Homology by BLASTX
BLASTX 2.2.4 [Aug-26-2002]
Query= M01B12_1
(459 letters)
Database: /home/niguts/usr02/tshini/ykclst/db/nr.seq
1,967,186 sequences; 661,712,633 total letters
Score E
Sequences producing significant alignments: (bits) Value
gi|17508293|ref|NP_491099.1| actin related protein 2 3 complex 1... 300 3e-81
gi|39595534|emb|CAE60572.1| Hypothetical protein CBG04201 [Caeno... 282 9e-76
gi|39583613|emb|CAE65717.1| Hypothetical protein CBG10797 [Caeno... 162 1e-39
gi|17506047|ref|NP_491506.1| actin related protein 2 3 complex 1... 147 4e-35
gi|11121262|emb|CAC14790.1| actin related protein 2/3 protein co... 125 2e-28
gi|47271435|ref|NP_919359.2| actin related protein 2/3 complex, ... 116 8e-26
gi|41393173|ref|NP_958917.1| actin related protein 2/3 complex, ... 115 2e-25
gi|18026580|gb|AAL55526.1| Arp2/3 complex 16kDa subunit [Danio r... 110 6e-24
gi|17943205|pdb|1K8K|G Chain G, Crystal Structure Of Arp23 COMPLEX 109 1e-23
gi|33150554|gb|AAP97155.1| ARC16-2 [Homo sapiens] 109 1e-23
gi|5031593|ref|NP_005708.1| actin related protein 2/3 complex su... 108 2e-23
gi|34880487|ref|XP_341132.1| similar to ARP2/3 complex 16 kDa su... 108 2e-23
gi|12847411|dbj|BAB27558.1| unnamed protein product [Mus musculu... 108 3e-23
gi|27683177|ref|XP_237111.1| similar to RIKEN cDNA 2010015J01 [R... 107 5e-23
gi|21312654|ref|NP_083085.1| actin related protein 2/3 complex, ... 107 6e-23
gi|47222194|emb|CAG11620.1| unnamed protein product [Tetraodon n... 106 1e-22
gi|13385866|ref|NP_080645.1| actin related protein 2/3 complex, ... 105 1e-22
gi|13569956|ref|NP_112240.1| actin related protein 2/3 complex, ... 104 3e-22
gi|34785663|gb|AAH57237.1| ARPC5 protein [Homo sapiens] 103 5e-22
gi|19920586|ref|NP_608693.1| CG9881-PA [Drosophila melanogaster]... 103 9e-22
gi|49258016|gb|AAH74279.1| Unknown (protein for MGC:84053) [Xeno... 97 7e-20
gi|47215613|emb|CAG11644.1| unnamed protein product [Tetraodon n... 96 1e-19
gi|41053796|ref|NP_956872.1| hypothetical protein MGC65881 [Dani... 96 1e-19
gi|50414831|gb|AAH77328.1| Unknown (protein for MGC:80296) [Xeno... 92 2e-18
gi|29841470|gb|AAP06502.1| similar to GenBank Accession Number A... 86 2e-16
gi|31237615|ref|XP_319641.1| ENSANGP00000013934 [Anopheles gambi... 86 2e-16
gi|38080124|ref|XP_356911.1| similar to actin related protein 2/... 85 3e-16
gi|38049444|ref|XP_356577.1| similar to actin related protein 2/... 85 3e-16
gi|20825588|ref|XP_123523.1| actin related protein 2/3 complex, ... 83 1e-15
gi|4093171|gb|AAC99781.1| p16-Arc [Dictyostelium discoideum] 79 2e-14
gi|50552776|ref|XP_503798.1| hypothetical protein [Yarrowia lipo... 76 2e-13
