411837|ref|XP_326399.1| PROTEIN KINASE C-LIKE [Neurospora c... 209 4e-53
gi|2499577|sp|Q99014|KPC1_TRIRE Protein kinase C-like >gnl|BL_OR... 209 5e-53
gi|28629057|gb|AAO49460.1| protein kinase C [Leptosphaeria macul... 209 6e-53
gi|4558499|gb|AAD22633.1| protein kinase C; serine/threonine pro... 209 6e-53
gi|6016441|sp|O42632|KPC1_COCHE Protein kinase C-like >gnl|BL_OR... 208 8e-53
gi|38524427|dbj|BAD02338.1| protein kinase C [Emericella nidulans] 208 8e-53
gi|49084020|ref|XP_404243.1| KPC1_ASPNG Protein kinase C-like [A... 208 8e-53
gi|50294680|ref|XP_449751.1| unnamed protein product [Candida gl... 207 1e-52
gi|31206439|ref|XP_312175.1| ENSANGP00000022036 [Anopheles gambi... 207 1e-52
gi|206169|gb|AAA41865.1| protein kinase C type III 207 2e-52
gi|46136289|ref|XP_389836.1| hypothetical protein FG09660.1 [Gib... 207 2e-52
gi|38104629|gb|EAA51167.1| hypothetical protein MG08689.4 [Magna... 207 2e-52
gi|4928705|gb|AAD33693.1| protein kinase C [Magnaporthe grisea] 207 2e-52
gi|34853188|ref|XP_216019.2| similar to cDNA sequence BC034126 [... 207 2e-52
gi|50308473|ref|XP_454238.1| unnamed protein product [Kluyveromy... 207 2e-52
gi|6102720|emb|CAB59301.1| protein kinase C [Botryotinia fuckeli... 207 2e-52
gi|15074866|emb|CAC48007.1| protein kinase C homologue [Tuber ma... 206 3e-52
gi|2499576|sp|Q00078|KPC1_ASPNG Protein kinase C-like >gnl|BL_OR... 206 3e-52
gi|12005625|gb|AAG44542.1| protein kinase C [Blumeria graminis] 206 4e-52
gi|6016443|sp|P87253|KPC1_NEUCR Protein kinase C-like >gnl|BL_OR... 206 4e-52
gi|31240263|ref|XP_320545.1| ENSANGP00000008680 [Anopheles gambi... 206 5e-52
gi|22087742|gb|AAM91026.1| protein kinase C-related kinase [Hydr... 205 9e-52
gi|30172014|gb|AAP20604.1| protein kinase C [Pichia pastoris] 205 9e-52
gi|4996216|dbj|BAA78372.1| PKC lambda [Rattus norvegicus] 204 1e-51
gi|38112351|gb|AAR11263.1| protein kinase C iota [Pan troglodyte... 204 1e-51
gi|3114956|emb|CAA73553.1| Serine/Threonine protein kinase [Sube... 204 1e-51
gi|33304197|gb|AAQ02606.1| protein kinase C, iota [synthetic con... 204 1e-51
gi|631750|pir||A53758 protein kinase C (EC 2.7.1.-) lambda - mouse 204 1e-51
gi|6679349|ref|NP_032883.1| protein kinase C, lambda [Mus muscul... 204 1e-51
gi|6016444|sp|Q16975|KPC2_APLCA Calcium-independent protein kina... 204 1e-51
gi|34856774|ref|XP_342224.1| protein kinase C, lambda [Rattus no... 204 1e-51
gi|48255885|ref|NP_002731.3| protein kinase C, iota; atypical pr... 204 1e-51
gi|39585491|emb|CAE70574.1| Hypothetical protein CBG17230 [Caeno... 204 1e-51
gi|45185877|ref|NP_983593.1| ACR191Cp [Eremothecium gossypii] >g... 204 2e-51
gi|34874121|ref|XP_343976.1| protein kinase C, alpha [Rattus nor... 204 2e-51
gi|35396780|gb|AAQ84896.1| protein kinase C 1 [Cryptococcus neof... 204 2e-51
gi|18859259|ref|NP_571930.1| protein kinase C, iota [Danio rerio... 204 2e-51
gi|22085162|gb|AAM90321.1| putative protein kinase C epsilon [Li... 204 2e-51
gi|28502762|gb|AAH47164.1| Prkci protein [Danio rerio] 204 2e-51
gi|49899150|gb|AAH75736.1| Prkci protein [Danio rerio] 204 2e-51
gi|125552|sp|P05696|KPCA_RAT Protein kinase C, alpha type (PKC-a... 204 2e-51
gi|55132|emb|CAA36907.1| protein kinase C [Mus musculus] >gnl|BL... 204 2e-51
gi|66717|pir||KIMSCA protein kinase C (EC 2.7.1.-) alpha - mouse... 204 2e-51
gi|4506067|ref|NP_002728.1| protein kinase C, alpha; protein kin... 204 2e-51
gi|9885776|gb|AAG01528.1| atypical protein kinase C [Drosophila ... 204 2e-51
gi|21392154|gb|AAM48431.1| RE60936p [Drosophila melanogaster] 204 2e-51
gi|24653760|ref|NP_524892.2| CG10261-PA [Drosophila melanogaster... 204 2e-51
gi|27807061|ref|NP_777012.1| protein kinase C, beta 1 polypeptid... 203 3e-51
gi|206189|gb|AAA41875.1| protein kinase C type II 203 3e-51
gi|66724|pir||KIRTC2 protein kinase C (EC 2.7.1.-) beta-II - rat... 203 3e-51
