Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M04G12_4
(1404 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17562680|ref|NP_506318.1| cathepsin Z precursor (53.2 kD) (5N... 911 0.0
gi|39592995|emb|CAE62609.1| Hypothetical protein CBG06727 [Caeno... 724 0.0
gi|47270758|gb|AAB54210.2| Cathepsin z protein 1 [Caenorhabditis... 336 7e-91
gi|17507081|ref|NP_491023.1| cathepsin Z (1D256) [Caenorhabditis... 336 7e-91
gi|1680720|gb|AAC47348.1| cysteine protease precursor [Onchocerc... 335 2e-90
gi|39595452|emb|CAE60490.1| Hypothetical protein CBG04105 [Caeno... 334 3e-90
gi|46561115|gb|AAT00789.1| cathepsin Z precursor [Onchocerca vol... 334 3e-90
gi|46948158|gb|AAT07061.1| cathepsin Z-like cysteine proteinase ... 328 1e-88
gi|4809232|gb|AAD30154.1| cathepsin Z1 preproprotein [Toxocara c... 322 1e-86
gi|47939805|gb|AAH72275.1| MGC82409 protein [Xenopus laevis] 295 1e-78
gi|945054|gb|AAA74445.1| cathepsin B-like protease 289 1e-76
gi|47227517|emb|CAG04665.1| unnamed protein product [Tetraodon n... 288 3e-76
gi|34328540|ref|NP_899159.1| cathepsin Y [Rattus norvegicus] >gn... 285 1e-75
gi|50758927|ref|XP_417483.1| PREDICTED: similar to cathepsin Y [... 285 1e-75
gi|47222865|emb|CAF96532.1| unnamed protein product [Tetraodon n... 284 3e-75
gi|11968166|ref|NP_071720.1| cathepsin Z preproprotein; cathepsi... 283 5e-75
gi|11863537|emb|CAC18798.1| cathepsin Z [Cricetulus griseus] 283 5e-75
gi|11066226|gb|AAG28507.1| cathepsin Z [Mus musculus] 282 1e-74
gi|37907340|gb|AAO64476.1| cathepsin Z precursor [Fundulus heter... 280 5e-74
gi|3650498|gb|AAC61477.1| cathepsin X precursor [Homo sapiens] 279 1e-73
gi|22538442|ref|NP_001327.2| cathepsin Z preproprotein; cathepsi... 278 2e-73
gi|3294548|gb|AAC39839.1| cathepsin Z precursor; CTSZ [Homo sapi... 278 2e-73
gi|3719219|gb|AAC63141.1| preprocathepsin P [Homo sapiens] 278 2e-73
gi|7245728|pdb|1DEU|A Chain A, Crystal Structure Of Human Procat... 278 2e-73
gi|7546545|pdb|1EF7|A Chain A, Crystal Structure Of Human Cathep... 275 1e-72
gi|33873837|gb|AAH25419.1| Unknown (protein for IMAGE:3929674) [... 236 1e-60
gi|29150712|gb|AAO64444.1| cathepsin Z-like cysteine proteinase ... 196 1e-48
gi|50657031|emb|CAH04633.1| cathepsin X/O [Suberites domuncula] 148 3e-34
gi|22653678|sp|O97578|CATC_CANFA Dipeptidyl-peptidase I precurso... 134 4e-30
gi|24987409|pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsi... 131 4e-29
gi|8393218|ref|NP_058793.1| cathepsin C; Cathepsin C (dipeptidyl... 131 4e-29
gi|115716|sp|P80067|CATC_RAT Dipeptidyl-peptidase I precursor (D... 131 4e-29
gi|33327024|gb|AAQ08887.1| cathepsin C [Homo sapiens] 130 6e-29
gi|3023454|sp|P97821|CATC_MOUSE Dipeptidyl-peptidase I precursor... 130 6e-29
gi|1582221|prf||2118248A prepro-cathepsin C 130 8e-29
gi|17933069|gb|AAL48191.1| cathepsin C [Homo sapiens] 130 8e-29
gi|4503141|ref|NP_001805.1| cathepsin C isoform a preproprotein;... 130 8e-29
gi|31560607|ref|NP_034112.2| cathepsin C preproprotein; dipeptid... 130 8e-29
gi|47550737|ref|NP_999887.1| cathepsin C; ik:tdsubc_1h2 [Danio r... 128 4e-28
gi|17933071|gb|AAL48192.1| cathepsin C [Homo sapiens] 127 8e-28
gi|17933077|gb|AAL48195.1| cathepsin C [Homo sapiens] 126 1e-27
gi|30038325|dbj|BAC75711.1| cathepsin C [Bos taurus] 123 9e-27
gi|37905530|gb|AAO64478.1| cathepsin C precursor [Fundulus heter... 123 1e-26
gi|50731191|ref|XP_417207.1| PREDICTED: similar to Dipeptidyl-pe... 118 3e-25
gi|5823020|gb|AAD53012.1| senescence-specific cysteine protease ... 117 5e-25
gi|28804799|dbj|BAC57943.1| cathepsin C [Marsupenaeus japonicus] 117 7e-25
gi|23344738|gb|AAN28682.1| cathepsin Z [Theromyzon tessulatum] 117 9e-25
gi|12832450|dbj|BAB22112.1| unnamed protein product [Mus musculus] 116 1e-24
gi|45708820|gb|AAH67941.1| LOC407938 protein [Xenopus tropicalis] 116 1e-24
gi|33417162|gb|AAH56109.1| Ctsc-prov protein [Xenopus laevis] 115 2e-24
gi|24657813|ref|NP_726176.1| CG3074-PA [Drosophila melanogaster]... 115 2e-24
gi|16768502|gb|AAL28470.1| GM06507p [Drosophila melanogaster] 111 5e-23
gi|21666724|gb|AAM73806.1| cysteine proteinase [Brassica napus] ... 109 2e-22
gi|1181143|emb|CAA93278.1| cysteine proteinase [Haemonchus conto... 108 4e-22
gi|19909509|dbj|BAB86959.1| cathepsin L [Fasciola gigantica] 107 5e-22
gi|7489849|pir||T10518 fruit bromelain (EC 3.4.22.33) FB1035 pre... 107 5e-22
gi|1085124|pir||JX0366 cysteine endopeptidase (EC 3.4.22.-) prec... 107 9e-22
gi|2599293|gb|AAC32040.1| preprocathepsin C [Schistosoma japonicum] 107 9e-22
gi|10798511|emb|CAC12806.1| cathepsin L1 [Fasciola hepatica] 106 1e-21
gi|7271889|gb|AAF44675.1| cathepsin L [Fasciola gigantica] 106 1e-21
gi|4574304|gb|AAD23996.1| cathepsin [Fasciola gigantica] 106 2e-21
gi|21263041|gb|AAM44832.1| cathepsin L2 [Fasciola gigantica] 106 2e-21
gi|118124|sp|P25250|CYS2_HORVU Cysteine proteinase EP-B 2 precur... 106 2e-21
gi|40556818|gb|AAR87763.1| fibroinase precursor [Bombyx mori] 106 2e-21
gi|7435804|pir||T03694 cysteine proteinase (EC 3.4.22.-) - rice ... 105 2e-21
gi|4426617|gb|AAD20453.1| cysteine endopeptidase precursor [Oryz... 105 2e-21
gi|41152538|gb|AAR99518.1| cathepsin L protein [Fasciola hepatica] 105 2e-21
gi|7435827|pir||T10501 fruit bromelain (EC 3.4.22.33) FB13 precu... 105 2e-21