gi|49071428|ref|XP_400003.1| hypothetical protein UM02388.1 [Ust... 75 4e-13
gi|50757107|ref|XP_415381.1| PREDICTED: similar to actin related... 73 1e-12
gi|50260995|gb|EAL23645.1| hypothetical protein CNBA2920 [Crypto... 66 2e-10
gi|45187812|ref|NP_984035.1| ADL061Wp [Eremothecium gossypii] >g... 59 3e-08
gi|18411708|ref|NP_567216.1| actin polymerization factor protein... 57 6e-08
gi|25407123|pir||A85022 probable actin polymerization factor [im... 57 6e-08
gi|50305193|ref|XP_452555.1| unnamed protein product [Kluyveromy... 57 1e-07
gi|50424689|ref|XP_460934.1| unnamed protein product [Debaryomyc... 56 1e-07
gi|50294958|ref|XP_449890.1| unnamed protein product [Candida gl... 55 3e-07
gi|6322127|ref|NP_012202.1| Arp complex subunit; Arc15p [Sacchar... 54 6e-07
gi|46433738|gb|EAK93169.1| hypothetical protein CaO19.6151 [Cand... 54 8e-07
gi|50751204|ref|XP_426631.1| PREDICTED: similar to hypothetical ... 50 1e-05
gi|38107596|gb|EAA53745.1| hypothetical protein MG09495.4 [Magna... 41 0.004
gi|40074463|gb|AAR39439.1| kinesin family member 10 [Dictyosteli... 38 0.037
gi|32404166|ref|XP_322696.1| Arp2/3 complex subunit homolog ARC1... 38 0.048
gi|46107878|ref|XP_380998.1| hypothetical protein FG00822.1 [Gib... 37 0.081
gi|49095190|ref|XP_409056.1| hypothetical protein AN4919.2 [Aspe... 37 0.081
gi|10443347|emb|CAC10445.1| CDC2L5 protein kinase [Sphaerechinus... 35 0.31
gi|23123970|ref|ZP_00105992.1| COG1413: FOG: HEAT repeat [Nostoc... 34 0.69
gi|1362587|pir||S56117 spermatid-specific protein T2 precursor -... 33 0.90
gi|46435291|gb|EAK94676.1| hypothetical protein CaO19.3685 [Cand... 33 0.90
gi|49903691|gb|AAH76839.1| Unknown (protein for MGC:83887) [Xeno... 33 1.2
gi|37534470|ref|NP_921537.1| putative polyprotein [Oryza sativa ... 33 1.2
gi|46561796|gb|AAT01117.1| rpL23-ScFv fusion protein [rpL23-fusi... 33 1.5
gi|46561784|gb|AAT01108.1| rpL23-GFP fusion protein [rpL23-fusio... 33 1.5
gi|46561792|gb|AAT01114.1| rpL23-SA fusion protein [rpL23-fusion... 33 1.5
gi|46561776|gb|AAT01102.1| rpL23-yEF1A fusion protein [rpL23-fus... 33 1.5
gi|46561788|gb|AAT01111.1| rpL23 [Expression vector prpL23] 33 1.5
gi|46561780|gb|AAT01105.1| rpL23-mIL-6 fusion protein [rpL23-fus... 33 1.5
gi|15803845|ref|NP_289879.1| 50S ribosomal subunit protein L23 [... 33 1.5
gi|45269285|gb|AAS56022.1| YDR173C [Saccharomyces cerevisiae] 33 1.5
gi|6320378|ref|NP_010458.1| Regulator of arginine-responsive gen... 33 1.5
gi|19115303|ref|NP_594391.1| possible trna-ribosyltransferase [S... 32 2.0
gi|14423985|sp|Q9V2T3|THSB_DESMO Thermosome beta subunit (Thermo... 32 2.0
