Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M01E5_3
(1077 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508313|ref|NP_493334.1| GTP-binding protein like (39.4 kD) ... 675 0.0
gi|31232778|ref|XP_318758.1| ENSANGP00000013178 [Anopheles gambi... 287 3e-76
gi|50758753|ref|XP_417403.1| PREDICTED: similar to GTP binding p... 273 7e-72
gi|48102582|ref|XP_395391.1| similar to ENSANGP00000013178 [Apis... 268 2e-70
gi|20129375|ref|NP_609218.1| CG13390-PA [Drosophila melanogaster... 267 3e-70
gi|39582938|emb|CAE73003.1| Hypothetical protein CBG20352 [Caeno... 267 4e-70
gi|7022959|dbj|BAA91783.1| unnamed protein product [Homo sapiens] 256 5e-67
gi|24308117|ref|NP_056481.1| GTP binding protein 5; GTP-binding ... 256 5e-67
gi|47229332|emb|CAG04084.1| unnamed protein product [Tetraodon n... 247 3e-64
gi|18447544|gb|AAL68333.1| RE72863p [Drosophila melanogaster] 199 7e-50
gi|15642873|ref|NP_227914.1| conserved hypothetical protein [The... 199 1e-49
gi|46199724|ref|YP_005391.1| GTP-binding protein [Thermus thermo... 196 6e-49
gi|47169233|pdb|1UDX|A Chain A, Crystal Structure Of The Conserv... 196 8e-49
gi|46308619|ref|ZP_00210811.1| COG0536: Predicted GTPase [Ehrlic... 196 1e-48
gi|15893230|ref|NP_360944.1| GTP-binding protein [Rickettsia con... 196 1e-48
gi|34581102|ref|ZP_00142582.1| GTP-binding protein [Rickettsia s... 194 3e-48
gi|27262240|gb|AAN87401.1| SPO0B-associated GTP-binding protein ... 191 2e-47
gi|22299896|ref|NP_683143.1| GTP-binding protein [Thermosynechoc... 191 3e-47
gi|15613776|ref|NP_242079.1| GTP-binding protein involved in ini... 190 4e-47
gi|15607036|ref|NP_214418.1| GTP-binding protein [Aquifex aeolic... 189 1e-46
gi|49235962|ref|ZP_00330025.1| COG0536: Predicted GTPase [Moorel... 189 1e-46
gi|48833506|ref|ZP_00290525.1| COG0536: Predicted GTPase [Magnet... 189 1e-46
gi|17231231|ref|NP_487779.1| GTP-binding protein [Nostoc sp. PCC... 187 3e-46
gi|16329540|ref|NP_440268.1| GTP-binding protein [Synechocystis ... 187 3e-46
gi|42560974|ref|NP_975425.1| GTP-binding protein Obg [Mycoplasma... 186 6e-46
gi|16079844|ref|NP_390670.1| GTPase activity [Bacillus subtilis ... 186 6e-46
gi|34540573|ref|NP_905052.1| GTP-binding protein Obg [Porphyromo... 186 6e-46
gi|15805125|ref|NP_293810.1| GTP-binding protein Obg [Deinococcu... 185 1e-45
gi|46113059|ref|ZP_00182241.2| COG0536: Predicted GTPase [Exiguo... 184 3e-45
gi|39938575|ref|NP_950341.1| conserved hypothetical protein [Oni... 184 4e-45
gi|29653734|ref|NP_819426.1| GTP-binding protein, GTP1/Obg famil... 182 1e-44
gi|50877479|emb|CAG37319.1| probable GTP-binding protein [Desulf... 182 1e-44
gi|48764951|ref|ZP_00269502.1| COG0536: Predicted GTPase [Rhodos... 182 2e-44
gi|15903028|ref|NP_358578.1| GTP-binding protein [Streptococcus ... 182 2e-44
gi|46129600|ref|ZP_00164101.2| COG0536: Predicted GTPase [Synech... 181 2e-44
gi|15673569|ref|NP_267743.1| Obg [Lactococcus lactis subsp. lact... 181 2e-44
gi|24158881|pdb|1LNZ|A Chain A, Structure Of The Obg Gtp-Binding... 181 3e-44
gi|22970626|ref|ZP_00017679.1| hypothetical protein [Chloroflexu... 181 3e-44
gi|24213552|ref|NP_711033.1| Probable GTP-binding protein [Lepto... 181 3e-44
gi|22996691|ref|ZP_00040938.1| COG0536: Predicted GTPase [Xylell... 181 3e-44
gi|15900948|ref|NP_345552.1| GTP-binding protein, GTP1/Obg famil... 181 3e-44
gi|15604673|ref|NP_221191.1| unknown [Rickettsia prowazekii str.... 181 3e-44
gi|20807398|ref|NP_622569.1| predicted GTPase [Thermoanaerobacte... 180 4e-44
gi|21230609|ref|NP_636526.1| GTP-binding protein [Xanthomonas ca... 180 6e-44
gi|27468245|ref|NP_764882.1| Spo0B-associated GTP-binding protei... 180 6e-44
gi|16803577|ref|NP_465062.1| conserved GTP binding protein [List... 180 6e-44
gi|22993554|ref|ZP_00038134.1| COG0536: Predicted GTPase [Xylell... 180 6e-44
gi|28199322|ref|NP_779636.1| GTP-binding protein [Xylella fastid... 179 1e-43
gi|16800640|ref|NP_470908.1| conserved GTP binding protein [List... 179 1e-43
gi|50591407|ref|ZP_00332720.1| COG0536: Predicted GTPase [Strept... 179 1e-43
gi|28211676|ref|NP_782620.1| GTP-binding protein [Clostridium te... 179 1e-43
gi|23124543|ref|ZP_00106525.1| COG0536: Predicted GTPase [Nostoc... 178 2e-43
gi|34496305|ref|NP_900520.1| probable GTP-binding protein [Chrom... 178 2e-43
gi|15611357|ref|NP_223008.1| putative [Helicobacter pylori J99] ... 178 2e-43
gi|48860515|ref|ZP_00314440.1| COG0536: Predicted GTPase [Clostr... 178 2e-43
gi|46579342|ref|YP_010150.1| GTP-binding protein, GTP1/OBG famil... 178 2e-43
gi|21242004|ref|NP_641586.1| GTP-binding protein [Xanthomonas ax... 178 2e-43
gi|48870693|ref|ZP_00323412.1| COG0536: Predicted GTPase [Pedioc... 177 3e-43
gi|15675273|ref|NP_269447.1| putative GTP-binding protein [Strep... 177 4e-43
gi|46203606|ref|ZP_00051283.2| COG0536: Predicted GTPase [Magnet... 177 4e-43
gi|19746308|ref|NP_607444.1| putative GTP-binding protein [Strep... 177 4e-43
gi|49483888|ref|YP_041112.1| Spo0B-associated GTP-binding protei... 176 6e-43
gi|15644931|ref|NP_207101.1| GTP-binding protein (obg) [Helicoba... 176 6e-43