gi|7435828|pir||T10503 fruit bromelain (EC 3.4.22.33) FB18 precu... 105 2e-21
gi|2351107|dbj|BAA21929.1| bromelain [Ananas comosus] 105 2e-21
gi|118120|sp|P25249|CYS1_HORVU Cysteine proteinase EP-B 1 precur... 105 3e-21
gi|7489850|pir||T10516 fruit bromelain (EC 3.4.22.33) FB22 precu... 105 3e-21
gi|7435824|pir||T07851 ananain (EC 3.4.22.31) precursor AN11 - p... 105 3e-21
gi|32399065|emb|CAD98305.1| cryptopain precursor [Cryptosporidiu... 104 4e-21
gi|37963625|gb|AAP94048.2| cathepsin-L-like midgut cysteine prot... 104 4e-21
gi|33333714|gb|AAQ11975.1| putative gut cathepsin L-like cystein... 104 6e-21
gi|1246527|emb|CAA62836.1| cysteine proteinase [Entamoeba histol... 104 6e-21
gi|1809288|gb|AAC47721.1| secreted cathepsin L 2 [Fasciola hepat... 104 6e-21
gi|28974202|gb|AAO61485.1| cathepsin H [Sterkiella histriomuscorum] 104 6e-21
gi|1809286|gb|AAB41670.1| secreted cathepsin L 1 [Fasciola hepat... 103 8e-21
gi|8547325|gb|AAF76330.1| cathepsin L [Fasciola hepatica] 103 1e-20
gi|5761329|dbj|BAA83473.1| cysteine endopeptidase [Oryza sativa]... 103 1e-20
gi|7271895|gb|AAF44678.1| cathepsin L [Fasciola gigantica] 103 1e-20
gi|39582397|emb|CAE74781.1| Hypothetical protein CBG22612 [Caeno... 103 1e-20
gi|27372551|gb|AAO03576.1| cysteine protease 19 [Entamoeba histo... 103 1e-20
gi|33348836|gb|AAQ16118.1| cathepsin L-like cysteine proteinase ... 103 1e-20
gi|48762476|dbj|BAD23809.1| cathepsin B-S [Tuberaphis styraci] 102 2e-20
gi|29249541|gb|EAA41050.1| GLP_447_16146_15244 [Giardia lamblia ... 102 2e-20
gi|48762491|dbj|BAD23815.1| cathepsin B-S [Tuberaphis coreana] 102 2e-20
gi|33242865|gb|AAQ01137.1| cathepsin [Branchiostoma lanceolatum] 102 2e-20
gi|2118132|pir||JC4848 cysteine proteinase (EC 3.4.22.-) - Dougl... 102 2e-20
gi|20136379|gb|AAM11647.1| cathepsin L [Fasciola hepatica] 102 3e-20
gi|49115269|gb|AAH73266.1| Unknown (protein for MGC:80629) [Xeno... 102 3e-20
gi|2239107|emb|CAA70693.1| cathepsin L-like cysteine proteinase ... 102 3e-20
gi|12597541|ref|NP_075125.1| cathepsin [Heliocoverpa armigera nu... 102 3e-20
gi|32129434|sp|P92132|CAL2_GIALA Cathepsin B-like CP2 precursor ... 101 4e-20
gi|31558997|gb|AAP49831.1| cathepsin L [Fasciola hepatica] 101 4e-20
gi|5381317|gb|AAD42940.1| cryptopain precursor [Cryptosporidium ... 101 4e-20
gi|18138384|ref|NP_542680.1| cathepsin [Helicoverpa zea single n... 101 4e-20
gi|34559455|gb|AAQ75437.1| cathepsin L-like protease [Helicoverp... 101 4e-20
gi|46251290|gb|AAS84611.1| cathepsin L-like cysteine proteinase ... 101 5e-20
gi|4139678|pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cath... 101 5e-20
gi|47522632|ref|NP_999094.1| cathepsin H [Sus scrofa] >gnl|BL_OR... 101 5e-20
gi|37788265|gb|AAO64472.1| cathepsin B precursor [Fundulus heter... 101 5e-20
gi|47224192|emb|CAG13112.1| unnamed protein product [Tetraodon n... 100 6e-20
gi|7271893|gb|AAF44677.1| cathepsin L [Fasciola gigantica] 100 6e-20
gi|33112581|gb|AAP94046.1| cathepsin-L-like cysteine peptidase 0... 100 6e-20
gi|14602252|ref|NP_148795.1| ORF11 cathepsin [Cydia pomonella gr... 100 6e-20
gi|7271891|gb|AAF44676.1| cathepsin L [Fasciola gigantica] 100 8e-20
gi|5231178|gb|AAD41105.1| cysteine proteinase [Hypera postica] 100 8e-20
gi|13432122|sp|P80884|ANAN_ANACO Ananain precursor >gnl|BL_ORD_I... 100 8e-20
gi|33112583|gb|AAP94047.1| cathepsin-L-like cysteine peptidase 0... 100 8e-20
gi|1345924|sp|P25802|CYS1_OSTOS Cathepsin B-like cysteine protei... 100 8e-20
gi|47524507|gb|AAT34987.1| putative cysteine protease [Gossypium... 100 1e-19
gi|535600|gb|AAA29137.1| cathepsin [Fasciola hepatica] 100 1e-19
gi|18423124|ref|NP_568722.1| cysteine proteinase, putative [Arab... 100 1e-19
gi|41152540|gb|AAR99519.1| cathepsin L protein [Fasciola hepatica] 100 1e-19
gi|30023547|gb|AAO48766.2| cathepsin L-like cysteine proteinase ... 100 1e-19
gi|8347420|dbj|BAA96501.1| cysteine protease [Nicotiana tabacum] 100 1e-19
gi|5915887|sp|O17473|CATL_BRUPA Cathepsin L-like precursor >gnl|... 100 1e-19
gi|32129435|sp|P92133|CAL3_GIALA Cathepsin B-like CP3 precursor ... 100 1e-19
gi|46948150|gb|AAT07057.1| cathepsin L-like cysteine proteinase ... 100 1e-19
gi|7435798|pir||T06206 probable cysteine proteinase (EC 3.4.22.-... 100 1e-19
gi|15234557|ref|NP_195406.1| cysteine proteinase, putative [Arab... 100 1e-19
gi|15290508|gb|AAK92229.1| cysteine proteinase [Arabidopsis thal... 100 1e-19
gi|629792|pir||S47434 cysteine proteinase (EC 3.4.22.-) - rice >... 100 1e-19
gi|13242027|gb|AAK16514.1| cathepsin L-like cysteine proteinase ... 100 1e-19
gi|31198479|ref|XP_308187.1| ENSANGP00000020785 [Anopheles gambi... 99 2e-19
gi|545734|gb|AAB30089.1| cysteine protease [Fasciola sp.] >gnl|B... 99 2e-19
gi|1085687|pir||S53027 cathepsin L (EC 3.4.22.15) precursor - pe... 99 2e-19
gi|6959769|gb|AAF33213.1| cysteine protease Cys1b [Babesia equi] 99 2e-19
gi|6650705|gb|AAF21977.1| thiolproteinase SmTP1 [Sarcocystis muris] 99 2e-19
gi|1498185|dbj|BAA06738.1| cysteine proteinase-1 precursor [Dros... 99 2e-19
gi|7435797|pir||T06208 cysteine proteinase (EC 3.4.22.-) - barle... 99 2e-19
gi|4100157|gb|AAD10337.1| cysteine proteinase precursor [Hordeum... 99 2e-19
gi|2146900|pir||S67481 cathepsin L-like cysteine proteinase (EC ... 99 2e-19