gi|20127450|ref|NP_002729.2| protein kinase C, beta isoform 2; p... 203 3e-51
gi|6679345|ref|NP_032881.1| protein kinase C, beta [Mus musculus... 203 3e-51
gi|2822147|gb|AAB97934.1| Protein kinase C beta (5' partial) spl... 203 3e-51
gi|50752484|ref|XP_422798.1| PREDICTED: similar to Protein kinas... 203 3e-51
gi|35396778|gb|AAQ84895.1| protein kinase C 1 [Cryptococcus neof... 203 3e-51
gi|50259580|gb|EAL22253.1| hypothetical protein CNBC3910 [Crypto... 203 3e-51
gi|41055807|ref|NP_957272.1| similar to protein kinase C, beta [... 203 3e-51
gi|66725|pir||KIRBC2 protein kinase C (EC 2.7.1.-) beta-II - rab... 202 4e-51
gi|125551|sp|P10102|KPCA_RABIT Protein kinase C, alpha type (PKC... 202 4e-51
gi|27806089|ref|NP_776860.1| protein kinase, C alpha [Bos taurus... 202 6e-51
gi|31418467|gb|AAH53365.1| Unknown (protein for MGC:61512) [Homo... 202 7e-51
gi|33304209|gb|AAQ02612.1| ribosomal protein S6 kinase, 70kDa, p... 202 7e-51
gi|12848541|dbj|BAB27991.1| unnamed protein product [Mus musculus] 202 7e-51
gi|125695|sp|P23443|K6B1_HUMAN Ribosomal protein S6 kinase (S6K)... 202 7e-51
gi|125696|sp|P21425|K6B1_RAT Ribosomal protein S6 kinase I (S6K)... 202 7e-51
gi|26328523|dbj|BAC28000.1| unnamed protein product [Mus musculus] 202 7e-51
gi|109371|pir||S12906 probable ribosomal protein S6 kinase (EC 2... 202 7e-51
gi|23512346|gb|AAH38491.1| Rps6kb1 protein [Mus musculus] 202 7e-51
gi|4506737|ref|NP_003152.1| ribosomal protein S6 kinase, 70kDa, ... 202 7e-51
gi|45430051|ref|NP_991385.1| p70S6K [Bos taurus] >gnl|BL_ORD_ID|... 202 7e-51
gi|6016442|sp|Q25378|KPC1_LYTPI Protein kinase C >gnl|BL_ORD_ID|... 202 7e-51
gi|125550|sp|P20444|KPCA_MOUSE Protein kinase C, alpha type (PKC... 201 1e-50
gi|6755078|ref|NP_035231.1| protein kinase C, alpha [Mus musculu... 201 1e-50
gi|303941|dbj|BAA03268.1| protein kinase [Schizosaccharomyces po... 201 1e-50
gi|19112742|ref|NP_595950.1| protein kinase c-like 2 [Schizosacc... 201 1e-50
gi|32566197|ref|NP_741872.2| protein kinase C (78.0 kD) (pkc-2) ... 201 1e-50
gi|1778592|gb|AAB40869.1| protein kinase C2 B isoform [Caenorhab... 201 1e-50
gi|48097317|ref|XP_391874.1| similar to ENSANGP00000009078 [Apis... 201 1e-50
gi|7511603|pir||T15903 protein kinase C homolog - Caenorhabditis... 201 1e-50
gi|21392563|gb|AAA68709.2| Protein kinase c protein 2, isoform c... 201 1e-50
gi|39596192|emb|CAE69829.1| Hypothetical protein CBG16150 [Caeno... 201 1e-50
gi|25146870|ref|NP_741871.1| protein kinase C (77.6 kD) (pkc-2) ... 201 1e-50
gi|1778590|gb|AAB40868.1| protein kinase C2 A isoform [Caenorhab... 201 1e-50
gi|50758354|ref|XP_415882.1| PREDICTED: similar to Ribosomal pro... 201 2e-50
gi|50550707|ref|XP_502826.1| hypothetical protein [Yarrowia lipo... 200 3e-50
gi|47223946|emb|CAG06123.1| unnamed protein product [Tetraodon n... 200 3e-50
gi|17136402|ref|NP_476682.1| CG6622-PA [Drosophila melanogaster]... 199 4e-50
gi|48141855|ref|XP_397273.1| similar to ENSANGP00000008680 [Apis... 199 4e-50
gi|47221653|emb|CAF97918.1| unnamed protein product [Tetraodon n... 199 4e-50
gi|18314569|gb|AAH22016.1| Protein kinase C, iota [Homo sapiens] 199 4e-50
gi|24654282|ref|NP_725626.1| CG6622-PB [Drosophila melanogaster]... 199 4e-50
gi|23478593|gb|EAA15636.1| kinase Akt/PKB-related [Plasmodium yo... 199 4e-50
gi|91277|pir||C32571 ribosomal protein S6 kinase II (EC 2.7.-.-)... 199 5e-50
gi|104167|pir||A37237 protein kinase C (EC 2.7.1.-) I - African ... 199 5e-50
gi|47086473|ref|NP_997951.1| ribosomal protein S6 kinase polypep... 199 5e-50
gi|50547917|ref|XP_501428.1| hypothetical protein [Yarrowia lipo... 199 5e-50
gi|33354095|dbj|BAC81131.1| RPS6KA3 [Homo sapiens] >gnl|BL_ORD_I... 199 5e-50
gi|4759050|ref|NP_004577.1| ribosomal protein S6 kinase, 90kDa, ... 199 5e-50
gi|22507357|ref|NP_683747.1| ribosomal protein S6 kinase polypep... 199 5e-50
gi|401774|gb|AAC82495.1| ribosomal protein S6 kinase 3 [Homo sap... 199 5e-50