gi|23472820|ref|ZP_00128141.1| COG1609: Transcriptional regulato... 32 2.0
gi|16762845|ref|NP_458462.1| 50S ribosomal subunit protein L23 [... 32 2.0
gi|22325703|ref|NP_179186.2| expressed protein [Arabidopsis thal... 32 2.0
gi|27924003|sp|O14095|YERC_SCHPO Hypothetical UPF0071 protein C2... 32 2.0
gi|45198934|ref|NP_985963.1| AFR416Cp [Eremothecium gossypii] >g... 32 2.6
gi|48104064|ref|XP_395706.1| similar to ENSANGP00000011635 [Apis... 32 2.6
gi|50421815|ref|XP_459465.1| unnamed protein product [Debaryomyc... 32 2.6
gi|295641|gb|AAA99926.1| Saccharomyces cerevisiae phosphoinositi... 32 2.6
gi|50122949|ref|YP_052116.1| 50S ribosomal subunit protein L23 [... 32 2.6
gi|6324986|ref|NP_015054.1| Karyogamy protein required for corre... 32 2.6
gi|16081234|ref|NP_393538.1| conserved hypothetical protein [The... 32 3.4
gi|15238336|ref|NP_196102.1| ovate family protein [Arabidopsis t... 32 3.4
gi|29246091|gb|EAA37701.1| GLP_216_13546_15360 [Giardia lamblia ... 31 4.5
gi|49095664|ref|XP_409293.1| hypothetical protein AN5156.2 [Aspe... 31 4.5
gi|15605400|ref|NP_220186.1| hypothetical protein CT667 [Chlamyd... 31 4.5
gi|15900761|ref|NP_345365.1| SpoE family protein [Streptococcus ... 31 5.8
gi|18310109|ref|NP_562043.1| phage-related hypothetical protein ... 31 5.8
gi|38567868|emb|CAE03019.3| OSJNBa0091D06.9 [Oryza sativa (japon... 31 5.8
gi|49088024|ref|XP_405883.1| hypothetical protein AN1746.2 [Aspe... 31 5.8
gi|47570486|ref|ZP_00241118.1| major capsid protein gpP [Bacillu... 31 5.8
gi|7023975|dbj|BAA92143.1| 120-kDa protein [Sarcophaga peregrina] 31 5.8
gi|16120549|ref|NP_403862.1| 50S ribosomal protein L23 [Yersinia... 31 5.8
gi|47229254|emb|CAG04006.1| unnamed protein product [Tetraodon n... 31 5.8
gi|32822796|gb|AAH55260.1| Wu:fb44b08 protein [Danio rerio] 31 5.8
gi|46447153|ref|YP_008518.1| probable alanyl-tRNA synthetase [Pa... 31 5.8
gi|46913609|emb|CAG20395.1| putative deacetylase [Photobacterium... 31 5.8
gi|30103020|gb|AAP21433.1| putative polyprotein [Oryza sativa (j... 30 7.6
gi|40786519|ref|NP_955463.1| ribosome binding protein 1 homolog ... 30 7.6
gi|34876995|ref|XP_224617.2| similar to PalBH [Rattus norvegicus] 30 7.6
gi|46811891|gb|AAT02189.1| PHO80-like cyclin [Emericella nidulans] 30 7.6
gi|2498896|sp|Q60563|SCP1_MESAU Synaptonemal complex protein 1 (... 30 7.6
gi|34905854|ref|NP_914274.1| putative polyprotein [Oryza sativa ... 30 7.6
gi|37528541|ref|NP_931886.1| 50S ribosomal protein L23 [Photorha... 30 7.6
gi|47938331|gb|AAH71857.1| Unknown (protein for MGC:88523) [Homo... 30 7.6
gi|41469393|gb|AAS07216.1| putative retrotransposon gag protein... 30 7.6