gi|15924634|ref|NP_372168.1| Spo0B-associated GTP-binding protei... 176 8e-43
gi|47459257|ref|YP_016119.1| putative GTP-binding protein [Mycop... 176 1e-42
gi|23099497|ref|NP_692963.1| Spo0B-associated GTP-binding protei... 176 1e-42
gi|47574520|ref|ZP_00244556.1| COG0536: Predicted GTPase [Rubriv... 176 1e-42
gi|50365339|ref|YP_053764.1| conserved GTPase [Mesoplasma florum... 176 1e-42
gi|21675022|ref|NP_663087.1| GTP-binding protein Obg [Chlorobium... 175 1e-42
gi|22537613|ref|NP_688464.1| GTP-binding protein, GTP1/Obg famil... 175 1e-42
gi|39998303|ref|NP_954254.1| GTP-binding protein, GTP1/OBG famil... 175 2e-42
gi|27375536|ref|NP_767065.1| GTP-binding protein [Bradyrhizobium... 175 2e-42
gi|23016096|ref|ZP_00055856.1| COG0536: Predicted GTPase [Magnet... 174 2e-42
gi|28378716|ref|NP_785608.1| GTP-binding protein [Lactobacillus ... 174 2e-42
gi|31544654|ref|NP_853232.1| Obg [Mycoplasma gallisepticum R] >g... 174 2e-42
gi|15839013|ref|NP_299701.1| GTP-binding protein [Xylella fastid... 174 3e-42
gi|21910546|ref|NP_664814.1| putative GTP-binding protein [Strep... 174 4e-42
gi|28895761|ref|NP_802111.1| putative GTP-binding protein [Strep... 174 4e-42
gi|29349796|ref|NP_813299.1| GTP-binding protein [Bacteroides th... 173 7e-42
gi|48864917|ref|ZP_00318787.1| COG0536: Predicted GTPase [Oenoco... 173 7e-42
gi|45523190|ref|ZP_00174579.1| COG0536: Predicted GTPase [Crocos... 172 9e-42
gi|50119641|ref|YP_048808.1| putative GTP-binding protein [Erwin... 172 1e-41
gi|24114472|ref|NP_708982.1| putative GTP-binding factor [Shigel... 172 1e-41
gi|29376092|ref|NP_815246.1| GTP-binding protein [Enterococcus f... 172 1e-41
gi|16762063|ref|NP_457680.1| probable GTP-binding protein [Salmo... 172 2e-41
gi|42783578|ref|NP_980825.1| spo0B-associated GTP-binding protei... 172 2e-41
gi|39933239|ref|NP_945515.1| possible GTP-binding proteins [Rhod... 172 2e-41
gi|30249270|ref|NP_841340.1| GTP1/OBG family [Nitrosomonas europ... 171 2e-41
gi|16131073|ref|NP_417650.1| putative GTP-binding factor; putati... 171 2e-41
gi|15803723|ref|NP_289757.1| putative GTP-binding factor [Escher... 171 3e-41
gi|48767605|ref|ZP_00271959.1| COG0536: Predicted GTPase [Ralsto... 171 3e-41
gi|24379258|ref|NP_721213.1| putative GTP-binding protein [Strep... 171 3e-41
gi|16766597|ref|NP_462212.1| putative GTP-binding protein [Salmo... 171 3e-41
gi|47566631|ref|ZP_00237453.1| GTP-binding protein [Bacillus cer... 171 3e-41
gi|30022515|ref|NP_834146.1| GTP-binding protein [Bacillus cereu... 171 3e-41
gi|48823773|ref|ZP_00285267.1| COG0536: Predicted GTPase [Entero... 170 5e-41
gi|46445853|ref|YP_007218.1| probable to GTP binding protein [Pa... 170 5e-41
gi|33239698|ref|NP_874640.1| Predicted GTPase [Prochlorococcus m... 170 5e-41
gi|42525170|ref|NP_970550.1| GTP-binding protein [Bdellovibrio b... 170 5e-41
gi|15640464|ref|NP_230091.1| GTP1/Obg family protein [Vibrio cho... 170 5e-41
gi|42630290|ref|ZP_00155834.1| COG0536: Predicted GTPase [Haemop... 170 6e-41
gi|48893802|ref|ZP_00327000.1| COG0536: Predicted GTPase [Tricho... 170 6e-41
gi|21402487|ref|NP_658472.1| GTP1_OBG, GTP1/OBG family [Bacillus... 170 6e-41
gi|34395197|dbj|BAC83597.1| putative GTP-binding protein [Oryza ... 170 6e-41
gi|19705223|ref|NP_602718.1| SPO0B-associated GTP-binding protei... 169 8e-41
gi|49481594|ref|YP_038491.1| spo0B-associated GTP-binding protei... 169 8e-41
gi|37528359|ref|NP_931704.1| hypothetical protein [Photorhabdus ... 169 1e-40
gi|16272817|ref|NP_439038.1| GTP-binding protein [Haemophilus in... 169 1e-40
gi|41724965|ref|ZP_00151775.1| COG0536: Predicted GTPase [Dechlo... 169 1e-40
gi|46133177|ref|ZP_00156739.2| COG0536: Predicted GTPase [Haemop... 169 1e-40
gi|32265507|ref|NP_859539.1| conserved hypothetical protein [Hel... 169 1e-40
gi|42518996|ref|NP_964926.1| Spo0B-associated GTP-binding protei... 169 1e-40
gi|49474970|ref|YP_033011.1| GTP-binding protein [Bartonella hen... 169 1e-40
gi|34860908|ref|XP_215964.2| similar to GTP binding protein 5 [R... 169 1e-40
gi|23002852|ref|ZP_00046524.1| COG0536: Predicted GTPase [Lactob... 168 2e-40
gi|48845064|ref|ZP_00299353.1| COG0536: Predicted GTPase [Geobac... 168 2e-40
gi|15828824|ref|NP_326184.1| GTP-BINDING PROTEIN [Mycoplasma pul... 168 2e-40
gi|23473984|ref|ZP_00129279.1| COG0536: Predicted GTPase [Desulf... 168 2e-40
gi|15890030|ref|NP_355711.1| AGR_C_5047p [Agrobacterium tumefaci... 168 2e-40
gi|15599762|ref|NP_253256.1| GTP-binding protein Obg [Pseudomona... 167 3e-40
gi|46105662|ref|ZP_00199626.1| COG0536: Predicted GTPase [Rubrob... 167 3e-40
gi|16123655|ref|NP_406968.1| putative GTP-binding protein [Yersi... 167 3e-40
gi|15605143|ref|NP_219928.1| GTP Binding Protein [Chlamydia trac... 167 3e-40
gi|15677906|ref|NP_275074.1| GTP-binding protein [Neisseria meni... 167 4e-40
gi|42527254|ref|NP_972352.1| GTP-binding protein, GTP1/Obg famil... 167 4e-40
gi|33591923|ref|NP_879567.1| probable GTP-binding protein [Borde... 167 5e-40
gi|24308346|ref|NP_149098.1| hypothetical protein BC004923 [Homo... 167 5e-40
gi|34899310|ref|NP_911001.1| putative GTP-binding protein obg [O... 167 5e-40