gi|20149547|ref|NP_002944.2| ribosomal protein S6 kinase, 90kDa,... 199 5e-50
gi|33304069|gb|AAQ02542.1| ribosomal protein S6 kinase, 90kDa, p... 199 5e-50
gi|125692|sp|P18652|K6AA_CHICK Ribosomal protein S6 kinase II al... 199 6e-50
gi|47230027|emb|CAG10441.1| unnamed protein product [Tetraodon n... 199 6e-50
gi|50730201|ref|XP_416804.1| PREDICTED: similar to ribosomal pro... 199 6e-50
gi|47210692|emb|CAF93761.1| unnamed protein product [Tetraodon n... 198 8e-50
gi|2073444|emb|CAA73363.1| protein kinase C [Hydra vulgaris] 198 8e-50
gi|22023043|emb|CAD30698.1| protein kinase C, alpha type [Takifu... 198 8e-50
gi|2073446|emb|CAA73362.1| protein kinase C [Hydra vulgaris] 198 8e-50
gi|29294760|gb|AAH49076.1| Rps6ka1 protein [Mus musculus] 198 8e-50
gi|2117824|pir||I51901 ribosomal protein S6 kinase 2 (EC 2.7.1.-... 198 8e-50
gi|13592065|ref|NP_112369.1| S6 protein kinase (Rsk-1) [Rattus n... 198 8e-50
gi|14010889|ref|NP_114191.1| S6 kinase [Rattus norvegicus] >gnl|... 198 8e-50
gi|39596862|emb|CAE59089.1| Hypothetical protein CBG02381 [Caeno... 198 1e-49
gi|41053359|ref|NP_957323.1| similar to Protein C kinase 53E [Da... 198 1e-49
gi|125558|sp|P05128|KPCG_BOVIN Protein kinase C, gamma type (PKC... 198 1e-49
gi|6755080|ref|NP_035232.1| protein kinase C, gamma [Mus musculu... 197 1e-49
gi|50604098|gb|AAH78065.1| Unknown (protein for MGC:82897) [Xeno... 197 1e-49
gi|104168|pir||B37237 protein kinase C (EC 2.7.1.-) II - African... 197 1e-49
gi|13384594|ref|NP_002730.1| protein kinase C, gamma; Protein ki... 197 2e-49
gi|50757861|ref|XP_415682.1| PREDICTED: similar to Protein kinas... 197 2e-49
gi|47085805|ref|NP_998241.1| zgc:55713 [Danio rerio] >gnl|BL_ORD... 197 2e-49
gi|35497|emb|CAA78820.1| protein kinase C gamma [Homo sapiens] 197 2e-49
gi|24650924|ref|NP_524545.2| CG1954-PA [Drosophila melanogaster]... 197 2e-49
gi|2065190|emb|CAA72926.1| protein kinase C [Hydra vulgaris] 197 2e-49
gi|1709606|sp|P36582|PCK1_SCHPO Protein kinase C-like 1 197 2e-49
gi|486786|pir||S35362 protein kinase C (EC 2.7.1.-) pck1 - fissi... 197 2e-49
gi|19114649|ref|NP_593737.1| protein kinase c-like 1 (EC 2.7.1.-... 197 2e-49
gi|39794417|gb|AAH64239.1| LOC394938 protein [Xenopus tropicalis] 197 2e-49
gi|125547|sp|P13678|KPC3_DROME Protein kinase C (PKC) (dPKC98F) ... 197 2e-49
gi|6537166|gb|AAF15553.1| Rsk-2 [Xenopus laevis] 197 2e-49
gi|48104993|ref|XP_395876.1| similar to p70 ribosomal protein S6... 196 3e-49
gi|50303505|ref|XP_451694.1| unnamed protein product [Kluyveromy... 196 3e-49
gi|17562588|ref|NP_506014.1| protein kinase C (80.2 kD) (pkc-1) ... 196 3e-49
gi|50555624|ref|XP_505220.1| hypothetical protein [Yarrowia lipo... 196 3e-49
gi|7504545|pir||T22856 hypothetical protein F57F5.5 - Caenorhabd... 196 3e-49
gi|47230126|emb|CAG10540.1| unnamed protein product [Tetraodon n... 196 3e-49
gi|4582255|emb|CAB40193.1| kinase [Xenopus laevis] 196 4e-49
gi|125560|sp|P10829|KPCG_RABIT Protein kinase C, gamma type (PKC... 196 4e-49
gi|49119294|gb|AAH73353.1| Unknown (protein for MGC:80770) [Xeno... 196 4e-49
gi|16648134|gb|AAL25332.1| GH13631p [Drosophila melanogaster] 196 4e-49
gi|4157977|emb|CAA76911.1| protein kinase C [Geodia cydonium] 196 4e-49
gi|17533011|ref|NP_495011.1| protein kinase C, iota/lambda/zeta ... 196 4e-49
gi|49118486|gb|AAH73469.1| Rps6kb1-A protein [Xenopus laevis] 196 4e-49
gi|50748818|ref|XP_421417.1| PREDICTED: similar to protein kinas... 196 5e-49
gi|47224750|emb|CAG00344.1| unnamed protein product [Tetraodon n... 196 5e-49
gi|13605770|gb|AAK32877.1| 90-kDa ribosomal protein S6 kinase [R... 195 7e-49
gi|25168263|ref|NP_005618.2| serum/glucocorticoid regulated kina... 195 7e-49
gi|13431833|sp|Q9XT18|SGK1_RABIT Serine/threonine-protein kinase... 195 7e-49
gi|1220554|gb|AAA91961.1| type Z protein kinase c 195 7e-49