gi|33333694|gb|AAQ11965.1| putative gut cathepsin L-like cystein... 99 2e-19
gi|33333698|gb|AAQ11967.1| putative gut cathepsin L-like cystein... 99 2e-19
gi|1093503|prf||2104214A Cys protease 99 2e-19
gi|7435790|pir||T12382 cysteine proteinase (EC 3.4.22.-) - commo... 99 2e-19
gi|46948152|gb|AAT07058.1| cathepsin L-like cysteine proteinase ... 99 2e-19
gi|40806498|gb|AAR92154.1| putative cysteine protease 1 [Iris ho... 99 2e-19
gi|6851030|emb|CAB71032.1| cysteine protease [Lolium multiflorum] 99 2e-19
gi|28974200|gb|AAO61484.1| cathepsin B [Sterkiella histriomuscorum] 99 3e-19
gi|29245813|gb|EAA37433.1| GLP_442_4888_3992 [Giardia lamblia AT... 99 3e-19
gi|118127|sp|P25251|CYS4_BRANA Cysteine proteinase COT44 precurs... 99 3e-19
gi|477253|pir||A48454 cathepsin B-like cysteine proteinase (EC 3... 99 3e-19
gi|24653514|ref|NP_523735.2| CG6692-PC [Drosophila melanogaster]... 99 3e-19
gi|14276828|gb|AAK58415.1| cysteine protease precursor [Blomia t... 99 3e-19
gi|9630063|ref|NP_046281.1| cathepsin [Orgyia pseudotsugata mult... 99 3e-19
gi|17569349|ref|NP_509408.1| cysteine proteinase AALP (43.7 kD) ... 99 3e-19
gi|47076309|emb|CAD89795.1| putative cathepsin L protease [Meloi... 99 3e-19
gi|30995341|gb|AAO59414.2| cathepsin B endopeptidase [Schistosom... 99 3e-19
gi|5764077|emb|CAB53367.1| necpain [Necator americanus] 99 3e-19
gi|24653516|ref|NP_725347.1| CG6692-PA [Drosophila melanogaster]... 99 3e-19
gi|18396939|ref|NP_564320.1| peptidase C1A papain family protein... 99 3e-19
gi|42407937|dbj|BAD09076.1| putative cysteine proteinase [Oryza ... 98 4e-19
gi|17565164|ref|NP_503383.1| cysteine PRotease related, cathepsi... 98 4e-19
gi|22096273|gb|AAC17994.2| cysteine protease [Babesia equi] 98 4e-19
gi|2239109|emb|CAA70694.1| cathepsin S-like cysteine proteinase ... 98 4e-19
gi|1046373|gb|AAC49135.1| SAG12 protein 98 4e-19
gi|18422605|ref|NP_568651.1| senescence-specific SAG12 protein (... 98 4e-19
gi|50251128|dbj|BAD27581.1| cathepsin L [Oryzias latipes] 98 5e-19
gi|113603|sp|P05167|ALEU_HORVU Thiol protease aleurain precursor... 98 5e-19
gi|255032|gb|AAB23155.1| COT44=cysteine proteinase homolog [Bras... 98 5e-19
gi|2765358|emb|CAA74241.1| cathepsin L [Litopenaeus vannamei] 98 5e-19
gi|15419587|gb|AAK97078.1| encystation-specific protease [Giardi... 98 5e-19
gi|33333700|gb|AAQ11968.1| putative gut cathepsin L-like cystein... 98 5e-19
gi|33333712|gb|AAQ11974.1| putative gut cathepsin L-like cystein... 98 5e-19
gi|33333706|gb|AAQ11971.1| putative gut cathepsin L-like cystein... 98 5e-19
gi|33333704|gb|AAQ11970.1| putative gut cathepsin L-like cystein... 98 5e-19
gi|33333702|gb|AAQ11969.1| putative gut cathepsin L-like cystein... 98 5e-19
gi|6630974|gb|AAF19631.1| cysteine proteinase precursor [Myxine ... 98 5e-19
gi|18378947|ref|NP_563648.1| cathepsin B-like cysteine protease,... 97 7e-19
gi|29245258|gb|EAA36907.1| GLP_41_8294_9919 [Giardia lamblia ATC... 97 7e-19
gi|67656|pir||KHBH aleurain (EC 3.4.22.-) precursor - barley 97 7e-19
gi|30017423|ref|NP_835199.1| testin [Mus musculus] >gnl|BL_ORD_I... 97 7e-19
gi|31240547|ref|XP_320687.1| ENSANGP00000020002 [Anopheles gambi... 97 7e-19
gi|47213723|emb|CAF95154.1| unnamed protein product [Tetraodon n... 97 7e-19
gi|28192371|gb|AAK07729.1| NTCP23-like cysteine proteinase [Nico... 97 7e-19
gi|537437|gb|AAC35211.1| cysteine proteinase [Hemerocallis hybri... 97 7e-19
gi|20334373|gb|AAM19207.1| cysteine protease [Lycopersicon pimpi... 97 9e-19
gi|31559530|dbj|BAC77523.1| cysteine proteinase [Glycine max] >g... 97 9e-19
gi|7435800|pir||T03941 cysteine proteinase (EC 3.4.22.-) precurs... 97 9e-19
gi|630489|pir||S43991 cathepsin L-like proteinases (EC 3.4.22.-)... 97 9e-19
gi|16506723|gb|AAL23917.1| cathepsin L [Fasciola gigantica] 97 9e-19
gi|33333708|gb|AAQ11972.1| putative gut cathepsin L-like cystein... 97 9e-19
gi|33333696|gb|AAQ11966.1| putative gut cathepsin L-like cystein... 97 9e-19
gi|1929343|emb|CAA62835.1| cysteine proteinase [Entamoeba histol... 97 9e-19
gi|39592833|emb|CAE62447.1| Hypothetical protein CBG06539 [Caeno... 97 9e-19
gi|33622213|ref|NP_891858.1| cathepsin [Cryptophlebia leucotreta... 97 9e-19
gi|22653679|sp|Q26636|CATL_SARPE Cathepsin L precursor >gnl|BL_O... 97 9e-19
gi|2330009|gb|AAB66719.1| cysteine protease [Giardia muris] 97 9e-19
gi|18181863|emb|CAC85211.2| cathepsin B endopeptidase [Schistoso... 97 9e-19
gi|203341|gb|AAA63484.1| cathepsin H 97 1e-18
gi|28192373|gb|AAK07730.1| CPR1-like cysteine proteinase [Nicoti... 97 1e-18
gi|38045864|gb|AAR08900.1| cathepsin L [Fasciola gigantica] 97 1e-18
gi|203648|gb|AAA40993.1| cathepsin (EC 3.4.22.1) 97 1e-18
gi|30387350|ref|NP_848429.1| cathepsin [Choristoneura fumiferana... 97 1e-18
gi|29165304|gb|AAO65603.1| cathepsin L precursor [Hydra vulgaris] 97 1e-18
gi|6978721|ref|NP_037071.1| cathepsin H [Rattus norvegicus] >gnl... 97 1e-18
gi|39588506|emb|CAE58029.1| Hypothetical protein CBG01103 [Caeno... 97 1e-18
gi|34874087|ref|XP_346478.1| hypothetical protein XP_346477 [Rat... 97 1e-18
gi|12018262|ref|NP_072119.1| cathepsin B preproprotein [Rattus n... 97 1e-18
gi|27497536|gb|AAO13008.1| cathepsin S preproprotein [Saimiri bo... 97 1e-18
gi|50313163|gb|AAT74529.1| toxopain-2 [Toxoplasma gondii] 97 1e-18