gi|23105569|ref|ZP_00092025.1| COG0536: Predicted GTPase [Azotob... 166 7e-40
gi|30686886|ref|NP_197358.2| GTP1/OBG family protein [Arabidopsi... 166 7e-40
gi|45684313|ref|ZP_00195744.1| COG0536: Predicted GTPase [Mesorh... 166 9e-40
gi|17936656|ref|NP_533446.1| GTP-binding protein [Agrobacterium ... 166 1e-39
gi|15793356|ref|NP_283178.1| putative GTP-binding protein [Neiss... 165 1e-39
gi|13358024|ref|NP_078298.1| GTP-binding protein [Ureaplasma par... 165 1e-39
gi|15966912|ref|NP_387265.1| PUTATIVE GTP-BINDING PROTEIN [Sinor... 165 2e-39
gi|36338340|gb|AAH04923.3| LOC85865 protein [Homo sapiens] >gnl|... 165 2e-39
gi|28897104|ref|NP_796709.1| GTP1/Obg family protein [Vibrio par... 165 2e-39
gi|48853834|ref|ZP_00308000.1| COG0536: Predicted GTPase [Cytoph... 164 3e-39
gi|15835314|ref|NP_297073.1| GTP-binding protein, GTP1/Obg famil... 164 3e-39
gi|13508302|ref|NP_110252.1| small GTPase OBG involved in cell g... 164 3e-39
gi|33863811|ref|NP_895371.1| GTP1/OBG family:Hemolysin-type calc... 164 3e-39
gi|34854297|ref|XP_231402.2| similar to BC034507 protein [Rattus... 164 4e-39
gi|15602216|ref|NP_245288.1| unknown [Pasteurella multocida Pm70... 164 4e-39
gi|46321046|ref|ZP_00221426.1| COG0536: Predicted GTPase [Burkho... 163 6e-39
gi|23117423|ref|ZP_00101482.1| COG0536: Predicted GTPase [Desulf... 163 7e-39
gi|49617797|gb|AAT67594.1| GTP binding protein; YhbZ; ObgE; CgtA... 163 7e-39
gi|50085638|ref|YP_047148.1| putative GTP-binding protein (Obg) ... 163 7e-39
gi|18311109|ref|NP_563043.1| Spo0B associated GTP-binding protei... 163 7e-39
gi|31222099|ref|XP_317120.1| ENSANGP00000019599 [Anopheles gambi... 163 7e-39
gi|28493438|ref|NP_787599.1| GTP-binding protein [Tropheryma whi... 162 1e-38
gi|33866460|ref|NP_898019.1| GTP1/Obg family GTP-binding protein... 162 1e-38
gi|23025074|ref|ZP_00064251.1| COG0536: Predicted GTPase [Leucon... 162 1e-38
gi|16124570|ref|NP_419134.1| GTP-binding protein CgtA [Caulobact... 162 1e-38
gi|17547539|ref|NP_520941.1| CONSERVED HYPOTHETICAL PROTEIN [Ral... 162 1e-38
gi|15791484|ref|NP_281307.1| putative GTP-binding protein [Campy... 162 1e-38
gi|24375148|ref|NP_719191.1| GTP-binding protein, GTP1/Obg famil... 162 1e-38
gi|48860693|ref|ZP_00314604.1| COG0536: Predicted GTPase [Microb... 162 1e-38
gi|38234350|ref|NP_940117.1| GTP1/OBG-family GTP-binding protein... 162 1e-38
gi|49473816|ref|YP_031858.1| GTP-binding protein [Bartonella qui... 162 2e-38
gi|12045245|ref|NP_073056.1| GTP-binding protein (obg) [Mycoplas... 161 2e-38
gi|33860778|ref|NP_892339.1| GTP1/OBG family [Prochlorococcus ma... 161 3e-38
gi|34762112|ref|ZP_00143120.1| SPO0B-associated GTP-binding prot... 161 3e-38
gi|50539968|ref|NP_001002454.1| zgc:92334 [Danio rerio] >gnl|BL_... 161 3e-38
gi|28572450|ref|NP_789230.1| GTP-binding protein [Tropheryma whi... 160 4e-38
gi|19553556|ref|NP_601558.1| predicted GTPase [Corynebacterium g... 160 4e-38
gi|46315975|ref|ZP_00216555.1| COG0536: Predicted GTPase [Burkho... 160 4e-38
gi|48781065|ref|ZP_00277719.1| COG0536: Predicted GTPase [Burkho... 160 4e-38
gi|37678656|ref|NP_933265.1| GTP1/Obg family protein [Vibrio vul... 160 6e-38
gi|50732459|ref|XP_418645.1| PREDICTED: similar to hypothetical ... 160 6e-38
gi|15595126|ref|NP_212915.1| GTP-binding protein (obg) [Borrelia... 159 8e-38
gi|26987426|ref|NP_742851.1| GTP-binding protein, GTP1/Obg famil... 159 8e-38
gi|9864207|gb|AAG01349.1| GTP-binding protein [Burkholderia pseu... 159 8e-38
gi|29839966|ref|NP_829072.1| GTP1/OBG family protein [Chlamydoph... 159 1e-37
gi|17986490|ref|NP_539124.1| GTP-BINDING PROTEIN [Brucella melit... 159 1e-37
gi|23502698|ref|NP_698825.1| GTP-binding protein, GTP1/OBG famil... 159 1e-37
gi|23466647|ref|ZP_00122235.1| COG0536: Predicted GTPase [Haemop... 158 2e-37
gi|32030119|ref|ZP_00133030.1| COG0536: Predicted GTPase [Haemop... 158 2e-37
gi|16752497|ref|NP_444759.1| GTP1/OBG family protein [Chlamydoph... 158 2e-37
gi|37523944|ref|NP_927321.1| glr4375 [Gloeobacter violaceus PCC ... 158 2e-37
gi|34556927|ref|NP_906742.1| PUTATIVE GTP-BINDING PROTEIN [Wolin... 158 2e-37
gi|15894542|ref|NP_347891.1| SPO0B-associated GTPase, obg [Clost... 158 2e-37
gi|48728823|ref|ZP_00262577.1| COG0536: Predicted GTPase [Pseudo... 158 2e-37
gi|21961479|gb|AAH34507.1| BC034507 protein [Mus musculus] 158 2e-37
gi|38081954|ref|XP_131888.2| cDNA sequence BC034507 [Mus musculus] 158 2e-37
gi|25028822|ref|NP_738876.1| putative GTP-binding protein [Coryn... 157 3e-37
gi|19881018|gb|AAM00642.1| essential conserved GTPase [Legionell... 157 3e-37
gi|27364126|ref|NP_759654.1| GTP1/Obg family protein [Vibrio vul... 157 3e-37
gi|28868027|ref|NP_790646.1| GTP-binding protein, GTP1/Obg famil... 157 3e-37
gi|50842319|ref|YP_055546.1| GTP1/OBG family [Propionibacterium ... 157 3e-37
gi|42520361|ref|NP_966276.1| GTP-binding protein [Wolbachia endo... 157 3e-37
gi|46912034|emb|CAG18829.1| putative GTP1/Obg family protein [Ph... 157 4e-37
gi|21221053|ref|NP_626832.1| GTP-binding protein [Streptomyces c... 157 4e-37
gi|15618455|ref|NP_224740.1| GTP binding protein [Chlamydophila ... 157 4e-37