gi|30585051|gb|AAP36798.1| Homo sapiens protein kinase C, zeta [... 195 7e-49
gi|11968080|ref|NP_071952.1| protein kinase C, zeta; 14 - 3 - 3 ... 195 7e-49
gi|478322|pir||JN0877 protein kinase C (EC 2.7.1.-) zeta - human... 195 7e-49
gi|14165515|gb|AAH08058.1| Protein kinase C, zeta [Homo sapiens]... 195 7e-49
gi|6679355|ref|NP_032886.1| protein kinase C, zeta [Mus musculus... 195 7e-49
gi|10864650|ref|NP_002735.2| protein kinase C, zeta [Homo sapien... 195 7e-49
gi|35501|emb|CAA78813.1| protein kinase C zeta [Homo sapiens] 195 7e-49
gi|35505544|gb|AAH57694.1| Protein kinase C zeta subspecies [Mus... 195 7e-49
gi|630707|pir||A53530 protein kinase C (EC 2.7.1.-) epsilon-rela... 195 7e-49
gi|33303865|gb|AAQ02446.1| serum/glucocorticoid regulated kinase... 195 7e-49
gi|31158356|dbj|BAC76975.1| protein kinase C-zeta 2 [Mus musculus] 195 7e-49
gi|206195|gb|AAA41878.1| protein kinase C zeta subspecies 195 7e-49
gi|39592150|emb|CAE75370.1| Hypothetical protein CBG23354 [Caeno... 195 9e-49
gi|6755490|ref|NP_035491.1| serum/glucocorticoid regulated kinas... 195 9e-49
gi|477098|pir||A48094 serum and glucocorticoid-regulated kinase ... 195 9e-49
gi|47124333|gb|AAH70401.1| Sgk protein [Mus musculus] 195 9e-49
gi|45383215|ref|NP_989807.1| serum- and glucocorticoid-induced k... 195 9e-49
gi|527675|gb|AAA75362.1| protein kinase C subspecies zeta 195 9e-49
gi|12060812|gb|AAG48248.1| p70 ribosomal protein S6 kinase [Arte... 195 9e-49
gi|3114989|emb|CAA73554.1| Serine/Threonine protein kinase [Syco... 194 1e-48
gi|50415396|gb|AAH78067.1| Unknown (protein for MGC:82916) [Xeno... 194 1e-48
gi|227491|prf||1704381B protein kinase C II 194 1e-48
gi|50759195|ref|XP_417561.1| PREDICTED: similar to protein kinas... 194 1e-48
gi|46444978|gb|EAL04249.1| hypothetical protein CaO19.13322 [Can... 194 1e-48
gi|629915|pir||S47220 protein kinase C (EC 2.7.1.-) PKC1 - yeast... 194 1e-48
gi|1170687|sp|P43057|KPC1_CANAL Protein kinase C-like 1 (PKC 1) ... 194 1e-48
gi|34861393|ref|XP_341980.1| similar to S6 kinase 2 [Rattus norv... 194 2e-48
gi|24658719|ref|NP_523941.2| CG10539-PA [Drosophila melanogaster... 194 2e-48
gi|66734|pir||KIRBCE protein kinase C (EC 2.7.1.-) epsilon - rabbit 194 2e-48
gi|125556|sp|P10830|KPCE_RABIT Protein kinase C, epsilon type (n... 194 2e-48
gi|6755084|ref|NP_035234.1| protein kinase C, epsilon [Mus muscu... 194 2e-48
gi|4885563|ref|NP_005391.1| protein kinase C, epsilon [Homo sapi... 194 2e-48
gi|47226221|emb|CAG08368.1| unnamed protein product [Tetraodon n... 194 2e-48
gi|3914977|sp|O00141|SGK1_HUMAN Serine/threonine-protein kinase ... 194 2e-48
gi|38086255|ref|XP_124895.2| similar to protein kinase C zeta [M... 194 2e-48
gi|49359177|gb|AAT65503.1| protein kinase C epsilon [Rattus norv... 194 2e-48
gi|19075510|ref|NP_588010.1| putative proliferation-associated s... 193 3e-48
gi|9507093|ref|NP_062105.1| serum/glucocorticoid regulated kinas... 193 3e-48
gi|50745818|ref|XP_420257.1| PREDICTED: similar to Ribosomal pro... 193 3e-48
gi|3688803|gb|AAC62398.1| unknown [Xenopus laevis] 193 3e-48
gi|49116933|gb|AAH73077.1| Sgk protein [Xenopus laevis] 193 3e-48
gi|50740446|ref|XP_419464.1| PREDICTED: similar to Protein kinas... 193 3e-48
gi|48097410|ref|XP_391892.1| similar to CG2049-PB [Apis mellifera] 192 5e-48
gi|1778160|gb|AAC47429.1| 70 kDa S6 kinase [Drosophila melanogas... 192 5e-48
gi|39930373|ref|NP_058867.1| protein kinase C, epsilon [Rattus n... 192 5e-48
gi|3024076|sp|O19111|KPCZ_RABIT Protein kinase C, zeta type (nPK... 192 6e-48
gi|49257650|gb|AAH74305.1| Unknown (protein for MGC:84110) [Xeno... 192 6e-48
gi|47225434|emb|CAG11917.1| unnamed protein product [Tetraodon n... 192 6e-48
gi|4506739|ref|NP_003943.1| ribosomal protein S6 kinase, 70kDa, ... 192 8e-48
gi|32425471|gb|AAH06106.2| RPS6KB2 protein [Homo sapiens] 192 8e-48
gi|50415318|gb|AAH78019.1| PKC-delta1 protein [Xenopus laevis] 192 8e-48
