Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M01D7_1
(1068 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|25145853|ref|NP_740789.1| G protein, class Q, Alpha subunit, ... 711 0.0
gi|39589436|emb|CAE74465.1| Hypothetical protein CBG22211 [Caeno... 701 0.0
gi|20198865|gb|AAM15593.1| Egg laying defective protein 30, isof... 612 e-174
gi|34494848|dbj|BAC85104.1| Gq-like G protein alpha subunit [Bom... 600 e-170
gi|17647455|ref|NP_523718.1| CG17759-PH [Drosophila melanogaster... 598 e-170
gi|42725849|gb|AAS38584.1| guanine nucleotide-binding protein G(... 596 e-169
gi|31209979|ref|XP_313956.1| ENSANGP00000025381 [Anopheles gambi... 595 e-169
gi|45361027|ref|NP_989150.1| Guanine nucleotide-binding protein,... 594 e-168
gi|45383662|ref|NP_989565.1| guanine nucleotide binding protein ... 593 e-168
gi|47551303|ref|NP_999835.1| guanine nucleotide-binding protein ... 593 e-168
gi|48479033|gb|AAT44837.1| heterotrimeric GTP-binding protein al... 592 e-168
gi|9296968|sp|P82471|GBQ_RAT Guanine nucleotide-binding protein ... 590 e-167
gi|13591957|ref|NP_112298.1| heterotrimeric guanine nucleotide-b... 590 e-167
gi|27503241|gb|AAH42284.1| Gna11-prov protein [Xenopus laevis] 590 e-167
gi|4504037|ref|NP_002058.1| guanine nucleotide binding protein (... 590 e-167
gi|2494885|sp|Q28294|GBQ_CANFA Guanine nucleotide-binding protei... 589 e-167
gi|40254462|ref|NP_002063.2| guanine nucleotide binding protein ... 589 e-167
gi|1169854|sp|P43444|GB11_XENLA Guanine nucleotide-binding prote... 589 e-167
gi|3041682|sp|P29992|GB11_HUMAN Guanine nucleotide-binding prote... 588 e-167
gi|6625746|gb|AAF19378.1| Gq/11 protein alpha subunit [Panulirus... 587 e-166
gi|7441570|pir||S71963 GTP-binding protein alpha-q - human (frag... 587 e-166
gi|585189|sp|P21279|GBQ_MOUSE Guanine nucleotide-binding protein... 587 e-166
gi|2286213|gb|AAB64301.1| GTP-binding protein alpha q [Homo sapi... 587 e-166
gi|71924|pir||RGMSQ GTP-binding regulatory protein Gq alpha chai... 587 e-166
gi|1174072|gb|AAB06875.1| G alpha-q 587 e-166
gi|3913714|sp|P91950|GBQ_HOMAM Guanine nucleotide-binding protei... 586 e-166
gi|1181671|gb|AAC50363.1| GTP-binding protein alpha q subunit >g... 586 e-166
gi|2286217|gb|AAB64303.1| guanine nucleotide binding protein alp... 585 e-166
gi|585190|sp|P38410|GBQ_XENLA Guanine nucleotide-binding protein... 585 e-166
gi|214188|gb|AAA49730.1| GTP-binding protein 585 e-166
gi|630961|pir||S45699 GTP-binding regulatory protein alpha chain... 585 e-166
gi|27805795|ref|NP_776747.1| guanine nucleotide binding protein ... 584 e-165
gi|1169852|sp|P38409|GB11_BOVIN Guanine nucleotide-binding prote... 584 e-165
gi|37059806|ref|NP_032165.2| guanine nucleotide binding protein,... 584 e-165
gi|6754004|ref|NP_034431.1| guanine nucleotide binding protein, ... 581 e-165
gi|585188|sp|P38411|GBQ_LYMST Guanine nucleotide-binding protein... 580 e-164
gi|1857923|gb|AAB48510.1| Gq protein alpha subunit [Limulus poly... 580 e-164
gi|1051238|gb|AAB36839.1| guanine nucleotide-binding protein 580 e-164
gi|13591951|ref|NP_112295.1| guanine nucleotide-binding protein ... 579 e-164
gi|19702253|gb|AAL93221.1| putative Gq protein alpha subunit [Ma... 577 e-163
gi|15029890|gb|AAH11169.1| Guanine nucleotide binding protein, a... 577 e-163
gi|3023865|sp|O15975|GBQ_PATYE Guanine nucleotide-binding protei... 572 e-162
gi|31209983|ref|XP_313958.1| ENSANGP00000022606 [Anopheles gambi... 564 e-159
gi|24653117|ref|NP_725196.1| CG17759-PD [Drosophila melanogaster... 561 e-159
gi|7160789|emb|CAB76453.1| guanine nucleotide-binding protein al... 557 e-157
gi|6016103|sp|O73819|GB14_XENLA Guanine nucleotide-binding prote... 556 e-157
gi|103129|pir||JN0115 GTP-binding regulatory protein dgq alpha c... 554 e-156
gi|7416005|dbj|BAA93638.1| G protein a subunit q class [Octopus ... 554 e-156
gi|20073277|gb|AAH27015.1| Guanine nucleotide binding protein, a... 549 e-155
gi|31542895|ref|NP_032163.2| guanine nucleotide binding protein,... 546 e-154
gi|27805885|ref|NP_776748.1| guanine nucleotide binding protein ... 546 e-154
gi|232137|sp|P30677|GB14_MOUSE Guanine nucleotide-binding protei... 546 e-154
gi|4758444|ref|NP_004288.1| guanine nucleotide binding protein (... 545 e-154
gi|585187|sp|P38412|GBQ_LOLFO Guanine nucleotide-binding protein... 540 e-152
gi|22711867|gb|AAM77353.2| visual iGq-alpha protein [Loligo pealei] 538 e-152
gi|31209981|ref|XP_313957.1| ENSANGP00000010002 [Anopheles gambi... 537 e-151
gi|17481207|dbj|BAB79199.1| G protein alpha subunit q class [Hal... 527 e-148
gi|50761810|ref|XP_424845.1| PREDICTED: similar to Guanine nucle... 525 e-148
gi|47225607|emb|CAG07950.1| unnamed protein product [Tetraodon n... 521 e-146
gi|47226407|emb|CAG08423.1| unnamed protein product [Tetraodon n... 514 e-144
gi|34861673|ref|XP_219671.2| similar to GTP-binding protein alph... 491 e-138
gi|26330604|dbj|BAC29032.1| unnamed protein product [Mus musculus] 488 e-136
gi|50761818|ref|XP_429163.1| PREDICTED: similar to GTP-binding p... 485 e-136
gi|50603860|gb|AAH77106.1| Unknown (protein for MGC:100897) [Dan... 481 e-134
gi|21483610|gb|AAM52780.1| SD21019p [Drosophila melanogaster] 456 e-127
gi|48096476|ref|XP_394698.1| similar to ENSANGP00000025381 [Apis... 449 e-125