gi|23110957|ref|NP_683880.1| cathepsin H isoform b precursor; al... 96 2e-18
gi|16506815|gb|AAL23962.1| truncated cathepsin H [Homo sapiens] 96 2e-18
gi|29708|emb|CAA30428.1| cathepsin H [Homo sapiens] 96 2e-18
gi|30141023|dbj|BAC75925.1| cysteine protease-3 [Helianthus annuus] 96 2e-18
gi|13491750|gb|AAK27968.1| cysteine protease [Ipomoea batatas] 96 2e-18
gi|48145879|emb|CAG33162.1| CTSH [Homo sapiens] 96 2e-18
gi|21264388|sp|P09668|CATH_HUMAN Cathepsin H precursor >gnl|BL_O... 96 2e-18
gi|67653|pir||KHHUH cathepsin H (EC 3.4.22.16) precursor [valida... 96 2e-18
gi|23110955|ref|NP_004381.2| cathepsin H isoform a preproprotein... 96 2e-18
gi|16506813|gb|AAL23961.1| cathepsin H [Homo sapiens] 96 2e-18
gi|48762493|dbj|BAD23816.1| cathepsin B-N [Tuberaphis coreana] 96 2e-18
gi|48762485|dbj|BAD23812.1| cathepsin B-N [Tuberaphis styraci] 96 2e-18
gi|10798509|emb|CAC12805.1| procathepsin L3 [Fasciola hepatica] 96 2e-18
gi|24638018|sp|P83443|MDO1_PSEMR Macrodontain I 96 2e-18
gi|1127275|pdb|1CTE|A Chain A, Molecule: Cathepsin B; Ec: 3.4.22... 96 2e-18
gi|19909511|dbj|BAB86960.1| cathepsin L [Fasciola gigantica] 96 2e-18
gi|37732137|gb|AAR02406.1| cysteine proteinase [Anthonomus grandis] 96 2e-18
gi|13774082|gb|AAK38169.1| cathepsin L-like [Fasciola hepatica] 96 2e-18
gi|45738078|gb|AAS75836.1| fastuosain precursor [Bromelia fastuosa] 96 2e-18
gi|28932706|gb|AAO60047.1| midgut cysteine proteinase 4 [Rhipice... 96 2e-18
gi|1311050|pdb|1CPJ|A Chain A, Thiol Protease Mol_id: 1; Molecul... 96 2e-18
gi|25988674|gb|AAN76202.1| lysosomal cysteine proteinase catheps... 96 2e-18
gi|24654434|ref|NP_725686.1| CG4847-PD [Drosophila melanogaster]... 96 3e-18
gi|39588844|emb|CAE69474.1| Hypothetical protein CBG15672 [Caeno... 96 3e-18
gi|5081735|gb|AAD39513.1| cathepsin L-like protease precursor [A... 96 3e-18
gi|19922198|ref|NP_610906.1| CG6347-PA [Drosophila melanogaster]... 96 3e-18
gi|7271897|gb|AAF44679.1| cathepsin L [Fasciola gigantica] 96 3e-18
gi|32394728|gb|AAM96000.1| cathepsin L precursor [Metapenaeus en... 96 3e-18
gi|32566081|ref|NP_506002.2| cysteine PRotease related (35.4 kD)... 96 3e-18
gi|6630972|gb|AAF19630.1| cysteine proteinase precursor [Myxine ... 96 3e-18
gi|32394730|gb|AAM96001.1| cathepsin L precursor [Metapenaeus en... 96 3e-18
gi|13905172|gb|AAH06878.1| Cathepsin H [Mus musculus] 96 3e-18
gi|15593252|gb|AAL02222.1| cysteine protease CP14 precursor [Fra... 96 3e-18
gi|1460063|emb|CAA60672.1| cysteine protein [Entamoeba dispar] 96 3e-18
gi|7497829|pir||T20148 probable cysteine proteinase (EC 3.4.22.-... 96 3e-18
gi|50745158|ref|XP_429301.1| PREDICTED: hypothetical protein XP_... 96 3e-18
gi|39588173|emb|CAE68098.1| Hypothetical protein CBG13738 [Caeno... 96 3e-18
gi|13242025|gb|AAK16513.1| cathepsin L-like cysteine proteinase ... 96 3e-18
gi|19922450|ref|NP_611221.1| CG4847-PA [Drosophila melanogaster]... 96 3e-18
gi|47230018|emb|CAG10432.1| unnamed protein product [Tetraodon n... 95 4e-18
gi|39581137|emb|CAE70994.1| Hypothetical protein CBG17826 [Caeno... 95 4e-18
gi|47213724|emb|CAF95155.1| unnamed protein product [Tetraodon n... 95 4e-18
gi|7435820|pir||T10514 probable stem bromelain (EC 3.4.22.32) pr... 95 4e-18
gi|7435780|pir||T09259 cathepsin L-like proteinase (EC 3.4.22.-)... 95 4e-18
gi|15593246|gb|AAL02220.1| cysteine protease CP7 precursor [Fran... 95 4e-18
gi|7106279|ref|NP_031827.1| cathepsin H; Cat H [Mus musculus] >g... 95 4e-18
gi|20334375|gb|AAM19208.1| cysteine protease [Lycopersicon penne... 95 4e-18
gi|6681079|ref|NP_031824.1| cathepsin B preproprotein [Mus muscu... 95 4e-18
gi|2507251|sp|P36184|ACP1_ENTHI Cysteine proteinase ACP1 precurs... 95 4e-18
gi|17559068|ref|NP_504682.1| cysteine PRotease related (36.5 kD)... 95 4e-18
gi|15593249|gb|AAL02221.1| cysteine protease CP10 precursor [Fra... 95 4e-18
gi|46195455|ref|NP_990702.1| cathepsin B [Gallus gallus] >gnl|BL... 95 4e-18
gi|2134308|pir||S58770 cathepsin B (EC 3.4.22.1) precursor - chi... 95 4e-18
gi|24285904|gb|AAL14199.1| cysteine proteinase precursor [Ipomoe... 95 4e-18
gi|46948156|gb|AAT07060.1| cathepsin L-like cysteine proteinase ... 95 4e-18
gi|600111|emb|CAA84378.1| cysteine proteinase [Vicia sativa] 95 5e-18
gi|15320768|ref|NP_203280.1| V-CATH [Epiphyas postvittana nucleo... 95 5e-18
gi|9955277|pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine... 95 5e-18
gi|12803615|gb|AAH02642.1| Cathepsin S, preproprotein [Homo sapi... 95 5e-18
gi|23110962|ref|NP_004070.3| cathepsin S preproprotein [Homo sap... 95 5e-18
gi|10441624|gb|AAG17127.1| cathepsin L-like cysteine proteinase ... 95 5e-18
gi|13124026|sp|Q9WGE0|CATV_NPVHC Viral cathepsin (V-cath) (Cyste... 95 5e-18
gi|19698257|dbj|BAB86771.1| cathepsin L-like [Engraulis japonicus] 95 5e-18
gi|21425246|emb|CAD33266.1| cathepsin L [Aphis gossypii] 95 5e-18
gi|2677828|gb|AAB97142.1| cysteine protease [Prunus armeniaca] 94 6e-18
gi|39583812|emb|CAE74885.1| Hypothetical protein CBG22748 [Caeno... 94 6e-18
gi|34912626|ref|NP_917660.1| putative cysteine proteinase [Oryza... 94 6e-18
gi|6435586|pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Hu... 94 6e-18
gi|21264393|sp|P25774|CATS_HUMAN Cathepsin S precursor 94 6e-18