gi|32480479|dbj|BAC79119.1| protein kinase-delta1 [Xenopus laevis] 192 8e-48
gi|37588972|gb|AAH00094.2| RPS6KB2 protein [Homo sapiens] 192 8e-48
gi|19923570|ref|NP_066958.2| ribosomal protein S6 kinase, 90kDa,... 192 8e-48
gi|7434394|pir||JE0377 p70 S6 kinase (EC 2.7.-.-) - human >gnl|B... 192 8e-48
gi|33303975|gb|AAQ02495.1| ribosomal protein S6 kinase, 90kDa, p... 192 8e-48
gi|34853790|ref|XP_341759.1| ribosomal protein S6 kinase, 90kD, ... 192 8e-48
gi|12643872|sp|Q9UBS0|K6B2_HUMAN Ribosomal protein S6 kinase bet... 192 8e-48
gi|50287865|ref|XP_446362.1| unnamed protein product [Candida gl... 192 8e-48
gi|33303901|gb|AAQ02464.1| ribosomal protein S6 kinase, 70kDa, p... 192 8e-48
gi|32480481|dbj|BAC79120.1| protein kinase-delta2 [Xenopus laevis] 191 1e-47
gi|31543511|ref|NP_032882.2| protein kinase C, eta [Mus musculus... 191 1e-47
gi|45187484|ref|NP_983707.1| ADL389Wp [Eremothecium gossypii] >g... 191 1e-47
gi|22087745|gb|AAM91027.1| protein kinase B [Hydra vulgaris] 191 1e-47
gi|50741701|ref|XP_419611.1| PREDICTED: similar to ribosomal pro... 191 1e-47
gi|12620233|gb|AAG60621.1| S6 kinase [Aplysia californica] 191 1e-47
gi|13676454|dbj|BAB41150.1| hypothetical protein [Macaca fascicu... 191 1e-47
gi|13592027|ref|NP_112347.1| protein kinase C-eta [Rattus norveg... 191 1e-47
gi|125693|sp|P10665|K6AA_XENLA Ribosomal protein S6 kinase II al... 191 1e-47
gi|401772|gb|AAC82496.1| ribosomal protein S6 kinase 2 [Homo sap... 191 1e-47
gi|50552438|ref|XP_503629.1| hypothetical protein [Yarrowia lipo... 191 2e-47
gi|6166243|sp|Q15349|K6A2_HUMAN Ribosomal protein S6 kinase alph... 191 2e-47
gi|41056055|ref|NP_956367.1| Unknown (protein for MGC:66139); wu... 191 2e-47
gi|227604|prf||1707301A protein kinase 190 2e-47
gi|46442847|gb|EAL02133.1| hypothetical protein CaO19.829 [Candi... 190 2e-47
gi|125563|sp|P23298|KPCL_MOUSE Protein kinase C, eta type (nPKC-... 190 2e-47
gi|10946894|ref|NP_067460.1| ribosomal protein S6 kinase, polype... 190 2e-47
gi|6321999|ref|NP_012075.1| protein kinase involved in growth co... 190 2e-47
gi|4426|emb|CAA31073.1| unnamed protein product [Saccharomyces c... 190 2e-47
gi|730723|sp|P11792|SCH9_YEAST Serine/threonine-protein kinase S... 190 2e-47
gi|25005142|gb|AAN71007.1| ribosomal protein S6 kinase [Mus musc... 190 3e-47
gi|28557781|ref|NP_006246.2| protein kinase C, eta [Homo sapiens... 190 3e-47
gi|33243964|gb|AAH55331.1| Ribosomal protein S6 kinase, polypept... 190 3e-47
gi|6755374|ref|NP_035429.1| ribosomal protein S6 kinase, polypep... 190 3e-47
gi|12860267|dbj|BAB31901.1| unnamed protein product [Mus musculus] 190 3e-47
gi|28300431|gb|AAO37581.1| RPS6KA2 [Mus musculus] 190 3e-47
gi|15787861|dbj|BAB68538.1| protein kinase C thetaII [Mus musculus] 190 3e-47
gi|1346393|sp|P24723|KPCL_HUMAN Protein kinase C, eta type (nPKC... 190 3e-47
gi|6679353|ref|NP_032885.1| protein kinase C, theta [Mus musculu... 190 3e-47
gi|17555946|ref|NP_499447.1| s6 kinase (3M341) [Caenorhabditis e... 190 3e-47
gi|40363533|ref|NP_954682.1| serum/glucocorticoid regulated kina... 189 4e-47
gi|3114991|emb|CAA73557.1| Serine/Threonine protein kinase [Syco... 189 4e-47
gi|558099|gb|AAA75571.1| protein kinase C-theta 189 7e-47
gi|5453976|ref|NP_006248.1| protein kinase C, theta [Homo sapien... 189 7e-47
gi|50427075|ref|XP_462144.1| unnamed protein product [Debaryomyc... 189 7e-47
gi|24641525|ref|NP_511171.2| CG10524-PA [Drosophila melanogaster... 189 7e-47
gi|10334453|emb|CAC10200.1| bA563J2.2 (protein kinase C theta ) ... 189 7e-47
gi|125694|sp|P10666|K6AB_XENLA Ribosomal protein S6 kinase II be... 188 9e-47
gi|49256532|gb|AAH71102.1| Unknown (protein for MGC:81220) [Xeno... 188 9e-47
gi|32420385|ref|XP_330636.1| hypothetical protein [Neurospora cr... 188 1e-46
gi|38109783|gb|EAA55600.1| hypothetical protein MG01251.4 [Magna... 188 1e-46