gi|47219923|emb|CAF97193.1| unnamed protein product [Tetraodon n... 445 e-124
gi|5139703|dbj|BAA81695.1| G protein a subunit 3 [Hydra magnipap... 432 e-120
gi|30315891|sp|Q9XZV4|GBQ_GEOCY Guanine nucleotide-binding prote... 430 e-119
gi|47219922|emb|CAF97192.1| unnamed protein product [Tetraodon n... 422 e-117
gi|21687052|ref|NP_610800.2| CG17760-PA [Drosophila melanogaster... 407 e-112
gi|24653123|ref|NP_725199.1| CG30054-PB [Drosophila melanogaster... 397 e-110
gi|47226406|emb|CAG08422.1| unnamed protein product [Tetraodon n... 394 e-108
gi|50417122|gb|AAH77141.1| Unknown (protein for MGC:100942) [Dan... 390 e-107
gi|6754010|ref|NP_034434.1| guanine nucleotide binding protein, ... 386 e-106
gi|25742654|ref|NP_445994.1| guanine nucleotide binding protein,... 385 e-106
gi|47116940|sp|Q9TU29|GB15_RABIT Guanine nucleotide-binding prot... 385 e-106
gi|24653121|ref|NP_725198.1| CG30054-PA [Drosophila melanogaster... 377 e-104
gi|4504039|ref|NP_002059.1| guanine nucleotide binding protein (... 375 e-103
gi|3289977|gb|AAC25612.1| GNA15; ALPHA-16 [Homo sapiens] 371 e-101
gi|6016104|sp|O74227|GBA1_COCHE Guanine nucleotide-binding prote... 350 4e-95
gi|49085312|ref|XP_404788.1| GBA1_EMENI Guanine nucleotide-bindi... 348 1e-94
gi|27524346|emb|CAC81704.1| guanine nucleotide binding protein a... 348 2e-94
gi|45382313|ref|NP_990733.1| Gi2 protein alpha-subunit [Gallus g... 347 2e-94
gi|5139711|dbj|BAA81699.1| G protein a subunit 3 [Ephydatia fluv... 347 2e-94
gi|47225608|emb|CAG07951.1| unnamed protein product [Tetraodon n... 347 2e-94
gi|20270698|gb|AAM18375.1| G-protein alpha subunit [Leptosphaeri... 347 3e-94
gi|3023823|sp|O15976|GB0_PATYE Guanine nucleotide-binding protei... 347 4e-94
gi|21263646|sp|O13055|GBI2_ORYLA Guanine nucleotide-binding prot... 346 5e-94
gi|120977|sp|P17806|GB02_CRILO Guanine nucleotide-binding protei... 345 8e-94
gi|41281685|ref|NP_620073.1| guanine nucleotide binding protein ... 345 1e-93
gi|46122315|ref|XP_385711.1| GBA1_CRYPA Guanine nucleotide-bindi... 345 1e-93
gi|232136|sp|P30683|GB0_LYMST Guanine nucleotide-binding protein... 345 1e-93
gi|2494877|sp|Q00580|GBA1_CRYPA Guanine nucleotide-binding prote... 345 1e-93
gi|585183|sp|P38400|GBI2_CANFA Guanine nucleotide-binding protei... 344 2e-93
gi|6677598|gb|AAD26121.2| guanine nucleotide-binding protein Gi2... 344 2e-93
gi|1730206|sp|P51877|GB0_HELTI Guanine nucleotide-binding protei... 344 2e-93
gi|21591543|gb|AAM64110.1| G-alpha subunit [Penicillium marneffei] 344 2e-93
gi|20147683|gb|AAM12609.1| guanine nucleotide binding protein al... 344 2e-93
gi|27728513|gb|AAO18659.1| G protein alpha subunit [Hypocrea vir... 344 2e-93
gi|348273|pir||S28158 GTP-binding regulatory protein Gi alpha-2 ... 343 3e-93
gi|183182|gb|AAA52556.1| guanine nucleotide-binding regulatory p... 343 4e-93
gi|4504041|ref|NP_002061.1| guanine nucleotide binding protein (... 343 4e-93
gi|15072479|gb|AAK74191.1| protein GTPase Tga1 [Trichoderma atro... 343 4e-93
gi|38101799|gb|EAA48707.1| GBA1_MAGGR Guanine nucleotide-binding... 343 4e-93
gi|17507897|ref|NP_492108.1| G protein, class O, Alpha subunit (... 343 5e-93
gi|120979|sp|P18873|GB02_MOUSE Guanine nucleotide-binding protei... 343 5e-93
gi|6647521|sp|O74259|GBA1_SPOSC Guanine nucleotide-binding prote... 343 5e-93
gi|32411735|ref|XP_326348.1| GUANINE NUCLEOTIDE-BINDING PROTEIN ... 343 5e-93
gi|3929354|sp|O42784|GBA1_COLTR Guanine nucleotide-binding prote... 342 7e-93
gi|41054806|ref|NP_032164.2| guanine nucleotide binding protein,... 342 9e-93
gi|1730227|sp|P38402|GBI2_CAVPO Guanine nucleotide-binding prote... 342 9e-93
gi|13591955|ref|NP_112297.1| GTP-binding protein (G-alpha-i2) [R... 342 1e-92
gi|45361345|ref|NP_989250.1| hypothetical protein MGC76300 [Xeno... 342 1e-92
gi|7416003|dbj|BAA93637.1| G protein a subunit o class [Octopus ... 342 1e-92
gi|30314178|gb|AAP12457.1| G protein alpha subunit; GPA3 [Mucor ... 342 1e-92
gi|3599503|gb|AAC35365.1| guanine nucleotide-binding protein Gi ... 341 1e-92
gi|1730229|sp|P08752|GBI2_MOUSE Guanine nucleotide-binding prote... 341 1e-92
gi|49259163|pdb|1SVK|A Chain A, Structure Of The K180p Mutant Of... 341 1e-92
gi|25295771|pir||JC7661 G protein alpha subunit Rga2 protein - R... 341 1e-92
gi|3929351|sp|O13315|GBA1_MAGGR Guanine nucleotide-binding prote... 341 1e-92
gi|585173|sp|P38404|GB0_LOCMI Guanine nucleotide-binding protein... 341 2e-92
gi|232135|sp|P30033|GB02_RAT Guanine nucleotide-binding protein ... 341 2e-92
gi|27805887|ref|NP_776749.1| adenylate cyclase-inhibiting G alph... 340 3e-92
gi|1698500|gb|AAB37244.1| G protein alpha subunit 340 3e-92
gi|13539547|emb|CAC35694.1| G protein alpha subunit [Oculimacula... 340 3e-92
gi|24652446|ref|NP_724934.1| CG2204-PB [Drosophila melanogaster]... 340 3e-92
gi|5650709|emb|CAB43212.2| hypothetical protein [Homo sapiens] 340 3e-92
gi|6980962|ref|NP_037277.1| guanine nucleotide binding protein, ... 340 3e-92
gi|15779126|gb|AAH14627.1| Guanine nucleotide binding protein (G... 340 4e-92
gi|30585131|gb|AAP36838.1| Homo sapiens guanine nucleotide bindi... 340 4e-92
gi|71897|pir||RGMSI2 GTP-binding regulatory protein Gi alpha-2 c... 339 6e-92
gi|45383628|ref|NP_989580.1| guanine nucleotide binding protein ... 339 6e-92
gi|1346102|sp|P10825|GB0_XENLA Guanine nucleotide-binding protei... 339 7e-92