gi|33151508|ref|NP_872861.1| putative GTP-binding protein [Haemo... 157 5e-37
gi|13473421|ref|NP_104988.1| GTP-binding protein [Mesorhizobium ... 157 5e-37
gi|17944993|gb|AAL48559.1| RE03627p [Drosophila melanogaster] 157 5e-37
gi|24585318|ref|NP_609999.2| CG10628-PA [Drosophila melanogaster... 156 7e-37
gi|41408362|ref|NP_961198.1| Obg [Mycobacterium avium subsp. par... 156 9e-37
gi|38089177|ref|XP_194403.2| similar to BC034507 protein [Mus mu... 155 1e-36
gi|15616993|ref|NP_240206.1| hypothetical 43.3 kDa GTP-binding p... 155 2e-36
gi|48835469|ref|ZP_00292469.1| COG0536: Predicted GTPase [Thermo... 155 2e-36
gi|29832012|ref|NP_826646.1| putative GTP-binding protein [Strep... 155 2e-36
gi|32472070|ref|NP_865064.1| GTP-binding protein OBG [Pirellula ... 155 2e-36
gi|26553646|ref|NP_757580.1| GTP-binding protein Obg [Mycoplasma... 154 3e-36
gi|46362802|ref|ZP_00225639.1| COG0536: Predicted GTPase [Kineoc... 154 4e-36
gi|15609577|ref|NP_216956.1| obg [Mycobacterium tuberculosis H37... 153 6e-36
gi|25406984|pir||F86210 hypothetical protein [imported] - Arabid... 153 6e-36
gi|15222470|ref|NP_172241.1| GTP1/OBG family protein [Arabidopsi... 153 6e-36
gi|8778535|gb|AAF79543.1| F22G5.1 [Arabidopsis thaliana] 153 6e-36
gi|15841962|ref|NP_336999.1| GTP-binding protein [Mycobacterium ... 153 6e-36
gi|48139161|ref|XP_396976.1| similar to CG10628-PA [Apis mellifera] 153 8e-36
gi|46188810|ref|ZP_00125356.2| COG0536: Predicted GTPase [Pseudo... 152 1e-35
gi|1783294|dbj|BAA13501.1| Obg [Streptomyces griseus] 152 1e-35
gi|22957838|ref|ZP_00005525.1| COG0536: Predicted GTPase [Rhodob... 151 2e-35
gi|48851274|ref|ZP_00305516.1| COG0536: Predicted GTPase [Novosp... 149 8e-35
gi|21672650|ref|NP_660717.1| putative 43.3 kDa GTP-binding prote... 149 8e-35
gi|27904840|ref|NP_777966.1| GTP-binding protein [Buchnera aphid... 147 3e-34
gi|15827767|ref|NP_302030.1| GTP1/Obg-family GTP-binding protein... 147 4e-34
gi|23465846|ref|NP_696449.1| GTP-binding protein [Bifidobacteriu... 147 5e-34
gi|15639729|ref|NP_219179.1| GTP-binding protein (obg) [Treponem... 146 7e-34
gi|23336705|ref|ZP_00121904.1| COG0536: Predicted GTPase [Bifido... 145 2e-33
gi|23025266|ref|ZP_00064409.1| COG0536: Predicted GTPase [Leucon... 144 4e-33
gi|46165019|ref|ZP_00138119.2| COG0536: Predicted GTPase [Pseudo... 143 8e-33
gi|34897168|ref|NP_909930.1| putative GTP-binding protein [Oryza... 139 1e-31
gi|42454342|ref|ZP_00154249.1| hypothetical protein Rick123901 [... 132 1e-29
gi|25990400|gb|AAN76513.1| UG0751c10 [Homo sapiens] 132 1e-29
gi|46433040|gb|EAK92497.1| hypothetical protein CaO19.6653 [Cand... 130 4e-29
gi|33519572|ref|NP_878404.1| probable GTP-binding protein [Candi... 130 7e-29
gi|30172724|gb|AAD15550.2| unknown [Homo sapiens] 128 3e-28
gi|19115862|ref|NP_594950.1| probable GTP binding protein [Schiz... 128 3e-28
gi|50549883|ref|XP_502413.1| hypothetical protein [Yarrowia lipo... 128 3e-28
gi|6321962|ref|NP_012038.1| Mitochondrial GTP binding protein wi... 125 1e-27
gi|49354655|gb|AAT65075.1| mitochondrial Mtg2p [Saccharomyces ce... 125 1e-27
gi|49085876|ref|XP_405026.1| hypothetical protein AN0889.2 [Aspe... 122 2e-26
gi|50427923|ref|XP_462574.1| unnamed protein product [Debaryomyc... 121 2e-26
gi|32491224|ref|NP_871478.1| yhbZ [Wigglesworthia glossinidia en... 121 3e-26
gi|50289843|ref|XP_447353.1| unnamed protein product [Candida gl... 121 3e-26
gi|23120101|ref|ZP_00102906.1| COG0536: Predicted GTPase [Desulf... 121 3e-26
gi|50302589|ref|XP_451230.1| unnamed protein product [Kluyveromy... 120 5e-26
gi|50256133|gb|EAL18860.1| hypothetical protein CNBI1210 [Crypto... 119 9e-26
gi|38106676|gb|EAA52952.1| hypothetical protein MG06080.4 [Magna... 118 2e-25
gi|32423700|gb|AAP81243.1| putative GTP-binding protein [Candida... 117 4e-25
gi|46136459|ref|XP_389921.1| hypothetical protein FG09745.1 [Gib... 117 6e-25
gi|45190905|ref|NP_985159.1| AER302Cp [Eremothecium gossypii] >g... 115 1e-24
gi|32408355|ref|XP_324659.1| hypothetical protein [Neurospora cr... 114 4e-24
gi|6456500|gb|AAF09165.1| GTP-binding protein homolog [Streptoco... 113 9e-24
gi|48867318|ref|ZP_00320868.1| COG0536: Predicted GTPase [Haemop... 109 1e-22
gi|17552324|ref|NP_498042.1| predicted GTPase like (43.9 kD) (3G... 107 4e-22
gi|49075894|ref|XP_401978.1| hypothetical protein UM04363.1 [Ust... 107 4e-22
gi|31088866|ref|NP_852089.1| GTP binding protein 5 [Mus musculus... 106 8e-22
gi|25395700|pir||H88444 protein C26E6.12 [imported] - Caenorhabd... 105 2e-21
gi|23612772|ref|NP_704311.1| GTP-binding protein, putative [Plas... 98 3e-19
gi|23489158|gb|EAA21502.1| GTP-binding protein, putative [Plasmo... 94 4e-18
gi|47225414|emb|CAG11897.1| unnamed protein product [Tetraodon n... 94 5e-18
gi|28828238|gb|AAO50915.1| similar to Heliobacillus mobilis. SPO... 93 9e-18
gi|23487173|gb|EAA20983.1| GTP-binding protein-related [Plasmodi... 89 2e-16
gi|23509335|ref|NP_702002.1| GTP-binding protein, putative [Plas... 82 2e-14
gi|23121465|ref|ZP_00103752.1| COG0536: Predicted GTPase [Desulf... 82 2e-14