gi|7019312|emb|CAB75578.1| protein kinase C delta [Rattus norveg... 188 1e-46
gi|18959250|ref|NP_579841.1| protein kinase C, delta [Rattus nor... 188 1e-46
gi|49093828|ref|XP_408375.1| hypothetical protein AN4238.2 [Aspe... 187 1e-46
gi|31205767|ref|XP_311835.1| ENSANGP00000018211 [Anopheles gambi... 187 2e-46
gi|19310195|dbj|BAB85907.1| p90 ribosomal S6 kinase [Asterina pe... 187 2e-46
gi|66731|pir||KIMSCD protein kinase C (EC 2.7.1.-) delta - mouse... 187 2e-46
gi|46107178|ref|XP_380648.1| hypothetical protein FG00472.1 [Gib... 187 2e-46
gi|49067618|ref|XP_398099.1| hypothetical protein UM00484.1 [Ust... 186 3e-46
gi|37702159|gb|AAR00731.1| protein kinase C type beta [Schistoso... 186 3e-46
gi|6755082|ref|NP_035233.1| protein kinase C, delta; protein kin... 186 4e-46
gi|4150896|emb|CAA73682.1| serine /threonine protein kinase [Rha... 186 6e-46
gi|50754129|ref|XP_414256.1| PREDICTED: similar to protein kinas... 186 6e-46
gi|3116064|emb|CAA11527.1| s-sgk1 [Squalus acanthias] 186 6e-46
gi|3116066|emb|CAA11528.1| s-sgk2 [Squalus acanthias] 186 6e-46
gi|50292225|ref|XP_448545.1| unnamed protein product [Candida gl... 185 7e-46
gi|9844082|emb|CAC03748.1| cAMP-dependent protein kinase catalyt... 185 7e-46
gi|45645188|sp|Q21734|KS6A_CAEEL Putative ribosomal protein S6 k... 185 9e-46
gi|45478134|gb|AAS66238.1| LRRGT00147 [Rattus norvegicus] 185 9e-46
gi|33300395|emb|CAE17938.1| Hypothetical protein T01H8.1c [Caeno... 185 9e-46
gi|39595602|emb|CAE67103.1| Hypothetical protein CBG12516 [Caeno... 185 9e-46
gi|17508707|ref|NP_492319.1| ribosomal protein S6 kinase (rsk-1)... 185 9e-46
gi|17508705|ref|NP_492320.1| ribosomal protein S6 kinase (rsk-1)... 185 9e-46
gi|33300393|emb|CAB02301.2| Hypothetical protein T01H8.1b [Caeno... 185 9e-46
gi|31377782|ref|NP_006245.2| protein kinase C, delta [Homo sapie... 184 1e-45
gi|50427081|ref|XP_462147.1| unnamed protein product [Debaryomyc... 184 1e-45
gi|50806296|ref|XP_428809.1| PREDICTED: similar to protein kinas... 184 1e-45
gi|520587|dbj|BAA01381.1| protein kinase C delta-type [Homo sapi... 184 1e-45
gi|33304013|gb|AAQ02514.1| protein kinase C, delta [synthetic co... 184 2e-45
gi|547803|sp|Q05655|KPCD_HUMAN Protein kinase C, delta type (nPK... 184 2e-45
gi|39584758|emb|CAE67653.1| Hypothetical protein CBG13216 [Caeno... 184 2e-45
gi|445070|prf||1908384B protein kinase 183 3e-45
gi|47207176|emb|CAF90287.1| unnamed protein product [Tetraodon n... 183 3e-45
gi|47213969|emb|CAG00660.1| unnamed protein product [Tetraodon n... 183 3e-45
gi|47210537|emb|CAF90656.1| unnamed protein product [Tetraodon n... 183 4e-45
gi|6323751|ref|NP_013822.1| protein kinase; Ypk2p [Saccharomyces... 182 5e-45
gi|17570293|ref|NP_510647.1| serum and Glucocorticoid inducible ... 182 5e-45
gi|50420447|ref|XP_458760.1| unnamed protein product [Debaryomyc... 182 5e-45
gi|39596349|emb|CAE69987.1| Hypothetical protein CBG16386 [Caeno... 182 6e-45
gi|47212674|emb|CAF94155.1| unnamed protein product [Tetraodon n... 182 6e-45
gi|1730069|sp|P54644|KRAC_DICDI RAC-family serine/threonine-prot... 182 6e-45
gi|47229583|emb|CAG06779.1| unnamed protein product [Tetraodon n... 181 1e-44
gi|33303995|gb|AAQ02505.1| serum/glucocorticoid regulated kinase... 180 3e-44
gi|25168261|ref|NP_733794.1| serum/glucocorticoid regulated kina... 180 3e-44
gi|17542632|ref|NP_499860.1| tetradecanoyl Phorbol Acetate resis... 180 3e-44
gi|7657526|ref|NP_055311.1| ribosomal protein S6 kinase, 90kDa, ... 180 3e-44
gi|7511605|pir||T33399 protein kinase C homolog tpa-1, splice fo... 180 3e-44
gi|33878427|gb|AAH14037.2| SGK2 protein [Homo sapiens] 180 3e-44
gi|303529|dbj|BAA03556.1| TPA-1 [Caenorhabditis elegans] 180 3e-44
gi|11181910|emb|CAC16111.1| bA54F22.1.1 (ribosomal protein S6 ki... 180 3e-44
gi|20127541|ref|NP_057360.2| serum/glucocorticoid regulated kina... 180 3e-44