gi|4503151|ref|NP_000387.1| cathepsin K preproprotein; cathepsin... 94 6e-18
gi|49456399|emb|CAG46520.1| CTSK [Homo sapiens] 94 6e-18
gi|836934|gb|AAA95998.1| cathepsin X 94 6e-18
gi|19698255|dbj|BAB86770.1| cathepsin L-like [Engraulis japonicus] 94 6e-18
gi|34873588|ref|XP_225137.2| similar to Cathepsin L precursor (M... 94 6e-18
gi|39592139|emb|CAE75359.1| Hypothetical protein CBG23343 [Caeno... 94 6e-18
gi|15593255|gb|AAL02223.1| cysteine protease CP19 precursor [Fra... 94 6e-18
gi|38639325|gb|AAR25800.1| cathepsin B-like cysteine proteinase ... 94 6e-18
gi|2317912|gb|AAC24376.1| cathepsin B-like cysteine proteinase [... 94 6e-18
gi|1483570|emb|CAA68066.1| cathepsin l [Litopenaeus vannamei] 94 8e-18
gi|1008858|gb|AAA79004.1| cathepsin B-like thiol protease 94 8e-18
gi|129233|sp|P25778|ORYC_ORYSA Oryzain gamma chain precursor >gn... 94 8e-18
gi|463046|gb|AAA49207.1| cysteine proteinase 94 8e-18
gi|284028|pir||A42482 cathepsin S (EC 3.4.22.27) precursor - hum... 94 8e-18
gi|179957|gb|AAC37592.1| cathepsin S [Homo sapiens] 94 8e-18
gi|33333710|gb|AAQ11973.1| putative gut cathepsin L-like cystein... 94 8e-18
gi|7381610|gb|AAF61565.1| cathepsin L-like proteinase precursor ... 94 8e-18
gi|47117667|sp|P61276|CATK_MACFA Cathepsin K precursor >gnl|BL_O... 94 8e-18
gi|2351557|gb|AAB68595.1| cathepsin [Choristoneura fumiferana MNPV] 94 8e-18
gi|29567137|ref|NP_818699.1| cathepsin [Adoxophyes honmai nucleo... 94 8e-18
gi|13242029|gb|AAK16515.1| cathepsin L-like cysteine proteinase ... 94 8e-18
gi|50761194|ref|XP_418273.1| PREDICTED: similar to Cathepsin L, ... 94 1e-17
gi|2499879|sp|Q40143|CYS3_LYCES Cysteine proteinase 3 precursor ... 94 1e-17
gi|1168794|sp|P43236|CATK_RABIT Cathepsin K precursor (OC-2 prot... 94 1e-17
gi|37077647|sp|Q91CL9|CATV_NPVAP Viral cathepsin (V-cath) (Cyste... 94 1e-17
gi|17062058|gb|AAL34984.1| cathepsine L-like cysteine protease [... 94 1e-17
gi|29374025|gb|AAO73003.1| cathepsin B [Fasciola gigantica] 94 1e-17
gi|39594338|emb|CAE71916.1| Hypothetical protein CBG18978 [Caeno... 94 1e-17
gi|50355623|dbj|BAD29960.1| cysteine protease [Daucus carota] 94 1e-17
gi|47523662|ref|NP_999467.1| cathepsin K precursor [Sus scrofa] ... 94 1e-17
gi|28932704|gb|AAO60046.1| midgut cysteine proteinase 3 [Rhipice... 94 1e-17
gi|18378945|ref|NP_563647.1| cathepsin B-like cysteine protease,... 93 1e-17
gi|39592835|emb|CAE62449.1| Hypothetical protein CBG06541 [Caeno... 93 1e-17
gi|50251130|dbj|BAD27582.1| cathepsin S [Oryzias latipes] 93 1e-17
gi|33348834|gb|AAQ16117.1| cathepsin L-like cysteine proteinase ... 93 1e-17
gi|27526823|emb|CAD32937.1| pro-cathepsin B2 [Fasciola hepatica] 93 1e-17
gi|28302291|gb|AAH46667.1| Cg10992-prov protein [Xenopus laevis] 93 1e-17
gi|2914174|pdb|1ATK| Crystal Structure Of The Cysteine Protease... 93 2e-17
gi|115752|sp|P05689|CATZ_BOVIN Cathepsin Z >gnl|BL_ORD_ID|107289... 93 2e-17
gi|34979797|gb|AAQ83887.1| cathepsin B [Branchiostoma belcheri t... 93 2e-17
gi|37780049|gb|AAP32197.1| cysteine protease 10 [Trifolium repens] 93 2e-17
gi|1942645|pdb|1MIR|A Chain A, Rat Procathepsin B >gnl|BL_ORD_ID... 93 2e-17
gi|4210800|emb|CAA76927.1| thiol protease [Phaedon cochleariae] 93 2e-17
gi|37651368|ref|NP_932731.1| cathepsin [Choristoneura fumiferana... 93 2e-17
gi|10798513|emb|CAC12807.1| procathepsin L3 [Fasciola hepatica] 93 2e-17
gi|50355619|dbj|BAD29958.1| cysteine protease [Daucus carota] 93 2e-17
gi|20334377|gb|AAM19209.1| cysteine protease [Lycopersicon escul... 93 2e-17
gi|41688064|dbj|BAD08618.1| cathepsin L preproprotein [Cyprinus ... 93 2e-17
gi|18403438|ref|NP_565780.1| cysteine proteinase, putative [Arab... 93 2e-17
gi|37786769|gb|AAO64471.1| cathepsin L precursor [Fundulus heter... 93 2e-17
gi|50513589|pdb|1SNK|A Chain A, Cathepsin K Complexed With Carba... 93 2e-17
gi|41323856|gb|AAS00027.1| cathepsin L-like cysteine proteinase ... 93 2e-17
gi|10336513|dbj|BAB13759.1| cysteine proteinase [Astragalus sini... 93 2e-17
gi|14582897|gb|AAK69705.1| procathepsin B [Oncorhynchus mykiss] 93 2e-17
gi|28194643|gb|AAO33583.1| cathepsin P [Meriones unguiculatus] 93 2e-17
gi|30141021|dbj|BAC75924.1| cysteine protease-2 [Helianthus annuus] 92 2e-17
gi|45822209|emb|CAE47501.1| cathepsin L-like proteinase [Diabrot... 92 2e-17
gi|1185459|gb|AAA87849.1| preprocathepsin cathepsin L 92 2e-17
gi|25289998|pir||JC7787 carrot seed cysteine proteinase (EC 3.4.... 92 2e-17
gi|47086663|ref|NP_997853.1| Unknown (protein for MGC:85774); wu... 92 2e-17
gi|37747900|gb|AAH59142.1| Ctss protein [Rattus norvegicus] 92 2e-17
gi|630486|pir||S44151 cathepsin L (EC 3.4.22.15) - fluke (Schist... 92 3e-17
gi|9630927|ref|NP_047524.1| Cystein Protease= Cathepsin=AcMNPV o... 92 3e-17
gi|39579201|emb|CAE56994.1| Hypothetical protein CBG24861 [Caeno... 92 3e-17
gi|27497538|gb|AAO13009.1| cathepsin S preproprotein [Canis fami... 92 3e-17
gi|516865|emb|CAA52403.1| putative thiol protease [Arabidopsis t... 92 3e-17
gi|18399697|ref|NP_565512.1| cysteine proteinase A494, putative ... 92 3e-17
gi|17563798|ref|NP_507199.1| CathePsin L (38.1 kD) (cpl-1) [Caen... 92 3e-17
gi|49522051|gb|AAH74718.1| Unknown (protein for MGC:69486) [Xeno... 92 3e-17
gi|50657027|emb|CAH04631.1| cathepsin H [Suberites domuncula] 92 3e-17