gi|45517234|ref|ZP_00168786.1| COG0536: Predicted GTPase [Ralsto... 78 3e-13
gi|23613265|ref|NP_703587.1| developmentally regulated GTP-bindi... 74 8e-12
gi|15235111|ref|NP_195662.1| GTP-binding protein, putative [Arab... 73 1e-11
gi|13540832|ref|NP_110520.1| Predicted GTPase [Thermoplasma volc... 73 1e-11
gi|49093512|ref|XP_408217.1| conserved hypothetical protein [Asp... 73 1e-11
gi|23482702|gb|EAA18608.1| GTP-binding-like protein [Plasmodium ... 73 1e-11
gi|50542888|ref|XP_499610.1| hypothetical protein [Yarrowia lipo... 72 2e-11
gi|7441586|pir||T42381 probable GTP-binding protein - fission ye... 72 3e-11
gi|19114262|ref|NP_593350.1| putative GTP-binding protein [Schiz... 72 3e-11
gi|14520715|ref|NP_126190.1| gtp-binding protein [Pyrococcus aby... 72 3e-11
gi|33322659|gb|AAQ07063.1| GTP-binding protein Obg [Lactobacillu... 71 4e-11
gi|29250054|gb|EAA41554.1| GLP_546_21275_20154 [Giardia lamblia ... 71 4e-11
gi|46439261|gb|EAK98581.1| hypothetical protein CaO19.12549 [Can... 71 4e-11
gi|20094635|ref|NP_614482.1| Predicted GTPase of the OBG/HflX su... 71 4e-11
gi|41720466|ref|ZP_00149279.1| COG1163: Predicted GTPase [Methan... 71 4e-11
gi|45188245|ref|NP_984468.1| ADR372Cp [Eremothecium gossypii] >g... 71 5e-11
gi|46125727|ref|XP_387417.1| conserved hypothetical protein [Gib... 71 5e-11
gi|33146858|dbj|BAC79856.1| putative GTP-binding protein DRG [Or... 70 6e-11
gi|14591438|ref|NP_143518.1| developmentally regulated GTP-bindi... 70 6e-11
gi|32403724|ref|XP_322475.1| hypothetical protein [Neurospora cr... 70 6e-11
gi|18314205|ref|NP_560872.1| conserved hypothetical protein [Pyr... 70 8e-11
gi|49072666|ref|XP_400622.1| hypothetical protein UM03007.1 [Ust... 70 8e-11
gi|15790199|ref|NP_280023.1| GTP-binding protein DRG; Drg [Halob... 70 8e-11
gi|48096688|ref|XP_394753.1| similar to ENSANGP00000016179 [Apis... 69 1e-10
gi|34913186|ref|NP_917940.1| putative GTP-binding protein [Oryza... 69 2e-10
gi|50294916|ref|XP_449869.1| unnamed protein product [Candida gl... 69 2e-10
gi|41720143|ref|ZP_00148982.1| COG0012: Predicted GTPase, probab... 69 2e-10
gi|41053317|ref|NP_956332.1| developmentally regulated GTP bindi... 69 2e-10
gi|37904742|gb|AAP57207.1| developmentally regulated GTP-binding... 69 2e-10
gi|18978135|ref|NP_579492.1| GTP-binding protein, gtp1/obg famil... 69 2e-10
gi|26348781|dbj|BAC38030.1| unnamed protein product [Mus musculus] 69 2e-10
gi|6681225|ref|NP_031905.1| developmentally regulated GTP bindin... 69 2e-10
gi|4758796|ref|NP_004138.1| developmentally regulated GTP bindin... 69 2e-10
gi|346685|pir||JC1349 GTP-binding protein DRG [validated] - mouse 69 2e-10
gi|50756645|ref|XP_415255.1| PREDICTED: similar to GTP-binding p... 69 2e-10
gi|24586704|gb|AAH39649.1| Developmentally regulated GTP binding... 69 2e-10
gi|31202337|ref|XP_310117.1| ENSANGP00000016179 [Anopheles gambi... 69 2e-10
gi|30585289|gb|AAP36917.1| Homo sapiens developmentally regulate... 69 2e-10
gi|11498960|ref|NP_070193.1| GTP-binding protein [Archaeoglobus ... 69 2e-10
gi|38109007|gb|EAA54939.1| hypothetical protein MG05730.4 [Magna... 69 2e-10
gi|50312171|ref|XP_456117.1| unnamed protein product [Kluyveromy... 68 3e-10
gi|16082451|ref|NP_394940.1| GTP-binding protein [Thermoplasma a... 68 3e-10
gi|11277016|pir||T43254 GTP-binding protein - Thermoplasma acido... 68 3e-10
gi|1169421|sp|P43690|DRG1_XENLA Developmentally regulated GTP-bi... 68 3e-10
gi|7481920|pir||PC7024 hypothetical 218 protein - Acholeplasma l... 68 3e-10
gi|49257324|gb|AAH73378.1| Xdrg protein [Xenopus laevis] 68 3e-10
gi|15828041|ref|NP_302304.1| conserved hypothetical protein [Myc... 67 5e-10
gi|6319281|ref|NP_009364.1| GTPase, interacts with ribosomes, ha... 67 5e-10
gi|50311459|ref|XP_455754.1| unnamed protein product [Kluyveromy... 67 5e-10
gi|28211303|ref|NP_782247.1| GTP-binding protein [Clostridium te... 67 5e-10
gi|50259064|gb|EAL21741.1| hypothetical protein CNBC4430 [Crypto... 67 5e-10
gi|46199128|ref|YP_004795.1| probable GTP-binding protein [Therm... 67 5e-10
gi|28493606|ref|NP_787767.1| GTP-binding protein [Tropheryma whi... 67 5e-10
gi|48824604|ref|ZP_00285957.1| COG0012: Predicted GTPase, probab... 67 7e-10
gi|23619515|ref|NP_705477.1| GTP-binding protein, putative [Plas... 67 7e-10
gi|50419273|ref|XP_458160.1| unnamed protein product [Debaryomyc... 67 7e-10
gi|18089152|gb|AAH20803.1| Developmentally regulated GTP binding... 67 7e-10
gi|47223702|emb|CAF99311.1| unnamed protein product [Tetraodon n... 67 9e-10
gi|16801978|ref|NP_472246.1| similar to probable GTP-binding pro... 67 9e-10
gi|39584747|emb|CAE67642.1| Hypothetical protein CBG13201 [Caeno... 67 9e-10
gi|37806152|dbj|BAC99657.1| Nucleolar GTP-binding protein 1-like... 67 9e-10
gi|45545749|ref|ZP_00185876.1| COG0012: Predicted GTPase, probab... 67 9e-10
gi|34905188|ref|NP_913941.1| putative GTP-binding protein [Oryza... 67 9e-10
gi|48851933|ref|ZP_00306127.1| COG0012: Predicted GTPase, probab... 66 1e-09
gi|17555344|ref|NP_499457.1| developmentally regulated gtp bindi... 66 1e-09
gi|32412392|ref|XP_326676.1| hypothetical protein [Neurospora cr... 66 1e-09