gi|156319|gb|AAA28059.1| G-o protein alpha subunit 339 7e-92
gi|6680041|ref|NP_032166.1| guanine nucleotide binding protein, ... 338 1e-91
gi|34865915|ref|XP_343481.1| similar to Gnat1 protein [Rattus no... 338 1e-91
gi|640425|pdb|1GIA| Gi Alpha 1 (Active Form With Bound Gtp-Gamm... 338 1e-91
gi|1730225|sp|P38401|GBI1_CAVPO Guanine nucleotide-binding prote... 338 2e-91
gi|47229779|emb|CAG06975.1| unnamed protein product [Tetraodon n... 337 2e-91
gi|47825400|ref|NP_001001475.1| guanine nucleotide-binding prote... 337 2e-91
gi|2494884|sp|Q28300|GBT1_CANFA Guanine nucleotide-binding prote... 337 3e-91
gi|585191|sp|P38407|GBT_XENLA Guanine nucleotide-binding protein... 337 3e-91
gi|2058390|emb|CAA60600.1| alpha 01 subunit of heterotrimeric GT... 337 3e-91
gi|631009|pir||S40508 GTP-binding regulatory protein Gi3 alpha c... 337 3e-91
gi|24652448|ref|NP_523684.2| CG2204-PA [Drosophila melanogaster]... 337 3e-91
gi|30794334|ref|NP_851365.1| guanine nucleotide binding protein ... 337 4e-91
gi|45382315|ref|NP_990734.1| Gi1 protein alpha-subunit [Gallus g... 337 4e-91
gi|71914|pir||RGXLOA GTP-binding regulatory protein Go alpha cha... 337 4e-91
gi|121021|sp|P27044|GBI1_XENLA Guanine nucleotide-binding protei... 336 5e-91
gi|1730230|sp|P51876|GBI_HELTI Guanine nucleotide-binding protei... 336 5e-91
gi|22027520|ref|NP_000163.2| guanine nucleotide binding protein,... 336 6e-91
gi|348272|pir||S28157 GTP-binding regulatory protein Gi alpha-1 ... 336 6e-91
gi|1942391|pdb|1GG2|A Chain A, G Protein Heterotrimer Mutant Gi_... 336 6e-91
gi|45382713|ref|NP_990022.1| rod-type transducin alpha subunit; ... 335 8e-91
gi|232149|sp|P30676|GBI_ASTPE Guanine nucleotide-binding protein... 335 8e-91
gi|20072863|gb|AAH26326.1| Guanine nucleotide binding protein (G... 335 8e-91
gi|71916|pir||RGFFO1 GTP-binding regulatory protein Go alpha cha... 335 8e-91
gi|28278608|gb|AAH44123.1| MGC53612 protein [Xenopus laevis] 335 8e-91
gi|1000030|pdb|1GIL| G I Alpha1 (Guanine Nucleotide-Binding Pro... 335 8e-91
gi|232150|sp|P30682|GBI_LYMST Guanine nucleotide-binding protein... 335 1e-90
gi|12044824|emb|CAC19871.1| G protein alpha subunit [Botryotinia... 335 1e-90
gi|18858763|ref|NP_571943.1| guanine nucleotide binding protein ... 335 1e-90
gi|10312058|emb|CAC10177.1| G protein alpha subunit [Blumeria gr... 335 1e-90
gi|33563256|ref|NP_034436.1| guanine nucleotide binding protein,... 335 1e-90
gi|2624610|pdb|1AS0| Gtp-Gamma-S Bound G42v Gia1 >gnl|BL_ORD_ID... 335 1e-90
gi|47524492|gb|AAT34978.1| guanine nucleotide-binding protein G(... 334 2e-90
gi|6980964|ref|NP_037238.1| guanine nucleotide binding protein, ... 334 2e-90
gi|3789978|gb|AAC67568.1| rod transducin alpha subunit [Ambystom... 334 2e-90
gi|10567816|ref|NP_066268.1| guanine nucleotide binding protein ... 334 2e-90
gi|386747|gb|AAA52581.1| guanine nucleotide-binding protein alph... 334 2e-90
gi|1730212|sp|P38403|GBAK_CAVPO Guanine nucleotide-binding prote... 333 3e-90
gi|41055760|ref|NP_957265.1| similar to guanine nucleotide bindi... 333 3e-90
gi|5729850|ref|NP_006487.1| guanine nucleotide binding protein (... 333 4e-90
gi|38488725|ref|NP_942100.1| guanine nucleotide binding protein ... 333 4e-90
gi|27805891|ref|NP_776751.1| guanine nucleotide binding protein ... 333 5e-90
gi|38079542|ref|XP_144196.2| similar to Guanine nucleotide-bindi... 332 1e-89
gi|41054141|ref|NP_956136.1| guanine nucleotide-binding protein ... 331 2e-89
gi|386750|gb|AAA52584.1| guanine nucleotide-binding protein [Hom... 331 2e-89
gi|71906|pir||RGBOO1 GTP-binding regulatory protein Go alpha cha... 331 2e-89
gi|8394152|ref|NP_059023.1| GTP-binding protein alpha o; GTP-bin... 331 2e-89
gi|348274|pir||S28159 GTP-binding regulatory protein Gi alpha-3 ... 331 2e-89
gi|24415108|gb|AAN59790.1| trimeric G-protein alpha o subunit [S... 330 3e-89
gi|50728081|ref|XP_425425.1| PREDICTED: similar to Guanine nucle... 330 3e-89
gi|6754012|ref|NP_034438.1| guanine nucleotide binding protein, ... 330 3e-89
gi|9489054|gb|AAB30632.2| G protein Gi2 alpha [Mus musculus] 330 3e-89
gi|17481199|dbj|BAB79197.1| G protein alpha subunit i class [Hal... 330 3e-89
gi|34860125|ref|XP_345272.1| similar to G-protein alpha-t2 subun... 330 3e-89
gi|37595921|gb|AAQ94737.1| G-alpha subunit [Phaeosphaeria nodorum] 330 3e-89
gi|31865|emb|CAA33196.1| unnamed protein product [Homo sapiens] 330 4e-89
gi|359|emb|CAA31391.1| unnamed protein product [Bos taurus] 330 4e-89
gi|27805889|ref|NP_776750.1| guanine nucleotide binding protein ... 330 4e-89
gi|49523123|gb|AAH75229.1| Unknown (protein for MGC:84417) [Xeno... 329 6e-89
gi|49227317|ref|NP_001001818.1| wu:fb10b04 [Danio rerio] >gnl|BL... 329 6e-89
gi|27465609|ref|NP_775162.1| gustducin [Rattus norvegicus] >gnl|... 329 6e-89
gi|120998|sp|P27045|GBAK_XENLA Guanine nucleotide-binding protei... 329 8e-89
gi|5139713|dbj|BAA81700.1| G protein a subunit 4 [Ephydatia fluv... 328 1e-88
gi|6680043|ref|NP_032167.1| guanine nucleotide binding protein, ... 328 1e-88
gi|20330805|ref|NP_005263.1| guanine nucleotide binding protein,... 328 1e-88
gi|3913723|sp|P87383|GBI1_ORYLA Guanine nucleotide-binding prote... 328 1e-88
gi|41387190|ref|NP_957081.1| guanine nucleotide binding protein ... 328 2e-88