gi|9719454|gb|AAF97809.1| falcipain 2 [Plasmodium falciparum] >g... 92 3e-17
gi|9719452|gb|AAF97808.1| falcipain 2 [Plasmodium falciparum] 92 3e-17
gi|7638427|gb|AAF65468.1| cysteine protease falcipain-2 [Plasmod... 92 3e-17
gi|30678927|ref|NP_849281.1| cathepsin B-like cysteine protease,... 92 4e-17
gi|18411686|ref|NP_567215.1| cathepsin B-like cysteine protease,... 92 4e-17
gi|8572753|gb|AAF77192.1| falcipain-3 [Plasmodium falciparum] 92 4e-17
gi|47779249|gb|AAT38521.1| cysteine protease [Bombyx mori nucleo... 92 4e-17
gi|38346007|emb|CAD40110.2| OSJNBa0035O13.9 [Oryza sativa (japon... 92 4e-17
gi|40643250|emb|CAC83720.1| cathepsin B [Hordeum vulgare subsp. ... 92 4e-17
gi|23508353|ref|NP_701022.1| falcipain-3 [Plasmodium falciparum ... 92 4e-17
gi|37780043|gb|AAP32194.1| cysteine protease 1 [Trifolium repens] 92 4e-17
gi|7435775|pir||JC5443 cathepsin L-like cysteine proteinase (EC ... 92 4e-17
gi|50762389|ref|XP_425038.1| PREDICTED: similar to cathepsin L p... 92 4e-17
gi|8050826|gb|AAF71757.1| cysteine protease falcipain-3; PCP2 [P... 92 4e-17
gi|39588507|emb|CAE58030.1| Hypothetical protein CBG01104 [Caeno... 92 4e-17
gi|227293|prf||1701299A cathepsin B 92 4e-17
gi|21483192|gb|AAL14224.1| cathepsin L [Haemonchus contortus] >g... 92 4e-17
gi|7435822|pir||T07840 ananain (EC 3.4.22.31) AN8 precursor - pi... 92 4e-17
gi|23508352|ref|NP_701021.1| falcipain-2 precursor, putative [Pl... 91 5e-17
gi|4557501|ref|NP_001325.1| cathepsin O preproprotein [Homo sapi... 91 5e-17
gi|39582386|emb|CAE74770.1| Hypothetical protein CBG22599 [Caeno... 91 5e-17
gi|37655265|gb|AAQ96835.1| cysteine proteinase [Glycine max] 91 5e-17
gi|7327279|gb|AAB26209.2| cysteine proteinase precursor [Entamoe... 91 5e-17
gi|28373366|pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bo... 91 5e-17
gi|27681979|ref|XP_225125.1| similar to cathepsin 1 precursor [R... 91 5e-17
gi|25289991|pir||D86413 cysteine proteinase (EC 3.4.22.-) [simil... 91 5e-17
gi|30690594|ref|NP_564321.2| peptidase C1A papain family protein... 91 5e-17
gi|5031250|gb|AAD38132.1| vitellogenic cathepsin-B like protease... 91 5e-17
gi|3087799|emb|CAA93276.1| cysteine proteinase [Haemonchus conto... 91 5e-17
gi|23452059|gb|AAN32912.1| cathepsin [Danio rerio] 91 5e-17
gi|47086859|ref|NP_997749.1| cathepsin L, a; ik:tdsubc_2d2; xx:t... 91 5e-17
gi|28194647|gb|AAO33585.1| cathepsin L [Mesocricetus auratus] 91 5e-17
gi|4503155|ref|NP_001903.1| cathepsin L preproprotein; major exc... 91 5e-17
gi|15214962|gb|AAH12612.1| Cathepsin L, preproprotein [Homo sapi... 91 5e-17
gi|2944340|gb|AAC05262.1| cathepsin B-like cysteine protease GCP... 91 5e-17
gi|27806671|ref|NP_776456.1| cathepsin B [Bos taurus] >gnl|BL_OR... 91 5e-17
gi|1168789|sp|P07688|CATB_BOVIN Cathepsin B precursor 91 5e-17
gi|18141289|gb|AAL60582.1| senescence-associated cysteine protea... 91 5e-17
gi|50355611|dbj|BAD29954.1| cysteine protease [Daucus carota] 91 5e-17
gi|46576360|sp|P60994|ERVB_TABDI Ervatamin B (ERV-B) >gnl|BL_ORD... 91 7e-17
gi|3087801|emb|CAA93277.1| cysteine proteinase [Haemonchus conto... 91 7e-17
gi|31559526|dbj|BAC77521.1| cysteine proteinase [Glycine max] >g... 91 7e-17
gi|7542559|gb|AAF63497.1| falcipain 2 [Plasmodium falciparum] >g... 91 7e-17
gi|445927|prf||1910332A Cys endopeptidase 91 7e-17
gi|19526442|gb|AAL89717.1| cathepsin B [Apriona germari] 91 7e-17
gi|7435782|pir||T06466 cathepsin B-like cysteine proteinase (EC ... 91 7e-17
gi|47212965|emb|CAF93376.1| unnamed protein product [Tetraodon n... 91 7e-17
gi|37905511|gb|AAO64477.1| cathepsin S precursor [Fundulus heter... 91 7e-17
gi|11493685|gb|AAG35605.1| cysteine protease [Cercopithecus aeth... 91 7e-17
gi|309202|gb|AAA37494.1| mouse preprocathepsin B 91 7e-17
gi|17543258|ref|NP_502836.1| cysteine precursor (4P968) [Caenorh... 91 7e-17
gi|12643318|sp|O70370|CATS_MOUSE Cathepsin S precursor >gnl|BL_O... 91 7e-17
gi|50539796|ref|NP_001002368.1| zgc:92089 [Danio rerio] >gnl|BL_... 91 7e-17
gi|21953244|emb|CAD42716.1| putative cathepsin L [Myzus persicae] 91 7e-17
gi|1173630|gb|AAB37233.1| cysteine proteinase 91 7e-17
gi|47271446|ref|NP_055279.2| tubulointerstitial nephritis antige... 91 9e-17
gi|18407961|ref|NP_566880.1| cysteine proteinase, putative [Arab... 91 9e-17
gi|11360328|pir||JC7189 tubulointerstitial nephritis antigen - h... 91 9e-17
gi|1706261|sp|Q10717|CYS2_MAIZE Cysteine proteinase 2 precursor ... 91 9e-17
gi|27819101|gb|AAO23117.1| cysteine proteinase [Bombyx mori nucl... 91 9e-17
gi|11265612|pir||T47471 cysteine proteinase (EC 3.4.22.-) F18N11... 91 9e-17
gi|49671274|gb|AAH75275.1| Unknown (protein for MGC:88904) [Xeno... 91 9e-17
gi|118119|sp|P13277|CYS1_HOMAM Digestive cysteine proteinase 1 p... 91 9e-17
gi|21954552|dbj|BAC06345.1| gamete and mating-type specific prot... 91 9e-17
gi|1644295|emb|CAB03627.1| cysteine proteinase [Haemonchus conto... 91 9e-17
gi|45361295|ref|NP_989225.1| hypothetical protein MGC75969 [Xeno... 91 9e-17
gi|27465595|ref|NP_775155.1| testin [Rattus norvegicus] >gnl|BL_... 91 9e-17
gi|12805315|gb|AAH02125.1| Ctss protein [Mus musculus] 91 9e-17
gi|18408828|ref|NP_566920.1| cysteine proteinase, putative [Arab... 91 9e-17
gi|609175|emb|CAA57522.1| cathepsin B-like cysteine proteinase [... 91 9e-17