gi|46228087|gb|EAK88986.1| DRG-like OBG family GTpase fused to a... 66 1e-09
gi|50257637|gb|EAL20342.1| hypothetical protein CNBF1530 [Crypto... 66 1e-09
gi|16081954|ref|NP_394364.1| GTP-binding protein Obg related pro... 66 1e-09
gi|27469293|ref|NP_765930.1| GTP-binding protein [Staphylococcus... 66 2e-09
gi|29377737|ref|NP_816891.1| GTP-binding protein, GTP1/OBG famil... 66 2e-09
gi|416555|sp|P32234|128U_DROME GTP-BINDING PROTEIN 128UP >gnl|BL... 66 2e-09
gi|17981711|ref|NP_536733.1| CG8340-PA [Drosophila melanogaster]... 66 2e-09
gi|21227149|ref|NP_633071.1| GTP-binding protein [Methanosarcina... 66 2e-09
gi|20093139|ref|NP_619214.1| GTP-binding protein [Methanosarcina... 66 2e-09
gi|23002960|ref|ZP_00046631.1| COG0012: Predicted GTPase, probab... 65 2e-09
gi|42519766|ref|NP_965696.1| probable GTP-binding protein [Lacto... 65 2e-09
gi|28379581|ref|NP_786473.1| GTP-binding protein [Lactobacillus ... 65 3e-09
gi|46121521|ref|XP_385315.1| conserved hypothetical protein [Gib... 65 3e-09
gi|15923353|ref|NP_370887.1| hypothetical protein SAV0363 [Staph... 65 3e-09
gi|19173579|ref|NP_597382.1| DEVELOPMENTALLY REGULATED GTP-BINDI... 65 3e-09
gi|23478702|gb|EAA15716.1| developmentally regulated GTP-binding... 65 3e-09
gi|23100935|ref|NP_694402.1| GTP-binding protein [Oceanobacillus... 65 4e-09
gi|16081144|ref|NP_391972.1| yyaF [Bacillus subtilis subsp. subt... 65 4e-09
gi|46443828|gb|EAL03107.1| hypothetical protein CaO19.3977 [Cand... 65 4e-09
gi|48865971|ref|ZP_00319828.1| COG0012: Predicted GTPase, probab... 65 4e-09
gi|31544866|ref|NP_853444.1| predictred GTPase [Mycoplasma galli... 65 4e-09
gi|48869708|ref|ZP_00322452.1| COG0012: Predicted GTPase, probab... 65 4e-09
gi|50286275|ref|XP_445566.1| unnamed protein product [Candida gl... 65 4e-09
gi|23024184|ref|ZP_00063404.1| COG0012: Predicted GTPase, probab... 64 5e-09
gi|48477308|ref|YP_023014.1| GTP binding protein [Picrophilus to... 64 5e-09
gi|48477924|ref|YP_023630.1| GTP-binding protein [Picrophilus to... 64 5e-09
gi|18310848|ref|NP_562782.1| probable GTP-binding protein [Clost... 64 5e-09
gi|48855483|ref|ZP_00309642.1| COG0012: Predicted GTPase, probab... 64 5e-09
gi|42524125|ref|NP_969505.1| GTP-binding protein [Bdellovibrio b... 64 6e-09
gi|15616613|ref|NP_244919.1| GTP-binding protein [Bacillus halod... 64 6e-09
gi|23116631|ref|ZP_00101085.1| COG0012: Predicted GTPase, probab... 64 6e-09
gi|7451193|pir||S77880 probable GTP-binding protein MC010 - Myco... 64 6e-09
gi|48858188|ref|ZP_00312151.1| COG0012: Predicted GTPase, probab... 64 6e-09
gi|42561432|ref|NP_975883.1| GTP-BINDING PROTEIN [Mycoplasma myc... 64 6e-09
gi|48841018|ref|ZP_00297944.1| COG1163: Predicted GTPase [Methan... 64 6e-09
gi|15921784|ref|NP_377453.1| 334aa long hypothetical GTP-binding... 64 6e-09
gi|38104572|gb|EAA51118.1| hypothetical protein MG08640.4 [Magna... 64 6e-09
gi|49089312|ref|XP_406381.1| conserved hypothetical protein [Asp... 64 8e-09
gi|11499729|ref|NP_070971.1| GTP-binding protein [Archaeoglobus ... 64 8e-09
gi|17228218|ref|NP_484766.1| probable GTP-binding protein [Nosto... 64 8e-09
gi|45509252|ref|ZP_00161587.1| COG0012: Predicted GTPase, probab... 64 8e-09
gi|23128085|ref|ZP_00109941.1| COG0012: Predicted GTPase, probab... 64 8e-09
gi|47568674|ref|ZP_00239371.1| GTP-binding protein YchF [Bacillu... 63 1e-08
gi|42784671|ref|NP_981918.1| GTP-binding protein YchF [Bacillus ... 63 1e-08
gi|30023499|ref|NP_835130.1| GTP-binding protein [Bacillus cereu... 63 1e-08
gi|30265493|ref|NP_847870.1| GTP-binding protein YchF [Bacillus ... 63 1e-08
gi|48839652|ref|ZP_00296582.1| COG0012: Predicted GTPase, probab... 63 1e-08
gi|50546703|ref|XP_500821.1| hypothetical protein [Yarrowia lipo... 63 1e-08
gi|21397957|ref|NP_653942.1| GTP1_OBG, GTP1/OBG family [Bacillus... 63 1e-08
gi|15895403|ref|NP_348752.1| Predicted GTPase, YYAF B.subtilis o... 63 1e-08
gi|29348525|ref|NP_812028.1| GTP-binding protein [Bacteroides th... 63 1e-08
gi|46226301|gb|EAK87314.1| DRG like OBG family GTpase fused to a... 63 1e-08
gi|20808085|ref|NP_623256.1| predicted GTPase [Thermoanaerobacte... 63 1e-08
gi|45358685|ref|NP_988242.1| GTP1/OBG family:ATP/GTP-binding sit... 63 1e-08
gi|24378536|ref|NP_720491.1| putative GTP-binding protein [Strep... 63 1e-08
gi|46308966|ref|ZP_00211158.1| COG0012: Predicted GTPase, probab... 63 1e-08
gi|50427637|ref|XP_462431.1| unnamed protein product [Debaryomyc... 63 1e-08
gi|45184690|ref|NP_982408.1| AAL134Wp [Eremothecium gossypii] >g... 63 1e-08
gi|50876578|emb|CAG36418.1| probable GTP-binding protein Era hom... 63 1e-08
gi|21673124|ref|NP_661189.1| GTP-binding protein [Chlorobium tep... 63 1e-08
gi|15669516|ref|NP_248326.1| GTP-binding protein, member of GTP1... 62 2e-08
gi|20093188|ref|NP_619263.1| GTP-binding protein [Methanosarcina... 62 2e-08
gi|19112017|ref|NP_595225.1| gtp-binding protein 1. [Schizosacch... 62 2e-08
gi|26554480|ref|NP_758414.1| GTP-binding protein [Mycoplasma pen... 62 2e-08
gi|48852927|ref|ZP_00307109.1| COG1163: Predicted GTPase [Ferrop... 62 2e-08
gi|12044874|ref|NP_072684.1| GTP-binding protein, putative [Myco... 62 2e-08