gi|17542634|ref|NP_499861.1| tetradecanoyl Phorbol Acetate resis... 180 3e-44
gi|33303997|gb|AAQ02506.1| ribosomal protein S6 kinase, 90kDa, p... 180 3e-44
gi|32414173|ref|XP_327566.1| hypothetical protein ( (AY029769) p... 179 4e-44
gi|47218293|emb|CAG04125.1| unnamed protein product [Tetraodon n... 179 5e-44
gi|29789163|ref|NP_080225.1| ribosomal protein S6 kinase polypep... 179 7e-44
gi|50731568|ref|XP_418280.1| PREDICTED: similar to Serine/threon... 179 7e-44
gi|49168616|emb|CAG38803.1| RPS6KA6 [Homo sapiens] 179 7e-44
gi|50758633|ref|XP_417346.1| PREDICTED: similar to serum/glucoco... 179 7e-44
gi|34881194|ref|XP_228473.2| similar to Ribosomal protein S6 kin... 179 7e-44
gi|47550719|ref|NP_999873.1| protein kinase C, delta; wu:fv43b11... 179 7e-44
gi|32450549|gb|AAH54113.1| Rps6ka6 protein [Mus musculus] 178 9e-44
gi|1362234|pir||S55694 protein kinase (EC 2.7.1.37) sck1, cAMP-d... 178 9e-44
gi|19114666|ref|NP_593754.1| cAMP-dependent protein kinase, sck1... 178 9e-44
gi|34860642|ref|XP_342571.1| serum/glucocorticoid regulated kina... 178 1e-43
gi|47220463|emb|CAG03243.1| unnamed protein product [Tetraodon n... 178 1e-43
gi|7305483|ref|NP_038759.1| serum/glucocorticoid regulated kinas... 178 1e-43
gi|103330|pir||A32545 protein kinase C (EC 2.7.1.-) - fruit fly ... 178 1e-43
gi|4938231|emb|CAA28890.2| protein kinase C [Drosophila melanoga... 178 1e-43
gi|38110989|gb|EAA56628.1| hypothetical protein MG06599.4 [Magna... 178 1e-43
gi|20072336|gb|AAH26549.1| Serum/glucocorticoid regulated kinase... 178 1e-43
gi|47210832|emb|CAF93173.1| unnamed protein product [Tetraodon n... 177 2e-43
gi|458284|gb|AAA57318.1| serine/threonine protein kinase 177 2e-43
gi|15072452|gb|AAK40343.1| protein kinase 1 [Cryphonectria paras... 177 2e-43
gi|39587559|emb|CAE58497.1| Hypothetical protein CBG01645 [Caeno... 177 2e-43
gi|4115530|dbj|BAA36408.1| PKC delta II [Mus musculus] 177 2e-43
gi|50255581|gb|EAL18314.1| hypothetical protein CNBJ2370 [Crypto... 177 2e-43
gi|46433231|gb|EAK92679.1| hypothetical protein CaO19.399 [Candi... 177 2e-43
gi|47218020|emb|CAG11425.1| unnamed protein product [Tetraodon n... 177 2e-43
gi|17136716|ref|NP_476863.1| CG6518-PA [Drosophila melanogaster]... 177 2e-43
gi|464395|sp|P28178|PK2_DICDI Protein kinase 2 >gnl|BL_ORD_ID|12... 177 3e-43
gi|28573945|ref|NP_788293.1| CG2049-PD [Drosophila melanogaster]... 176 3e-43
gi|3393042|emb|CAA06507.1| eye-specific protein kinase C [Callip... 176 3e-43
gi|6677811|ref|NP_033123.1| ribosomal protein S6 kinase polypept... 176 4e-43
gi|45185202|ref|NP_982919.1| ABL028Wp [Eremothecium gossypii] >g... 176 6e-43
gi|50291879|ref|XP_448372.1| unnamed protein product [Candida gl... 176 6e-43
gi|46122935|ref|XP_386021.1| hypothetical protein FG05845.1 [Gib... 176 6e-43
gi|445069|prf||1908384A protein kinase 176 6e-43
gi|6322723|ref|NP_012796.1| 76.5 kDa Serine/threonine protein ki... 176 6e-43
gi|172181|gb|AAA34880.1| protein kinase 176 6e-43
gi|19115752|ref|NP_594840.1| serine/threonine protein kinase [Sc... 175 8e-43
gi|49097300|ref|XP_410110.1| hypothetical protein AN5973.2 [Aspe... 175 1e-42
gi|7649389|emb|CAB89082.1| S6 ribosomal protein kinase [Asparagu... 174 2e-42
gi|31563382|ref|NP_037389.4| serum/glucocorticoid regulated kina... 174 2e-42
gi|33303813|gb|AAQ02420.1| serum/glucocorticoid regulated kinase... 174 2e-42
gi|6466010|gb|AAF12758.1| protein kinase [Homo sapiens] >gnl|BL_... 174 2e-42
gi|26327211|dbj|BAC27349.1| unnamed protein product [Mus musculus] 173 3e-42
gi|18959280|ref|NP_573483.1| serum/glucocorticoid regulated kina... 173 3e-42
gi|17390848|gb|AAH18363.1| Sgk3 protein [Mus musculus] 173 3e-42
gi|31240261|ref|XP_320544.1| ENSANGP00000015337 [Anopheles gambi... 173 3e-42
gi|17402861|gb|AAF27051.2| SGK-like protein SGKL [Homo sapiens] 173 4e-42
gi|3411161|gb|AAC67395.1| mitogen- and stress-activated protein ... 172 5e-42