gi|3789980|gb|AAC67569.1| cone transducin alpha subunit [Ambysto... 328 2e-88
gi|47219775|emb|CAG03402.1| unnamed protein product [Tetraodon n... 327 4e-88
gi|45382711|ref|NP_990021.1| cone-type transducin alpha subunit ... 327 4e-88
gi|18654428|gb|AAL77635.1| guanine nucleotide binding protein [T... 327 4e-88
gi|3599501|gb|AAC35364.1| guanine nucleotide-binding protein G(O... 326 5e-88
gi|1942173|pdb|1GOT|A Chain A, Heterotrimeric Complex Of A Gt-Al... 326 6e-88
gi|21465862|pdb|1KJY|A Chain A, Crystal Structure Of Human G[alp... 326 6e-88
gi|17510719|ref|NP_490790.1| SPiNdle orientation defective SPN-1... 325 1e-87
gi|576308|pdb|1TND|A Chain A, Transducin (Alpha Subunit) Complex... 325 1e-87
gi|18249680|dbj|BAB83918.1| G protein alpha subunit Gi splicing ... 324 2e-87
gi|18249678|dbj|BAB83917.1| G protein alpha subunit Gi splicing ... 324 2e-87
gi|49522173|gb|AAH75226.1| Unknown (protein for MGC:84412) [Xeno... 324 2e-87
gi|18858765|ref|NP_571944.1| guanine nucleotide binding protein ... 324 2e-87
gi|13399564|pdb|1FQJ|A Chain A, Crystal Structure Of The Heterot... 324 2e-87
gi|2494879|sp|P87032|GBA1_USTMA Guanine nucleotide-binding prote... 324 2e-87
gi|26364567|dbj|BAB26258.2| unnamed protein product [Mus musculus] 322 7e-87
gi|11559291|dbj|BAB18736.1| heterotrimeric G protein alpha subun... 321 2e-86
gi|41152264|ref|NP_957122.1| hypothetical protein MGC73153 [Dani... 320 3e-86
gi|31214957|ref|XP_315935.1| ENSANGP00000013560 [Anopheles gambi... 320 4e-86
gi|30315890|sp|Q9XZV3|GB0_GEOCY Guanine nucleotide-binding prote... 320 5e-86
gi|50541890|gb|AAT78421.1| Galphai2 protein [Homo sapiens] 319 8e-86
gi|1730207|sp|P53359|GB0_MANSE Guanine nucleotide-binding protei... 318 1e-85
gi|7415988|dbj|BAA93630.1| G protein alpha subunit [Halocynthia ... 318 1e-85
gi|3891516|pdb|1BH2| A326s Mutant Of An Inhibitory Alpha Subunit 317 3e-85
gi|17540930|ref|NP_501921.1| G Protein, Alpha subunit (41.0 kD) ... 317 3e-85
gi|18654413|gb|AAL77628.1| G protein alpha subunit [Takifugu rub... 317 3e-85
gi|1814384|gb|AAB41887.1| transducin alpha subunit [Sparus aurata] 316 5e-85
gi|39583722|emb|CAE63826.1| Hypothetical protein CBG08377 [Caeno... 316 5e-85
gi|23398623|gb|AAH16995.1| GNAI2 protein [Homo sapiens] 316 7e-85
gi|13195564|gb|AAK15759.1| G protein alpha-subunit [Pisolithus s... 315 9e-85
gi|1169866|sp|P41776|GBI_HOMAM Guanine nucleotide-binding protei... 315 1e-84
gi|17137790|ref|NP_477502.1| CG10060-PA [Drosophila melanogaster... 315 1e-84
gi|71901|pir||RGFFA GTP-binding regulatory protein Gi alpha chai... 315 1e-84
gi|120984|sp|P27601|GB13_MOUSE Guanine nucleotide-binding protei... 315 1e-84
gi|47216354|emb|CAG02412.1| unnamed protein product [Tetraodon n... 314 3e-84
gi|7416001|dbj|BAA93636.1| G protein alpha subunit i class [Octo... 312 1e-83
gi|40254582|ref|NP_034433.2| guanine nucleotide binding protein,... 312 1e-83
gi|50757869|ref|XP_415686.1| PREDICTED: similar to guanine nucle... 311 1e-83
gi|45439860|gb|AAS64389.1| Galpha13 [Rattus norvegicus] >gnl|BL_... 311 2e-83
gi|30024658|gb|AAP13579.1| guanine nucleotide binding protein al... 311 2e-83
gi|47825404|ref|NP_001001476.1| guanine nucleotide-binding prote... 311 2e-83
gi|24111250|ref|NP_006563.2| guanine nucleotide binding protein ... 311 2e-83
gi|47228773|emb|CAG07505.1| unnamed protein product [Tetraodon n... 310 3e-83
gi|2135318|pir||I57490 guanine nucleotide regulatory protein - h... 310 5e-83
gi|6980966|ref|NP_037321.1| guanine nucleotide binding protein, ... 308 1e-82
gi|47223707|emb|CAF99316.1| unnamed protein product [Tetraodon n... 308 1e-82
gi|1730208|sp|P52206|GB11_CANFA Guanine nucleotide-binding prote... 308 2e-82
gi|27532946|ref|NP_034441.1| guanine nucleotide binding protein,... 307 3e-82
gi|47230366|emb|CAF99559.1| unnamed protein product [Tetraodon n... 307 3e-82
gi|42725783|gb|AAS38579.1| guanine nucleotide-binding protein G(... 306 7e-82
gi|23336958|gb|AAH37333.1| Guanine nucleotide binding protein, a... 305 9e-82
gi|39587877|emb|CAE67895.1| Hypothetical protein CBG13491 [Caeno... 305 9e-82
gi|22382165|gb|AAH26342.1| Guanine nucleotide binding protein, a... 305 1e-81
gi|219669|dbj|BAA14180.1| Gx-alpha [Homo sapiens] 305 1e-81
gi|39580185|emb|CAE71591.1| Hypothetical protein CBG18548 [Caeno... 305 1e-81
gi|17562782|ref|NP_506290.1| ODoRant response abnormal ODR-3, he... 305 1e-81
gi|4504051|ref|NP_002064.1| guanine nucleotide binding protein, ... 305 2e-81
gi|30026294|gb|AAN78250.1| ODR-3 [Caenorhabditis briggsae] >gnl|... 304 2e-81
gi|30026270|gb|AAN78238.1| ODR-3 [Caenorhabditis elegans] 304 3e-81
gi|232140|sp|P30675|GBA1_COPCO Guanine nucleotide-binding protei... 304 3e-81
gi|7330345|gb|AAB24072.2| G-protein alpha i subunit [Homarus ame... 303 3e-81
gi|25144868|ref|NP_499921.2| G Protein, Alpha subunit (41.7 kD) ... 300 4e-80
gi|30026258|gb|AAN78232.1| ODR-3 [Caenorhabditis elegans] >gnl|B... 298 1e-79
gi|30923558|gb|EAA46036.1| CG17678-PA.3 [Drosophila melanogaster] 298 1e-79
gi|30026274|gb|AAN78240.1| ODR-3 [Caenorhabditis remanei] >gnl|B... 298 1e-79
gi|30026286|gb|AAN78246.1| ODR-3 [Caenorhabditis remanei] 298 2e-79
gi|30026256|gb|AAN78231.1| ODR-3 [Caenorhabditis elegans] >gnl|B... 298 2e-79
gi|120999|sp|P25157|GBAL_DROME Guanine nucleotide-binding protei... 297 2e-79