gi|49070026|ref|XP_399302.1| hypothetical protein UM01687.1 [Ust... 62 2e-08
gi|34539921|ref|NP_904400.1| conserved hypothetical protein TIGR... 62 2e-08
gi|7491710|pir||T40599 hypothetical protein SPBC649.06 - fission... 62 2e-08
gi|6321612|ref|NP_011689.1| Protein with similarity to mammalian... 62 2e-08
gi|12644208|sp|P32235|GTP1_SCHPO GTP-binding protein 1 62 2e-08
gi|42520316|ref|NP_966231.1| GTP-binding protein YchF [Wolbachia... 62 2e-08
gi|15606048|ref|NP_213425.1| hypothetical protein aq_609 [Aquife... 62 2e-08
gi|2058456|gb|AAB53256.1| GTP-binding protein [Arabidopsis thali... 62 2e-08
gi|15218561|ref|NP_177410.1| developmentally regulated GTP-bindi... 62 2e-08
gi|15220113|ref|NP_173190.1| developmentally regulated GTP-bindi... 62 2e-08
gi|41408780|ref|NP_961616.1| hypothetical protein MAP2682c [Myco... 62 2e-08
gi|15902048|ref|NP_357598.1| Conserved hypothetical protein [Str... 62 2e-08
gi|15899953|ref|NP_344557.1| GTP-binding protein [Streptococcus ... 62 2e-08
gi|13358160|ref|NP_078434.1| GTP-binding protein [Ureaplasma par... 62 2e-08
gi|14601806|ref|NP_148347.1| developmentally regulated GTP-bindi... 62 2e-08
gi|31792305|ref|NP_854798.1| Probable GTP binding protein [Mycob... 62 2e-08
gi|7474153|pir||T30310 probable GTP binding protein - Lactococcu... 62 3e-08
gi|46119556|ref|ZP_00176802.2| COG0012: Predicted GTPase, probab... 62 3e-08
gi|15897540|ref|NP_342145.1| GTP-binding protein [Sulfolobus sol... 62 3e-08
gi|15608252|ref|NP_215628.1| hypothetical protein Rv1112 [Mycoba... 62 3e-08
gi|15220827|ref|NP_178192.1| expressed protein [Arabidopsis thal... 62 3e-08
gi|23612594|ref|NP_704155.1| conserved GTP-binding protein, puta... 62 3e-08
gi|8778457|gb|AAF79465.1| F1L3.17 [Arabidopsis thaliana] 62 3e-08
gi|50591624|ref|ZP_00332930.1| COG0012: Predicted GTPase, probab... 62 3e-08
gi|22536191|ref|NP_687042.1| GTP-binding protein YchF [Streptoco... 62 3e-08
gi|15671988|ref|NP_266162.1| GTP-binding protein [Lactococcus la... 62 3e-08
gi|21909540|ref|NP_663808.1| putative GTP-binding protein [Strep... 62 3e-08
gi|19745204|ref|NP_606340.1| putative GTP-binding protein [Strep... 62 3e-08
gi|15674254|ref|NP_268427.1| putative GTP-binding protein [Strep... 62 3e-08
gi|17551942|ref|NP_498808.1| GTP-binding protein like (3J337) [C... 61 4e-08
gi|46229282|gb|EAK90131.1| MJ1332/Ygr210cp-like GTP binding prot... 61 4e-08
gi|32398750|emb|CAD98710.1| GTP-binding protein, probable [Crypt... 61 4e-08
gi|47117846|sp|P34280|YKK3_CAEEL Hypothetical GTP-binding protei... 61 4e-08
gi|30024666|gb|AAP13583.1| developmentally regulated GTP-binding... 61 4e-08
gi|23612160|ref|NP_703740.1| hypothetical protein [Plasmodium fa... 61 4e-08
gi|21227184|ref|NP_633106.1| GTP-binding protein [Methanosarcina... 61 4e-08
gi|22299130|ref|NP_682377.1| ORF_ID:tll1587~probable GTP-binding... 61 5e-08
gi|42562778|ref|NP_176001.2| GTP-binding protein-related [Arabid... 61 5e-08
gi|13507765|ref|NP_109714.1| similar to GTPases [Mycoplasma pneu... 61 5e-08
gi|20093443|ref|NP_613290.1| Predicted GTPase [Methanopyrus kand... 61 5e-08
gi|23489774|gb|EAA21702.1| GTP-binding protein [Plasmodium yoeli... 61 5e-08
gi|25330207|pir||H96601 hypothetical protein T6H22.14 [imported]... 61 5e-08
gi|37522802|ref|NP_926179.1| hypothetical protein gll3233 [Gloeo... 61 5e-08
gi|37904746|gb|AAP57208.1| developmentally regulated GTP-binding... 61 5e-08
gi|39579327|emb|CAE56931.1| Hypothetical protein CBG24776 [Caeno... 61 5e-08
gi|47086759|ref|NP_997803.1| developmentally regulated GTP bindi... 61 5e-08
gi|45514187|ref|ZP_00165746.1| COG0012: Predicted GTPase, probab... 60 7e-08
gi|37525971|ref|NP_929315.1| hypothetical protein [Photorhabdus ... 60 7e-08
gi|39938669|ref|NP_950435.1| conserved hypothetical protein [Oni... 60 7e-08
gi|14521033|ref|NP_126508.1| gtp-binding protein, gtp1/obg famil... 60 7e-08
gi|2654192|gb|AAC33135.1| GTP-binding protein [Oncorhynchus tsha... 60 7e-08
gi|32474584|ref|NP_867578.1| GTP-binding protein Hflx [Pirellula... 60 7e-08
gi|24215029|ref|NP_712510.1| GTP-binding protein [Leptospira int... 60 9e-08
gi|28199875|ref|NP_780189.1| GTP-binding protein [Xylella fastid... 60 9e-08
gi|29655129|ref|NP_820821.1| GTP-binding protein YchF [Coxiella ... 60 9e-08
gi|48890612|ref|ZP_00324262.1| COG0012: Predicted GTPase, probab... 60 9e-08
gi|18977867|ref|NP_579224.1| GTP-binding protein, gtp1/obg famil... 60 9e-08
gi|48847156|ref|ZP_00301413.1| COG0012: Predicted GTPase, probab... 60 9e-08
gi|34221970|dbj|BAC82378.1| developmentally regulated GTP-bindin... 60 9e-08
gi|39995770|ref|NP_951721.1| GTP binding protein YchF [Geobacter... 60 9e-08
gi|34897082|ref|NP_909887.1| putative GTP-binding protein [Oryza... 60 9e-08
gi|2127948|pir||G64475 GTP-binding protein, GTP1/OBG-family - Me... 60 1e-07
gi|46192315|ref|ZP_00006994.2| COG0012: Predicted GTPase, probab... 60 1e-07
gi|14591132|ref|NP_143208.1| hypothetical protein PH1320 [Pyroco... 60 1e-07
gi|15669598|ref|NP_248411.1| GTP-binding protein, member of GTP1... 60 1e-07