gi|4506735|ref|NP_003933.1| ribosomal protein S6 kinase, 90kDa, ... 172 5e-42
gi|15231959|ref|NP_187484.1| serine/threonine protein kinase (PK... 172 5e-42
gi|28839796|gb|AAH47896.1| RPS6KA4 protein [Homo sapiens] 172 5e-42
gi|47218993|emb|CAG02031.1| unnamed protein product [Tetraodon n... 172 6e-42
gi|3114958|emb|CAA73556.1| Serine/Threonine protein kinase [Sube... 172 6e-42
gi|24643817|ref|NP_523437.2| CG17596-PA [Drosophila melanogaster... 172 8e-42
gi|28416327|gb|AAO42636.1| SD05277p [Drosophila melanogaster] 172 8e-42
gi|31239753|ref|XP_320290.1| ENSANGP00000009078 [Anopheles gambi... 172 8e-42
gi|455163|gb|AAA50509.1| p90 ribosomal S6 kinase 172 8e-42
gi|48096660|ref|XP_394743.1| similar to CG10524-PA [Apis mellifera] 171 1e-41
gi|31216024|ref|XP_316151.1| ENSANGP00000020399 [Anopheles gambi... 171 1e-41
gi|50748598|ref|XP_421318.1| PREDICTED: similar to ribosomal pro... 170 2e-41
gi|50304295|ref|XP_452097.1| unnamed protein product [Kluyveromy... 170 2e-41
gi|34876345|ref|XP_341554.1| protein kinase C, theta [Rattus nor... 169 4e-41
gi|48099894|ref|XP_394955.1| similar to ribosomal protein S6 kin... 169 4e-41
gi|21166148|gb|AAM43765.1| similar to Dictyostelium discoideum (... 169 4e-41
gi|9910454|ref|NP_064308.1| ribosomal protein S6 kinase, polypep... 169 5e-41
gi|2911462|gb|AAC04357.1| serine/threonine protein kinase [Colle... 169 7e-41
gi|15277982|gb|AAH12964.1| Ribosomal protein S6 kinase, polypept... 169 7e-41
gi|28558156|sp|Q8R4U9|SGK2_RAT Serine/threonine-protein kinase S... 168 9e-41
gi|49067855|ref|XP_398217.1| hypothetical protein UM00602.1 [Ust... 168 9e-41
gi|15231960|ref|NP_187485.1| serine/threonine protein kinase (PK... 168 1e-40
gi|21537155|gb|AAM61496.1| putative ribosomal-protein S6 kinase ... 168 1e-40
gi|2911458|gb|AAC04355.1| cAMP-dependent protein kinase catalyti... 167 2e-40
gi|2129541|pir||S68463 protein kinase ATPK19 (EC 2.7.1.-) - Arab... 167 2e-40
gi|23956386|ref|NP_705815.1| ribosomal protein S6 kinase, polype... 167 2e-40
gi|33638111|gb|AAQ24165.1| ribosomal protein S6 kinase splice va... 167 2e-40
gi|26328137|dbj|BAC27809.1| unnamed protein product [Mus musculus] 167 2e-40
gi|38707442|dbj|BAD04044.1| catalytic subunit of cAMP-dependent ... 167 2e-40
gi|50294600|ref|XP_449711.1| unnamed protein product [Candida gl... 167 2e-40
gi|1438885|gb|AAC47172.1| putative protein kinase A catalytic su... 167 2e-40
gi|20385903|gb|AAM21494.1| protein kinase Sch9 [Cryptococcus neo... 167 3e-40
>gi|7500109|pir||T21523 protein kinase (EC 2.7.1.37) akt-2 long splice
form [similarity] - Caenorhabditis elegans
gi|3876529|emb|CAA20936.1| Hypothetical protein F28H6.1a
[Caenorhabditis elegans]
gi|3878871|emb|CAB07403.1| C. elegans AKT-2 protein (corresponding
sequence F28H6.1a) [Caenorhabditis elegans]
Length = 528
Score = 473 bits (1216), Expect = e-132
Identities = 232/243 (95%), Positives = 232/243 (95%)
Frame = +2
Query: 2 EIILALGYLHHRNIVYRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYL 181
EIILALGYLHHRNIVYRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYL
Sbjct: 286 EIILALGYLHHRNIVYRDMKLENLLLDRDGHIKITDFGLCKEEIKYGDKTSTFCGTPEYL 345
Query: 182 APEVIEDIDYDRSVDWWGVGVVMYEMMCGRLPFSAKENGKLFELITTCDLKFPNRLSPEA 361
APEVIEDIDYDRSVDWWGVGVVMYEMMCGRLPFSAKENGKLFELITTCDLKFPNRLSPEA
Sbjct: 346 APEVIEDIDYDRSVDWWGVGVVMYEMMCGRLPFSAKENGKLFELITTCDLKFPNRLSPEA 405
Query: 362 VTLLSGLLERVPAKRLGAGPDDAREVSRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTS 541
VTLLSGLLERVPAKRLGAGPDDAREVSRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTS
Sbjct: 406 VTLLSGLLERVPAKRLGAGPDDAREVSRAEFFKDVDWEATLRKEVEPPFKPNVMSETDTS 465
Query: 542 FFDREFTSMPVQLTPPRRGXXXXXXXXXXXLQANFIQFASYYVSGSLERSYDTNRSADKY 721
FFDREFTSMPVQLTPPRRG LQANFIQFASYYVSGSLERSYDTNRSADKY
Sbjct: 466 FFDREFTSMPVQLTPPRRGEELPTVDEEEELQANFIQFASYYVSGSLERSYDTNRSADKY 525
Query: 722 EIR 730
EIR
Sbjct: 526 EIR 528