gi|38110454|gb|EAA56167.1| hypothetical protein MG01818.4 [Magna... 297 2e-79
gi|1730209|sp|P54853|GBA1_CRYNE Guanine nucleotide-binding prote... 297 2e-79
gi|2293542|gb|AAB65425.1| MAGA [Magnaporthe grisea] 297 3e-79
gi|563253|gb|AAA67707.1| guanine nucleotide regulatory protein 296 5e-79
gi|30026290|gb|AAN78248.1| ODR-3 [Caenorhabditis remanei] 296 5e-79
gi|30026254|gb|AAN78230.1| ODR-3 [Caenorhabditis elegans] >gnl|B... 296 5e-79
gi|5139715|dbj|BAA81701.1| G protein a subunit 5 [Ephydatia fluv... 296 7e-79
gi|48095213|ref|XP_394382.1| similar to ENSANGP00000004036 [Apis... 296 7e-79
gi|34147944|gb|AAQ62550.1| G-protein alpha subunit Cga2 [Cryptoc... 296 7e-79
gi|50260864|gb|EAL23514.1| hypothetical protein CNBA1610 [Crypto... 296 7e-79
gi|32408163|ref|XP_324563.1| GUANINE NUCLEOTIDE-BINDING PROTEIN ... 295 9e-79
gi|120988|sp|P16894|GBA1_DICDI Guanine nucleotide-binding protei... 295 9e-79
gi|30026292|gb|AAN78249.1| ODR-3 [Caenorhabditis remanei] 295 9e-79
gi|30026302|gb|AAN87175.1| ODR-3 [Caenorhabditis remanei] 295 9e-79
gi|30026276|gb|AAN78241.1| ODR-3 [Caenorhabditis remanei] 295 1e-78
gi|204444|gb|AAA41262.1| Guanine nucleotide-binding protein alph... 295 2e-78
gi|30026280|gb|AAN78243.1| ODR-3 [Caenorhabditis remanei] 295 2e-78
gi|4456856|emb|CAB36912.1| G protein alpha subunit [Sclerotinia ... 294 2e-78
gi|18654411|gb|AAL77627.1| G protein alpha subunit [Takifugu rub... 294 2e-78
gi|30026272|gb|AAN78239.1| ODR-3 [Caenorhabditis remanei] 294 2e-78
gi|47229911|emb|CAG10325.1| unnamed protein product [Tetraodon n... 294 2e-78
gi|18606326|gb|AAL57853.2| G protein alpha subunit [Sporothrix s... 293 4e-78
gi|30026262|gb|AAN78234.1| ODR-3 [Caenorhabditis elegans] 293 5e-78
gi|28372386|gb|AAO38051.1| G alpha subunit [Trichoderma viride] 293 5e-78
gi|47220675|emb|CAG06597.1| unnamed protein product [Tetraodon n... 293 5e-78
gi|49071686|ref|XP_400132.1| GBA2_USTMA Guanine nucleotide-bindi... 293 5e-78
gi|32140279|gb|AAO41857.1| G protein alpha subunit [Penicillium ... 293 5e-78
gi|50256632|gb|EAL19355.1| hypothetical protein CNBH0490 [Crypto... 293 5e-78
gi|5670092|gb|AAD46575.1| G-protein alpha-subunit [Filobasidiell... 293 5e-78
gi|14133507|gb|AAK54043.1| G protein alpha subunit 3 [Strongyloi... 293 6e-78
gi|25295770|pir||JC7660 G protein alpha subunit, Rga1 protein - ... 293 6e-78
gi|25012870|gb|AAN71523.1| RH09776p [Drosophila melanogaster] 292 1e-77
gi|40882505|gb|AAR96164.1| RE53936p [Drosophila melanogaster] 292 1e-77
gi|50753611|ref|XP_414065.1| PREDICTED: similar to guanine nucle... 291 1e-77
gi|46136197|ref|XP_389790.1| GBA3_NEUCR Guanine nucleotide-bindi... 291 2e-77
gi|31197857|ref|XP_307876.1| ENSANGP00000004036 [Anopheles gambi... 291 2e-77
gi|39579531|emb|CAE56865.1| Hypothetical protein CBG24698 [Caeno... 291 2e-77
gi|19577354|emb|CAD28435.1| probable g protein alpha subunit [As... 291 2e-77
gi|47825398|ref|NP_001001474.1| guanine nucleotide-binding prote... 290 5e-77
gi|21636308|gb|AAM69919.1| G protein alpha subunit Tga3 [Trichod... 290 5e-77
gi|39591966|emb|CAE75186.1| Hypothetical protein CBG23127 [Caeno... 290 5e-77
gi|42725833|gb|AAS38583.1| guanine nucleotide-binding protein G(... 289 7e-77
gi|49086174|ref|XP_405153.1| hypothetical protein AN1016.2 [Aspe... 289 7e-77
gi|14133505|gb|AAK54042.1| G protein alpha subunit 2 [Strongyloi... 288 1e-76
gi|585175|sp|Q05424|GBA2_NEUCR Guanine nucleotide-binding protei... 288 1e-76
gi|4101576|gb|AAD01207.1| G protein alpha subunit [Neurospora cr... 288 2e-76
gi|3273566|gb|AAC24766.1| MOD-D; G alpha protein [Podospora anse... 288 2e-76
gi|3913716|sp|O14438|GBA3_USTHO Guanine nucleotide-binding prote... 288 2e-76
gi|156321|gb|AAA28061.1| G protein alpha subunit 288 2e-76
gi|49077848|ref|XP_402738.1| GBA1_USTMA Guanine nucleotide-bindi... 287 3e-76
gi|17561832|ref|NP_505425.1| G Protein, Alpha subunit (40.6 kD) ... 287 3e-76
gi|30026296|gb|AAN78251.1| ODR-3 [Caenorhabditis briggsae] >gnl|... 287 3e-76
gi|31213965|ref|XP_315788.1| ENSANGP00000004423 [Anopheles gambi... 287 3e-76
gi|3913717|sp|O16118|GBAS_HOMAM Guanine nucleotide-binding prote... 286 4e-76
gi|23495476|dbj|BAC20192.1| G protein alpha subunit [Helicobasid... 286 7e-76
gi|34190601|gb|AAH30027.2| GNAO1 protein [Homo sapiens] 285 1e-75
gi|6754006|ref|NP_034432.1| guanine nucleotide binding protein, ... 284 3e-75
gi|25295772|pir||JC7662 G protein alpha subunit Rga3 protein - R... 284 3e-75
gi|13591953|ref|NP_112296.1| guanine nucleotide binding protein ... 283 4e-75
gi|5566083|gb|AAD45319.1| heterotrimeric G protein alpha subunit... 283 4e-75
gi|49076166|ref|XP_402089.1| GBA3_USTMA Guanine nucleotide-bindi... 283 5e-75
gi|39594585|emb|CAE72163.1| Hypothetical protein CBG19263 [Caeno... 283 5e-75
gi|20147695|gb|AAM12615.1| guanine nucleotide binding protein al... 283 5e-75
gi|182994|gb|AAA35867.1| Ga subunit 283 6e-75
gi|47550899|ref|NP_999968.1| GNAS complex locus [Danio rerio] >g... 282 1e-74
gi|5139723|dbj|BAA81705.1| G protein a subunit 9 [Ephydatia fluv... 282 1e-74
gi|40037204|gb|AAR37394.1| G-protein alpha subunit [Sporothrix s... 282 1e-74
gi|42476111|ref|NP_031379.2| guanine nucleotide binding protein ... 282 1e-74
gi|37524027|gb|AAQ92314.1| G-protein a-subunit s class [Pinctada... 281 1e-74