gi|42525821|ref|NP_970919.1| GTP-binding protein YchF [Treponema... 60 1e-07
gi|47459437|ref|YP_016299.1| putative GTPase translation factor ... 60 1e-07
gi|47210849|emb|CAF89715.1| unnamed protein product [Tetraodon n... 60 1e-07
gi|50875671|emb|CAG35511.1| probable GTP-binding protein (YchF) ... 59 1e-07
gi|16760677|ref|NP_456294.1| putative ATP/GTP-binding protein [S... 59 1e-07
gi|21241722|ref|NP_641304.1| GTP-binding protein [Xanthomonas ax... 59 1e-07
gi|26247526|ref|NP_753566.1| Probable GTP-binding protein ychF [... 59 1e-07
gi|15839230|ref|NP_299918.1| GTP-binding protein [Xylella fastid... 59 1e-07
gi|15677674|ref|NP_274835.1| GTP-binding protein, putative [Neis... 59 1e-07
gi|15830962|ref|NP_309735.1| putative GTP-binding protein [Esche... 59 1e-07
gi|22993545|ref|ZP_00038126.1| COG0012: Predicted GTPase, probab... 59 1e-07
gi|22998173|ref|ZP_00042307.1| COG0012: Predicted GTPase, probab... 59 1e-07
gi|31198107|ref|XP_308001.1| ENSANGP00000013421 [Anopheles gambi... 59 1e-07
gi|416043|gb|AAA67557.1| 35 kDa GTP-binding protein >gnl|BL_ORD_... 59 1e-07
gi|50842061|ref|YP_055288.1| putative ATP/GTP binding protein [P... 59 1e-07
gi|15594580|ref|NP_212369.1| conserved hypothetical protein [Bor... 59 1e-07
gi|16081987|ref|NP_394400.1| GTP-binding protein related protein... 59 1e-07
gi|15679616|ref|NP_276733.1| GTP-binding protein, GTP1/OBG famil... 59 1e-07
gi|50365475|ref|YP_053900.1| conserved GTPase [Mesoplasma florum... 59 1e-07
gi|46446386|ref|YP_007751.1| conserved hypothetical protein [Par... 59 2e-07
gi|2222777|emb|CAA74319.1| GTP-binding protein [Teladorsagia cir... 59 2e-07
gi|16330542|ref|NP_441270.1| hypothetical protein [Synechocystis... 59 2e-07
gi|16122253|ref|NP_405566.1| conserved hypothetical protein [Yer... 59 2e-07
gi|21356473|ref|NP_650822.1| CG6195-PA [Drosophila melanogaster]... 59 2e-07
gi|13877991|gb|AAK44073.1| putative developmentally regulated GT... 59 2e-07
gi|42524625|ref|NP_970005.1| GTPase [Bdellovibrio bacteriovorus ... 59 2e-07
gi|419815|pir||JT0741 GTP-binding protein 1 - fission yeast (Sch... 59 2e-07
gi|48834813|ref|ZP_00291817.1| COG0012: Predicted GTPase, probab... 59 2e-07
gi|48867941|ref|ZP_00321352.1| COG0012: Predicted GTPase, probab... 59 3e-07
gi|21230349|ref|NP_636266.1| GTP-binding protein [Xanthomonas ca... 59 3e-07
gi|23468010|ref|ZP_00123584.1| COG0012: Predicted GTPase, probab... 59 3e-07
gi|16272342|ref|NP_438555.1| GTP-binding protein [Haemophilus in... 59 3e-07
gi|33152132|ref|NP_873485.1| putative GTP-binding protein [Haemo... 59 3e-07
gi|30584259|gb|AAP36378.1| Homo sapiens developmentally regulate... 59 3e-07
gi|15602028|ref|NP_245100.1| unknown [Pasteurella multocida Pm70... 59 3e-07
gi|15806403|ref|NP_295109.1| conserved hypothetical protein [Dei... 59 3e-07
gi|46914439|emb|CAG21218.1| putative GTP-binding protein [Photob... 59 3e-07
gi|46362921|ref|ZP_00225730.1| COG0012: Predicted GTPase, probab... 59 3e-07
gi|28897511|ref|NP_797116.1| GTP-binding protein [Vibrio parahae... 59 3e-07
gi|21672897|ref|NP_660962.1| ferrous iron transport protein B [C... 59 3e-07
gi|47573012|ref|ZP_00243052.1| COG0012: Predicted GTPase, probab... 59 3e-07
gi|12653443|gb|AAH00493.1| Developmentally regulated GTP binding... 59 3e-07
gi|4557537|ref|NP_001379.1| developmentally regulated GTP bindin... 59 3e-07
gi|17547617|ref|NP_521019.1| PROBABLE GTP-BINDING PROTEIN [Ralst... 59 3e-07
gi|50807910|ref|XP_424577.1| PREDICTED: similar to RIKEN cDNA 28... 59 3e-07
>gi|17508313|ref|NP_493334.1| GTP-binding protein like (39.4 kD)
(1N870) [Caenorhabditis elegans]
gi|7505883|pir||T23645 hypothetical protein M01E5.2 - Caenorhabditis
elegans
gi|3878629|emb|CAB07637.1| Hypothetical protein M01E5.2
[Caenorhabditis elegans]
Length = 358
Score = 675 bits (1742), Expect = 0.0
Identities = 341/358 (95%), Positives = 341/358 (95%)
Frame = -1
Query: 1077 MRISLQKCSKTACSVLSKRPILSPKKPKSEGEATSFIDYRRVRCQAGNGGNGMVSFFRGY 898
MRISLQKCSKTACSVLSKRPILSPKKPKSEGEATSFIDYRRVRCQAGNGGNGMVSFFRGY
Sbjct: 1 MRISLQKCSKTACSVLSKRPILSPKKPKSEGEATSFIDYRRVRCQAGNGGNGMVSFFRGY 60
Query: 897 RKXXXXXXXXXXXXXXXXXFRASRSSKDLSTVHSIVRAQNGEFGRSKSCHGKSADHKEVE 718
RK FRASRSSKDLSTVHSIVRAQNGEFGRSKSCHGKSADHKEVE
Sbjct: 61 RKPFGGPDGGDGGHGGHVVFRASRSSKDLSTVHSIVRAQNGEFGRSKSCHGKSADHKEVE 120
Query: 717 VPLGTVFKADGNTIFELNNENDMFIAARGGVGGRGNQFYVSNEVRKPFKAEYGGEGEELI 538
VPLGTVFKADGNTIFELNNENDMFIAARGGVGGRGNQFYVSNEVRKPFKAEYGGEGEELI
Sbjct: 121 VPLGTVFKADGNTIFELNNENDMFIAARGGVGGRGNQFYVSNEVRKPFKAEYGGEGEELI 180
Query: 537 YDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAV 358
YDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAV
Sbjct: 181 YDVEMRVMATAGLVGFPNAGKSSLLRAISRAKPKVASYPFTTLHPHIGVVFYEDFEQIAV 240
Query: 357 ADIPGLIEDSHLNKGLGISFLKHIERCESLWYVLDYSTGSLTDQYKMLRVELEGYQKGLG 178
ADIPGLIEDSHLNKGLGISFLKHIERCESLWYVLDYSTGSLTDQYKMLRVELEGYQKGLG
Sbjct: 241 ADIPGLIEDSHLNKGLGISFLKHIERCESLWYVLDYSTGSLTDQYKMLRVELEGYQKGLG 300
Query: 177 DRASTIVINKIDLSGKSPEEEAHHLSSLFPNLPVFPVSAQQRIGLEPLLEHLREQYDK 4
DRASTIVINKIDLSGKSPEEEAHHLSSLFPNLPVFPVSAQQRIGLEPLLEHLREQYDK
Sbjct: 301 DRASTIVINKIDLSGKSPEEEAHHLSSLFPNLPVFPVSAQQRIGLEPLLEHLREQYDK 358