gi|20428641|ref|NP_620470.1| CG8947-PA [Drosophila melanogaster]... 90 1e-16
gi|1246523|emb|CAA62833.1| cysteine proteinase [Entamoeba histol... 90 1e-16
gi|34850847|dbj|BAC87861.1| cathepsin L [Engraulis japonicus] 90 1e-16
gi|23306947|dbj|BAC16538.1| cathepsin L [Engraulis japonicus] 90 1e-16
gi|40060510|gb|AAR37419.1| papain-like cysteine proteinase [Tric... 90 1e-16
gi|16304178|gb|AAL16954.1| cathepsin L-like cysteine protease pr... 90 1e-16
gi|27960480|gb|AAO27844.1| cathepsin Q2 [Rattus norvegicus] 90 1e-16
gi|23110960|ref|NP_001324.2| cathepsin L2 preproprotein; catheps... 90 1e-16
gi|3087790|emb|CAA75029.1| cathepsin L2 [Homo sapiens] 90 1e-16
gi|118153|sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine protein... 90 1e-16
gi|2245510|gb|AAB62536.1| cysteine protease [Dirofilaria immitis] 90 1e-16
gi|24158605|pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipep... 90 1e-16
gi|23577865|ref|NP_703114.1| viral cathepsin [Rachiplusia ou mul... 90 1e-16
gi|9627870|ref|NP_054157.1| viral cathepsin-like protein [Autogr... 90 1e-16
gi|2129942|pir||S60479 cathepsin B-like cysteine proteinase (EC ... 90 1e-16
gi|23508356|ref|NP_701025.1| falcipain 2 precursor [Plasmodium f... 90 1e-16
gi|118158|sp|P12412|CYSP_VIGMU Vignain precursor (Bean endopepti... 90 1e-16
gi|50418223|gb|AAH77285.1| Unknown (protein for MGC:80097) [Xeno... 90 1e-16
gi|14582899|gb|AAK69706.1| procathepsin L [Oncorhynchus mykiss] 90 1e-16
gi|1246519|emb|CAA62834.1| cysteine proteinase [Entamoeba dispar] 90 1e-16
gi|14582576|gb|AAK69541.1| cathepsin B-like cysteine proteinase ... 90 1e-16
gi|13928758|ref|NP_113748.1| cathepsin K [Rattus norvegicus] >gn... 90 1e-16
gi|28277314|gb|AAH44689.1| MGC53360 protein [Xenopus laevis] 90 1e-16
gi|945081|gb|AAC49361.1| P21 90 1e-16
gi|16307393|gb|AAH10240.1| Cathepsin B, preproprotein [Homo sapi... 90 1e-16
gi|115711|sp|P07858|CATB_HUMAN Cathepsin B precursor (Cathepsin ... 90 1e-16
gi|4503139|ref|NP_001899.1| cathepsin B preproprotein; APP secre... 90 1e-16
gi|30583753|gb|AAP36125.1| Homo sapiens cathepsin B [synthetic c... 90 1e-16
gi|7239343|gb|AAF43193.1| cathepsin L [Stylonychia lemnae] 90 1e-16
gi|40060518|gb|AAR37420.1| papain-like cysteine proteinase [Tric... 89 2e-16
gi|26390492|dbj|BAC25906.1| unnamed protein product [Mus musculus] 89 2e-16
gi|50355613|dbj|BAD29955.1| cysteine protease [Daucus carota] 89 2e-16
gi|2144502|pir||KHCHL cathepsin L (EC 3.4.22.15) - chicken 89 2e-16
gi|7435811|pir||T06708 cysteine proteinase (EC 3.4.22.-) T29H11.... 89 2e-16
gi|1345573|emb|CAA40073.1| endopeptidase (EP-C1) [Phaseolus vulg... 89 2e-16
gi|23344734|gb|AAN28680.1| cathepsin L [Theromyzon tessulatum] 89 2e-16
gi|34329348|gb|AAQ63885.1| putative cysteine proteinase [Medicag... 89 2e-16
gi|49522293|gb|AAH75261.1| Unknown (protein for MGC:88875) [Xeno... 89 2e-16
gi|17224950|gb|AAL37181.1| cathepsin L-like protease [Ancylostom... 89 2e-16
gi|18308182|gb|AAL67857.1| cysteine proteinase [Acanthamoeba hea... 89 2e-16
gi|9631045|ref|NP_047715.1| cathepsin-like proteinase [Lymantria... 89 2e-16
gi|7435774|pir||S22502 cysteine proteinase (EC 3.4.22.-) - kidne... 89 2e-16
gi|544129|sp|P25803|CYSP_PHAVU Vignain precursor (Bean endopepti... 89 2e-16
gi|23397070|gb|AAN31820.1| putative cysteine proteinase AALP [Ar... 89 3e-16
gi|18424347|ref|NP_568921.1| cysteine proteinase, putative / AAL... 89 3e-16
gi|7381221|gb|AAF61441.1| papain-like cysteine proteinase isofor... 89 3e-16
gi|7211745|gb|AAF40416.1| papain-like cysteine proteinase isofor... 89 3e-16
gi|18401420|ref|NP_565649.1| cysteine proteinase, putative [Arab... 89 3e-16
gi|129232|sp|P25777|ORYB_ORYSA Oryzain beta chain precursor >gnl... 89 3e-16
gi|20150649|pdb|1K3B|B Chain B, Crystal Structure Of Human Dipep... 89 3e-16
gi|2982114|pdb|1PBH| Crystal Structure Of Human Recombinant Pro... 89 3e-16
gi|7435791|pir||T12041 cysteine proteinase (EC 3.4.22.-) 3 precu... 89 3e-16
gi|118122|sp|P25793|CYS2_HAECO Cathepsin B-like cysteine protein... 89 3e-16
gi|7381219|gb|AAF61440.1| papain-like cysteine proteinase isofor... 89 3e-16
gi|7211741|gb|AAF40414.1| papain-like cysteine proteinase isofor... 89 3e-16
gi|7435801|pir||T06416 cysteine proteinase (EC 3.4.22.-) precurs... 89 3e-16
gi|29248841|gb|EAA40365.1| GLP_567_6496_7413 [Giardia lamblia AT... 89 3e-16
gi|4731372|gb|AAD28476.1| papain-like cysteine protease [Sanders... 89 3e-16
gi|11265608|pir||T46630 cysteine proteinase (EC 3.4.22.-) 1 prec... 89 3e-16
gi|30749499|pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Boun... 89 3e-16
gi|3087797|emb|CAA93275.1| cysteine proteinase [Haemonchus conto... 89 3e-16
gi|478099|pir||D48435 cysteine proteinase AC-3 - nematode (Haemo... 89 3e-16
gi|4731374|gb|AAD28477.1| papain-like cysteine protease [Sanders... 89 3e-16
gi|30749675|pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin ... 89 3e-16
gi|6635844|gb|AAF20005.1| cysteine protease [Prunus dulcis] 89 3e-16
gi|25153428|ref|NP_507186.2| predicted CDS, cathepsin B family m... 89 3e-16
gi|46309423|ref|YP_006313.1| cathepsin [Agrotis segetum granulov... 89 3e-16
gi|33242867|gb|AAQ01138.1| cathepsin [Branchiostoma lanceolatum] 89 3e-16
gi|1223922|gb|AAA92063.1| cysteinyl endopeptidase [Vigna radiata] 89 3e-16