gi|39589328|emb|CAE74357.1| Hypothetical protein CBG22078 [Caeno... 281 2e-74
gi|2293546|gb|AAB65427.1| MAGC [Magnaporthe grisea] 281 2e-74
gi|31197465|ref|XP_307680.1| ENSANGP00000002249 [Anopheles gambi... 281 2e-74
gi|304324|gb|AAA28060.1| G protein alpha subunit 280 3e-74
gi|17481219|dbj|BAB79202.1| G protein alpha subunit s class [Hal... 280 4e-74
gi|4504043|ref|NP_002062.1| guanine nucleotide binding protein (... 279 7e-74
gi|47271350|ref|NP_034437.1| guanine nucleotide binding protein,... 279 7e-74
gi|5139705|dbj|BAA81696.1| G protein a subunit 4 [Hydra magnipap... 279 9e-74
gi|7441574|pir||T37245 GTP-binding regulatory protein Gs alpha-S... 279 9e-74
gi|17561828|ref|NP_505840.1| G Protein, Alpha subunit (40.7 kD) ... 279 9e-74
gi|25141265|ref|NP_490817.2| guanine nucleotide-binding protein ... 279 9e-74
gi|33641702|gb|AAQ24336.1| G-alpha subunit [Penicillium marneffei] 278 2e-73
gi|47218963|emb|CAF98161.1| unnamed protein product [Tetraodon n... 278 2e-73
gi|2851469|sp|P38406|GBAF_RAT Guanine nucleotide-binding protein... 277 3e-73
gi|48095594|ref|XP_394484.1| similar to ENSANGP00000009208 [Apis... 277 3e-73
gi|33695153|ref|NP_892023.1| guanine nucleotide binding protein ... 276 4e-73
gi|39645717|gb|AAH63735.1| MGC68706 protein [Xenopus laevis] 276 6e-73
gi|386745|gb|AAA53148.1| guanine nucleotide-binding protein G-s-... 276 6e-73
gi|45219789|gb|AAH66923.1| Guanine nucleotide binding protein (G... 276 6e-73
gi|13539549|emb|CAC35695.1| G protein alpha subunit [Oculimacula... 276 8e-73
gi|50758931|ref|XP_417485.1| PREDICTED: similar to MGC68706 prot... 275 1e-72
gi|17137798|ref|NP_477506.1| CG2835-PA [Drosophila melanogaster]... 275 1e-72
gi|47498042|ref|NP_998855.1| hypothetical protein MGC69295 [Xeno... 275 2e-72
gi|49904442|gb|AAH76540.1| Zgc:92392 protein [Danio rerio] 274 2e-72
gi|20259689|gb|AAM14395.1| G-protein alpha subunit CPG-3 [Crypho... 274 2e-72
gi|27465189|gb|AAN65182.1| G protein alpha subunit [Hypocrea vir... 274 2e-72
gi|38103784|gb|EAA50445.1| hypothetical protein MG04204.4 [Magna... 274 3e-72
gi|46136945|ref|XP_390164.1| hypothetical protein FG09988.1 [Gib... 274 3e-72
gi|232143|sp|P30669|GBAS_SCHMA Guanine nucleotide-binding protei... 273 4e-72
gi|17137796|ref|NP_477505.1| CG2835-PB [Drosophila melanogaster]... 273 4e-72
gi|71887|pir||RGMSA1 GTP-binding regulatory protein Gs alpha-S1 ... 273 4e-72
gi|49256367|gb|AAH74466.1| Unknown (protein for IMAGE:6950346) [... 273 5e-72
gi|1345099|gb|AAC49295.1| guanosine nucleotide binding protein a... 273 6e-72
gi|16215392|emb|CAC82735.1| G-protein alpha subunit [Xenopus lae... 272 8e-72
gi|18426900|ref|NP_536351.1| guanine nucleotide binding protein ... 272 8e-72
gi|121004|sp|P24799|GBAS_XENLA Guanine nucleotide-binding protei... 272 1e-71
gi|25295769|pir||D87723 protein R06A10.2 [imported] - Caenorhabd... 272 1e-71
gi|39596217|emb|CAE69854.1| Hypothetical protein CBG16182 [Caeno... 271 1e-71
gi|17568409|ref|NP_509557.1| G Protein, Alpha subunit (42.0 kD) ... 271 1e-71
gi|2982077|pdb|1AZS|C Chain C, Complex Of Gs-Alpha With The Cata... 271 1e-71
gi|232141|sp|P30684|GBAS_LYMST Guanine nucleotide-binding protei... 271 1e-71
gi|462162|sp|P34042|GBA4_DICDI Guanine nucleotide-binding protei... 271 1e-71
gi|13096682|pdb|1CUL|C Chain C, Complex Of Gs-Alpha With The Cat... 271 1e-71
gi|38181790|gb|AAH61496.1| Gnas protein [Mus musculus] 271 1e-71
gi|17298141|dbj|BAB78537.1| heterotrimeric G protein alpha subun... 271 2e-71
gi|47523682|ref|NP_999477.1| alpha-stimulatory subunit of GTP-bi... 271 2e-71
gi|1345097|gb|AAC98513.1| guanine nucleotide binding protein alp... 271 2e-71
gi|50257824|gb|EAL20525.1| hypothetical protein CNBE4450 [Crypto... 271 2e-71
gi|1730211|sp|P34043|GBA5_DICDI Guanine nucleotide-binding prote... 269 9e-71
gi|47222822|emb|CAF96489.1| unnamed protein product [Tetraodon n... 269 9e-71
gi|478708|pir||S27015 GTP-binding regulatory protein Gs alpha ch... 268 2e-70
gi|38505377|gb|AAQ74379.2| G-protein alpha subunit Gpa3 [Cryptoc... 268 2e-70
gi|5139717|dbj|BAA81702.1| G protein a subunit 6 [Ephydatia fluv... 268 2e-70
gi|30585277|gb|AAP36911.1| Homo sapiens GNAS complex locus [synt... 267 3e-70
gi|6137656|pdb|1CJK|C Chain C, Complex Of Gs-Alpha With The Cata... 267 3e-70
gi|121000|sp|P04896|GBAS_BOVIN Guanine nucleotide-binding protei... 267 3e-70
gi|31952|emb|CAA30084.1| unnamed protein product [Homo sapiens] 267 3e-70
gi|4504047|ref|NP_000507.1| guanine nucleotide binding protein (... 267 3e-70
gi|21749110|dbj|BAC03535.1| unnamed protein product [Homo sapiens] 267 4e-70
gi|2144866|pir||RGHUA2 GTP-binding regulatory protein Gs alpha c... 267 4e-70
gi|7416007|dbj|BAA93639.1| G protein a subunit s class [Octopus ... 267 4e-70
gi|120993|sp|P16051|GBA2_DICDI Guanine nucleotide-binding protei... 266 5e-70
gi|47228774|emb|CAG07506.1| unnamed protein product [Tetraodon n... 266 5e-70
gi|9506737|ref|NP_062005.1| GNAS complex locus; Guanine nucleoti... 266 5e-70
gi|121001|sp|P16052|GBAS_CRILO Guanine nucleotide-binding protei... 266 5e-70
gi|19702467|gb|AAL93256.1| guanine nucleotide-binding protein G(... 266 6e-70
gi|71881|pir||RGMSA2 GTP-binding regulatory protein Gs alpha-S2 ... 266 6e-70
gi|386748|gb|AAA52583.1| guanine nucleotide-binding protein alph... 266 8e-70