gi|32489382|emb|CAE04228.1| OSJNBa0011F23.1 [Oryza sativa (japon... 30 7.6
gi|9754771|gb|AAF98068.1| agglutinin-like protein Als7p [Candida... 30 7.6
gi|50808525|ref|XP_424604.1| PREDICTED: similar to hypothetical ... 30 7.6
gi|32417930|ref|XP_329443.1| hypothetical protein [Neurospora cr... 30 7.6
gi|50119041|ref|YP_048208.1| methyl-accepting chemotaxis protein... 30 10.0
gi|38082993|ref|XP_110186.2| similar to axonemal dynein heavy ch... 30 10.0
gi|46391139|gb|AAS90666.1| putative polyprotein [Oryza sativa (j... 30 10.0
gi|14335448|gb|AAK60622.1| axonemal dynein heavy chain 8 short f... 30 10.0
gi|14335452|gb|AAK60624.1| axonemal dynein heavy chain 8 short f... 30 10.0
gi|7496919|pir||T19683 hypothetical protein C33D9.6 - Caenorhabd... 30 10.0
gi|7656959|ref|NP_055111.1| calpain 7; calpain like protease; ho... 30 10.0
gi|33440539|gb|AAH56202.1| Calpain 7 [Homo sapiens] 30 10.0
gi|15229144|ref|NP_189859.1| Ulp1 protease family protein [Arabi... 30 10.0
gi|13310482|gb|AAK18309.1| axonemal dynein heavy chain 8 Dnahc8 ... 30 10.0
gi|49097506|ref|XP_410213.1| hypothetical protein AN6076.2 [Aspe... 30 10.0
gi|38110180|gb|EAA55941.1| hypothetical protein MG01592.4 [Magna... 30 10.0
gi|15029526|ref|NP_001362.1| dynein, axonemal, heavy polypeptide... 30 10.0
gi|14335446|gb|AAK60621.1| axonemal dynein heavy chain 8 long fo... 30 10.0
gi|34328061|ref|NP_038839.1| dynein, axonemal, heavy chain 8; dy... 30 10.0
gi|23509291|ref|NP_701958.1| hypothetical protein [Plasmodium fa... 30 10.0
gi|45476724|gb|AAS65970.1| E1A 13S protein [Human adenovirus typ... 30 10.0
gi|17538980|ref|NP_501515.1| putative nuclear protein family mem... 30 10.0
>gi|17508293|ref|NP_491099.1| actin related protein 2 3 complex
16kDa, Actin Related protein 2/3 compleX component ARX-7
(arx-7) [Caenorhabditis elegans]
gi|7505855|pir||T33169 hypothetical protein M01B12.3 -
Caenorhabditis elegans
gi|3158519|gb|AAC17561.1| Arp2/3 complex component protein 7
[Caenorhabditis elegans]
Length = 152
Score = 300 bits (769), Expect = 3e-81
Identities = 152/152 (100%), Positives = 152/152 (100%)
Frame = -1
Query: 459 MSKNMQNTSYRKLDVDSFDPEQYDENDETVDTPGLGPDERAVQGFLSSNRLEDALHAALL 280
MSKNMQNTSYRKLDVDSFDPEQYDENDETVDTPGLGPDERAVQGFLSSNRLEDALHAALL
Sbjct: 1 MSKNMQNTSYRKLDVDSFDPEQYDENDETVDTPGLGPDERAVQGFLSSNRLEDALHAALL 60
Query: 279 SPPLKTKDQNVKDRATQLVTKVLQSFKNAEIEATVQKLSIEESDILMKYVYKSMEIGADA 100
SPPLKTKDQNVKDRATQLVTKVLQSFKNAEIEATVQKLSIEESDILMKYVYKSMEIGADA
Sbjct: 61 SPPLKTKDQNVKDRATQLVTKVLQSFKNAEIEATVQKLSIEESDILMKYVYKSMEIGADA 120
Query: 99 AVCQSLLAWHAQLVAKFGHGAIMRVFSGRQRL 4
AVCQSLLAWHAQLVAKFGHGAIMRVFSGRQRL
Sbjct: 121 AVCQSLLAWHAQLVAKFGHGAIMRVFSGRQRL 152