gi|32488398|emb|CAE02823.1| OSJNBa0043A12.28 [Oryza sativa (japo... 89 3e-16
gi|7435779|pir||S71923 cysteine proteinase (EC 3.4.22.-) - garde... 89 3e-16
gi|14422331|emb|CAC41636.1| early leaf senescence abundant cyste... 89 3e-16
gi|37991670|dbj|BAD00046.1| cysteine protease [Triticum aestivum] 89 3e-16
gi|17565162|ref|NP_503382.1| cathepsin B precursor family member... 89 3e-16
gi|37780051|gb|AAP32198.1| cysteine protease 12 [Trifolium repens] 89 3e-16
gi|29374023|gb|AAO73002.1| cathepsin B [Fasciola gigantica] 89 3e-16
gi|37780047|gb|AAP32196.1| cysteine protease 8 [Trifolium repens] 89 3e-16
gi|37780045|gb|AAP32195.1| cysteine protease 5 [Trifolium repens] 89 3e-16
gi|41055001|ref|NP_957349.1| similar to cathepsin B [Danio rerio... 89 3e-16
gi|10946582|ref|NP_067256.1| cathepsin S preproprotein; Cat S [M... 89 3e-16
gi|50355615|dbj|BAD29956.1| cysteine protease [Daucus carota] 88 4e-16
gi|1169186|sp|P43156|CYSP_HEMSP Thiol protease SEN102 precursor ... 88 4e-16
gi|45822205|emb|CAE47499.1| cathepsin L-like proteinase [Diabrot... 88 4e-16
gi|1834307|dbj|BAA09820.1| cysteine proteinase [Spirometra erina... 88 4e-16
gi|15128493|dbj|BAB62718.1| plerocercoid growth factor/cysteine ... 88 4e-16
>gi|17562680|ref|NP_506318.1| cathepsin Z precursor (53.2 kD) (5N863)
[Caenorhabditis elegans]
gi|7506009|pir||T23720 hypothetical protein M04G12.2 - Caenorhabditis
elegans
gi|3878645|emb|CAB03209.1| C. elegans CPZ-2 protein (corresponding
sequence M04G12.2) [Caenorhabditis elegans]
Length = 467
Score = 911 bits (2355), Expect = 0.0
Identities = 434/467 (92%), Positives = 434/467 (92%)
Frame = +1
Query: 1 MNLKLIGFLFVIGTCQANLFNLPRAAIRLTREFTGMDKLPAPEELGGEEYDMKIXXXXXX 180
MNLKLIGFLFVIGTCQANLFNLPRAAIRLTREFTGMDKLPAPEELGGEEYDMKI
Sbjct: 1 MNLKLIGFLFVIGTCQANLFNLPRAAIRLTREFTGMDKLPAPEELGGEEYDMKIEVNNVV 60
Query: 181 XXXXXXXXXXXXXXTPLARVVNDDDLLYKKGFHLDSPFELNKKVNKPVVRYPNIAKNNQK 360
TPLARVVNDDDLLYKKGFHLDSPFELNKKVNKPVVRYPNIAKNNQK
Sbjct: 61 EEMVDDMEDSSEEDTPLARVVNDDDLLYKKGFHLDSPFELNKKVNKPVVRYPNIAKNNQK 120
Query: 361 IREEIVYPADFDEHVVEILDSRKERKIDLSPMIKAKLEKGYYEPNDEALVDMXXXXXXXX 540
IREEIVYPADFDEHVVEILDSRKERKIDLSPMIKAKLEKGYYEPNDEALVDM
Sbjct: 121 IREEIVYPADFDEHVVEILDSRKERKIDLSPMIKAKLEKGYYEPNDEALVDMSSESEESS 180
Query: 541 XXXXXARPYLKCGCLKKSGKVFESKTAPREWESSSFKSNDLPTGWDWRNVSGVNYCSPTR 720
ARPYLKCGCLKKSGKVFESKTAPREWESSSFKSNDLPTGWDWRNVSGVNYCSPTR
Sbjct: 181 EEWEEARPYLKCGCLKKSGKVFESKTAPREWESSSFKSNDLPTGWDWRNVSGVNYCSPTR 240
Query: 721 NQHIPVYCGSCWVFGTTGALNDRFNVARKGRWPMTQLSPQEIIDCNGKGNCQGGEIGNVL 900
NQHIPVYCGSCWVFGTTGALNDRFNVARKGRWPMTQLSPQEIIDCNGKGNCQGGEIGNVL
Sbjct: 241 NQHIPVYCGSCWVFGTTGALNDRFNVARKGRWPMTQLSPQEIIDCNGKGNCQGGEIGNVL 300
Query: 901 EHAKIQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSLTNYTRYYVKDYGQVQGRDKI 1080
EHAKIQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSLTNYTRYYVKDYGQVQGRDKI
Sbjct: 301 EHAKIQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSLTNYTRYYVKDYGQVQGRDKI 360
Query: 1081 MSEIKKGGPIACAIGATKKFEYEYVKGVYSEKSDLESNHIISLTGWGVDENGVEYWIARN 1260
MSEIKKGGPIACAIGATKKFEYEYVKGVYSEKSDLESNHIISLTGWGVDENGVEYWIARN
Sbjct: 361 MSEIKKGGPIACAIGATKKFEYEYVKGVYSEKSDLESNHIISLTGWGVDENGVEYWIARN 420
Query: 1261 SWGEAWGELGWFRVVTSKFKDGQGDQYNMGIERDCYYADVDVSNLTF 1401
SWGEAWGELGWFRVVTSKFKDGQGDQYNMGIERDCYYADVDVSNLTF
Sbjct: 421 SWGEAWGELGWFRVVTSKFKDGQGDQYNMGIERDCYYADVDVSNLTF 467
>gi|39592995|emb|CAE62609.1| Hypothetical protein CBG06727
[Caenorhabditis briggsae]
Length = 469
Score = 724 bits (1868), Expect = 0.0
Identities = 345/470 (73%), Positives = 385/470 (81%), Gaps = 3/470 (0%)
Frame = +1
Query: 1 MNLKLIGFLFVIGTCQANLFNLPRAAIRLTREFTGMDKLPAPEELGGEEYDMKIXXXXXX 180
MNLK +G L V+G CQAN+FN+P AAIR TR+FTGM+KL AP+ELGGE+YDMKI
Sbjct: 1 MNLKFLGLLLVVGLCQANIFNIPSAAIRFTRKFTGMEKLSAPDELGGEDYDMKIEVGQIA 60
Query: 181 XXXXXXXXXXXXXXTPLARVVNDDDLLYKKGFHLDSPFELNKKVNKPVVRYPNIAKNNQK 360
V++ L K +L+ ++ + +PVV YPN+ K +
Sbjct: 61 EDLVADVKDDDSEEVTF-EPVSEKKLEKKPKKNLEHEIGISIRDREPVVNYPNMLKKDFG 119
Query: 361 I-REEIVYPADFDEHVVEILDSRKERKIDLSPMIKAKLEKGYYEPNDEA--LVDMXXXXX 531
R+E+V P ++ E+VVEI+DSR ER+IDL PMIKAK+EKGYYE +A D+
Sbjct: 120 TPRKEVVLPENYHENVVEIMDSRNEREIDLEPMIKAKVEKGYYEDLMDAGSWTDLETTGE 179
Query: 532 XXXXXXXXARPYLKCGCLKKSGKVFESKTAPREWESSSFKSNDLPTGWDWRNVSGVNYCS 711
ARPYLKCGCLKKSGKVFESKTAPREWES +FK+NDLPT WDWRNVSG NYCS
Sbjct: 180 ESDEEWEEARPYLKCGCLKKSGKVFESKTAPREWESDNFKANDLPTAWDWRNVSGKNYCS 239
Query: 712 PTRNQHIPVYCGSCWVFGTTGALNDRFNVARKGRWPMTQLSPQEIIDCNGKGNCQGGEIG 891
PTRNQHIPVYCGSCWVFGTTGALNDRFNVAR+GRWPMTQLSPQEIIDCNGKGNCQGGEIG
Sbjct: 240 PTRNQHIPVYCGSCWVFGTTGALNDRFNVAREGRWPMTQLSPQEIIDCNGKGNCQGGEIG 299
Query: 892 NVLEHAKIQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSLTNYTRYYVKDYGQVQGR 1071
+VLEHAKIQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSL+NYTRYYVKDYG+V GR
Sbjct: 300 DVLEHAKIQGLVEEGCNVYRATNGECNPYHRCGSCWPNECFSLSNYTRYYVKDYGKVTGR 359
Query: 1072 DKIMSEIKKGGPIACAIGATKKFEYEYVKGVYSEKSDLESNHIISLTGWGVDENGVEYWI 1251
+KIM+EIKKGGPIACAIGATKKFEYEYVKGVYSEKSDLESNHIISLTGWGVDENGVEYWI
Sbjct: 360 EKIMAEIKKGGPIACAIGATKKFEYEYVKGVYSEKSDLESNHIISLTGWGVDENGVEYWI 419
Query: 1252 ARNSWGEAWGELGWFRVVTSKFKDGQGDQYNMGIERDCYYADVDVSNLTF 1401
ARNSWGEAWGELGWFRVVTSKF++G+GD YNMGIERDCY+ADVDVSNL F
Sbjct: 420 ARNSWGEAWGELGWFRVVTSKFQNGEGDHYNMGIERDCYFADVDVSNLNF 469