gi|49091532|ref|XP_407227.1| conserved hypothetical protein [Asp... 266 8e-70
gi|37538718|ref|XP_294370.2| guanine nucleotide binding protein,... 265 1e-69
gi|5139721|dbj|BAA81704.1| G protein a subunit 8 [Ephydatia fluv... 265 1e-69
gi|12057026|emb|CAC19872.1| G protein alpha subunit [Botryotinia... 265 1e-69
gi|71882|pir||RGBOGA GTP-binding regulatory protein Gs alpha-2 c... 264 3e-69
gi|39595606|emb|CAE67107.1| Hypothetical protein CBG12520 [Caeno... 263 4e-69
gi|4262551|gb|AAD14686.1| G-protein XLalphas [Mus musculus] 263 4e-69
gi|4973028|gb|AAD34893.1| G protein alpha subunit homolog GanAp ... 263 5e-69
gi|163130|gb|AAA30561.1| p-alpha-h subunit 262 9e-69
gi|19068016|gb|AAL11436.1| G-protein alpha subunit 1 [Phytophtho... 261 2e-68
gi|5566081|gb|AAD45318.1| heterotrimeric G protein alpha subunit... 261 2e-68
gi|41148050|ref|XP_374627.1| similar to Guanine nucleotide-bindi... 260 4e-68
gi|19068018|gb|AAL11437.1| G-protein alpha subunit 1 [Phytophtho... 259 1e-67
gi|739577|prf||2003375B guanine nucleotide-binding protein Gs al... 259 1e-67
gi|7507346|pir||T32578 hypothetical protein T07A9.7 - Caenorhabd... 259 1e-67
gi|17507903|ref|NP_492312.1| G Protein, Alpha subunit (40.9 kD) ... 258 1e-67
gi|11037746|gb|AAG27721.1| heterotrimeric G protein alpha subuni... 258 1e-67
gi|47271396|ref|NP_034439.2| guanine nucleotide binding protein ... 258 1e-67
gi|5139701|dbj|BAA81694.1| G protein a subunit 2 [Hydra magnipap... 258 2e-67
gi|28829380|gb|AAO51920.1| similar to Dictyostelium discoideum (... 258 2e-67
gi|18426898|ref|NP_536350.1| guanine nucleotide binding protein ... 257 4e-67
gi|50552836|ref|XP_503828.1| hypothetical protein [Yarrowia lipo... 256 5e-67
gi|14161099|emb|CAC39211.1| XLalphas protein [Rattus norvegicus] 256 8e-67
gi|1086315|pir||S52418 GTP-binding regulatory protein Gs alpha-X... 256 8e-67
gi|17561830|ref|NP_505157.1| G Protein, Alpha subunit (41.5 kD) ... 255 1e-66
gi|171615|gb|AAA34651.1| nucleotide-binding regulatory protein GPA2 254 2e-66
gi|6320858|ref|NP_010937.1| Nucleotide binding alpha subunit of ... 254 2e-66
gi|1092826|prf||2101292A G extra-large protein 254 2e-66
gi|18606296|gb|AAH22875.1| Similar to GNAS complex locus [Homo s... 254 3e-66
gi|32308993|gb|AAP79428.1| guanine nucleotide-binding protein Gs... 253 4e-66
gi|25295773|pir||D89605 protein F18G5.3 [imported] - Caenorhabdi... 253 4e-66
gi|1169856|sp|P34045|GBA7_DICDI Guanine nucleotide-binding prote... 253 7e-66
gi|5139719|dbj|BAA81703.1| G protein a subunit 7 [Ephydatia fluv... 252 9e-66
gi|11559293|dbj|BAB18737.1| heterotrimeric G protein alpha subun... 251 2e-65
gi|50543488|ref|XP_499910.1| hypothetical protein [Yarrowia lipo... 248 2e-64
gi|38112309|gb|AAR11244.1| guanine nucleotide-binding protein [M... 247 3e-64
gi|38112307|gb|AAR11243.1| guanine nucleotide-binding protein [P... 247 3e-64
gi|7505996|pir||T23705 hypothetical protein M04C7.1 - Caenorhabd... 247 4e-64
gi|30315958|sp|Q9XZV5|GBAS_GEOCY Guanine nucleotide-binding prot... 245 1e-63
gi|17561834|ref|NP_506160.1| G Protein, Alpha subunit (42.4 kD) ... 244 3e-63
gi|50426093|ref|XP_461643.1| unnamed protein product [Debaryomyc... 244 3e-63
gi|260897|gb|AAB24335.1| signal-transducing G protein alpha q su... 243 4e-63
gi|1730210|sp|P54111|GBA2_KLULA Guanine nucleotide-binding prote... 243 7e-63
gi|50307143|ref|XP_453550.1| GBA2_KLULA [Kluyveromyces lactis] >... 243 7e-63
gi|34875240|ref|XP_221066.2| similar to GTP-binding regulatory p... 242 9e-63
gi|260894|gb|AAB24332.1| signal-transducing G protein alpha q su... 242 1e-62
gi|3047015|gb|AAC13568.1| GTP binding protein Gz subunit alpha [... 241 3e-62
gi|1345101|gb|AAC49296.1| guanine nucleotide binding protein 241 3e-62
gi|39583868|emb|CAE63958.1| Hypothetical protein CBG08544 [Caeno... 238 1e-61
gi|4206776|gb|AAD11802.1| guanine nucleotide-binding protein [Ra... 238 2e-61
gi|17568407|ref|NP_510189.1| G Protein, Alpha subunit (42.1 kD) ... 238 2e-61
gi|6754016|ref|NP_034440.1| guanine nucleotide binding protein a... 238 2e-61
gi|39590325|emb|CAE66064.1| Hypothetical protein CBG11277 [Caeno... 236 5e-61
gi|479532|pir||S34421 GTP-binding regulatory protein Gs alpha ch... 236 5e-61
gi|17561838|ref|NP_504745.1| G Protein, Alpha subunit (41.6 kD) ... 236 7e-61
gi|39583178|emb|CAE61396.1| Hypothetical protein CBG05252 [Caeno... 235 1e-60
gi|50290345|ref|XP_447604.1| unnamed protein product [Candida gl... 234 2e-60
gi|19114715|ref|NP_593803.1| guanine nucleotide-binding protein ... 233 6e-60
gi|39580191|emb|CAE71597.1| Hypothetical protein CBG18556 [Caeno... 233 6e-60
gi|5139709|dbj|BAA81698.1| G protein a subunit 2 [Ephydatia fluv... 230 5e-59
gi|45185389|ref|NP_983106.1| ABR158Wp [Eremothecium gossypii] >g... 229 8e-59
gi|18249684|dbj|BAB83920.1| G protein alpha subunit Gq [Ciona in... 228 1e-58
gi|17481211|dbj|BAB79200.1| G protein alpha subunit x class [Hal... 227 3e-58
gi|17737609|ref|NP_524118.1| CG12232-PA [Drosophila melanogaster... 226 5e-58
gi|539073|pir||A46393 GTP-binding protein alpha chain gpa2 - fis... 226 7e-58
gi|31218047|ref|XP_316554.1| ENSANGP00000010043 [Anopheles gambi... 225 2e-57
gi|39594386|emb|CAE71964.1| Hypothetical protein CBG19035 [Caeno... 224 3e-57
gi|47229912|emb|CAG10326.1| unnamed protein product [Tetraodon n... 223 4e-57
gi|46443501|gb|EAL02782.1| hypothetical protein CaO19.9189 [Cand... 223 6e-57
gi|19112752|ref|NP_595960.1| guanine nucleotide-binding protein ... 223 6e-57
gi|1169857|sp|P34046|GBA8_DICDI Guanine nucleotide-binding prote... 222 1e-56
gi|45188027|ref|NP_984250.1| ADR153Cp [Eremothecium gossypii] >g... 222 1e-56
gi|1353512|gb|AAB01735.1| G protein alpha t1 (rod transducin) 221 2e-56
gi|50421049|ref|XP_459069.1| unnamed protein product [Debaryomyc... 221 3e-56
gi|6321792|ref|NP_011868.1| Involved in the mating pheromone sig... 221 3e-56
gi|7498003|pir||T29826 hypothetical protein C55H1.2 - Caenorhabd... 220 4e-56
gi|101032|pir||A41106 GTP-binding protein alpha chain gpa1 - fis... 219 6e-56
gi|46443866|gb|EAL03145.1| hypothetical protein CaO19.4015 [Cand... 219 8e-56
gi|173560|gb|AAA18403.1| putative. G-alpha-like protein 219 8e-56
gi|22476944|gb|AAM97353.1| G protein alpha II subunit [Pisum sat... 219 1e-55
gi|3913709|sp|O04279|GBA2_PEA Guanine nucleotide-binding protein... 218 2e-55
gi|542819|pir||JH0813 GTP-binding regulatory protein Gs alpha ch... 218 2e-55
gi|12230105|sp|Q9Y7B7|GBA1_KLULA Guanine nucleotide-binding prot... 218 2e-55
gi|22476942|gb|AAM97352.1| G protein alpha II subunit [Pisum sat... 217 3e-55
gi|323013|pir||A44384 GTP-binding regulatory protein G alpha cha... 216 9e-55
gi|1169855|sp|P28868|GBA1_CANAL Guanine nucleotide-binding prote... 216 9e-55
gi|10241503|emb|CAC09367.1| dJ543J19.1 (guanine nucleotide bindi... 215 2e-54
gi|3913724|sp|P93163|GBA2_SOYBN Guanine nucleotide-binding prote... 215 2e-54
gi|21165521|dbj|BAB93551.1| hypothetical protein [Mus musculus] 215 2e-54
gi|50312401|ref|XP_456234.1| GBA1_KLULA [Kluyveromyces lactis] >... 215 2e-54
gi|3334195|sp|Q40224|GBA1_LUPLU Guanine nucleotide-binding prote... 214 2e-54
gi|48101621|ref|XP_395172.1| similar to ENSANGP00000013560 [Apis... 214 3e-54
gi|5139699|dbj|BAA81693.1| G protein a subunit 1 [Hydra magnipap... 213 5e-54
gi|13936842|gb|AAK49966.1| inhibitory GTP-binding protein subuni... 213 5e-54
>gi|25145853|ref|NP_740789.1| G protein, class Q, Alpha subunit, EGg
Laying defective EGL-30 (41.9 kD) (egl-30)
[Caenorhabditis elegans]
gi|7441577|pir||T15288 hypothetical protein M01D7.7 - Caenorhabditis
elegans
gi|1354762|gb|AAB04059.1| EGL-30
gi|2105489|gb|AAB58071.1| Egg laying defective protein 30, isoform a
[Caenorhabditis elegans]
gi|13489243|gb|AAG32092.1| heterotrimeric G protein alpha subunit
[Caenorhabditis elegans]
Length = 355
Score = 711 bits (1836), Expect = 0.0
Identities = 355/355 (100%), Positives = 355/355 (100%)
Frame = +1
Query: 1 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG 180
MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG
Sbjct: 1 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG 60
Query: 181 YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF 360
YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF
Sbjct: 61 YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF 120
Query: 361 EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV 540
EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV
Sbjct: 121 EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV 180
Query: 541 PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN 720
PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN
Sbjct: 181 PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN 240
Query: 721 ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA 900
ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA
Sbjct: 241 ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA 300
Query: 901 AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV 1065
AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Sbjct: 301 AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV 355
>gi|39589436|emb|CAE74465.1| Hypothetical protein CBG22211
[Caenorhabditis briggsae]
Length = 355
Score = 701 bits (1808), Expect = 0.0
Identities = 349/355 (98%), Positives = 354/355 (99%)
Frame = +1
Query: 1 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG 180
MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG
Sbjct: 1 MACCLSEEAREQKRINQEIEKQLQRDKRNARRELKLLLLGTGESGKSTFIKQMRIIHGQG 60
Query: 181 YSEEDKRAHIRLVYQNVFMAIQSMIRAMDTLDIKFGNESEELQEKAAVVREVDFESVTSF 360
YS+EDKRAHIRLVYQNVFMAIQSMIRAMDTL I+FG++SEELQEKAAVVREVDFESVTSF
Sbjct: 61 YSDEDKRAHIRLVYQNVFMAIQSMIRAMDTLCIQFGDQSEELQEKAAVVREVDFESVTSF 120
Query: 361 EEPYVSYIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV 540
EEPYVS+IKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV
Sbjct: 121 EEPYVSFIKELWEDSGIQECYDRRREYQLTDSAKYYLSDLRRLAVPDYLPTEQDILRVRV 180
Query: 541 PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN 720
PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN
Sbjct: 181 PTTGIIEYPFDLEQIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVECDN 240
Query: 721 ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA 900
ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA
Sbjct: 241 ENRMEESKALFRTIITYPWFTNSSVILFLNKKDLLEEKILYSHLADYFPEYDGPPRDPIA 300
Query: 901 AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV 1065
AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV
Sbjct: 301 AREFILKMFVDLNPDADKIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNLV 355